F382359

General Info

Members Datasets Scaffolds Average Seq Length
278 185 556 160

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_11287297|Ga0114129_112872972
Length 179
Sequence MLASTTHAEIAKLAEITDLALRSWRAAVVAAMVLFVAAPAAADVTGFIGANTTPANRRTQGFSLGAGLLLLGFEFEYANTPDDPDSASPALRSGSGNVLLQTPFAILGIQPYVTTGGGVYRETLGSRIQTGFALNNGAGVKINLIGPVRLRVDYRAFRLGDGALHSPAHRVYAGLNLKF

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
120 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
121 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
122 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
125 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
126 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
127 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
128 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
130 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
131 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
135 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
136 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.6
Rhizosphere 96.04
Stem 0
Stem Tuber 0
Unclassified 26.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_11287297 3300009147 Bacteria 907
2 JGI24751J29686_10002504 3300002459 Bacteria 3696
3 Ga0058862_12782733 3300004803 Unclassified 2006
4 Ga0065712_10200069 3300005290 Bacteria 1090
5 Ga0065715_10162330 3300005293 Bacteria 1617
6 Ga0065707_10138943 3300005295 Unclassified 1799
7 Ga0070676_10123721 3300005328 Bacteria 1627
8 Ga0070690_100164120 3300005330 Bacteria 1524
9 Ga0070677_10083264 3300005333 Bacteria 1374
10 Ga0068869_100841023 3300005334 Unclassified 791
11 Ga0070680_100204723 3300005336 Bacteria 1664
12 Ga0068868_100105818 3300005338 Bacteria 2282
13 Ga0070689_100075690 3300005340 Bacteria 2636
14 Ga0070687_100260982 3300005343 Bacteria 1081
15 Ga0070669_101507797 3300005353 Bacteria 584
16 Ga0070671_100478341 3300005355 Bacteria 1070
17 Ga0070674_100160063 3300005356 Bacteria 1707
18 Ga0070674_100391013 3300005356 Bacteria 1134
19 Ga0070674_101551347 3300005356 Unclassified 596
20 Ga0070673_100228505 3300005364 Bacteria 1613
21 Ga0070673_101149477 3300005364 Bacteria 726
22 Ga0070659_100038976 3300005366 Unclassified 3708
23 Ga0070709_10412400 3300005434 Unclassified 1011
24 Ga0070709_10457182 3300005434 Bacteria 963
25 Ga0070713_100055885 3300005436 Bacteria 3282
26 Ga0070700_100557985 3300005441 Unclassified 891
27 Ga0070694_100174451 3300005444 Bacteria 1586
28 Ga0070694_100563914 3300005444 Unclassified 913
29 Ga0070678_100559130 3300005456 Bacteria 1016
30 Ga0070681_10007768 3300005458 Bacteria 10486
31 Ga0070681_10203984 3300005458 Bacteria 1895
32 Ga0068867_100584695 3300005459 Bacteria 972
33 Ga0068867_100761075 3300005459 Unclassified 860
34 Ga0070685_10130279 3300005466 Unclassified 1572
35 Ga0070685_10310532 3300005466 Bacteria 1065
36 Ga0070706_100675803 3300005467 Unclassified 958
37 Ga0070698_100057855 3300005471 Bacteria 3922
38 Ga0070698_100343087 3300005471 Bacteria 1425
39 Ga0070698_100565192 3300005471 Bacteria 1077
40 Ga0070699_100366934 3300005518 Unclassified 1298
41 Ga0070679_100223631 3300005530 Unclassified 1843
42 Ga0070679_100279358 3300005530 Bacteria 1623
43 Ga0070684_100045081 3300005535 Bacteria 3818
44 Ga0070697_100985628 3300005536 Archaea 749
45 Ga0068853_100264155 3300005539 Unclassified 1583
46 Ga0070672_100404316 3300005543 Bacteria 1171
47 Ga0070686_100001161 3300005544 Bacteria 15057
48 Ga0070686_100030785 3300005544 Bacteria 3276
49 Ga0070686_100115391 3300005544 Bacteria 1836
50 Ga0070696_100285211 3300005546 Bacteria 1260
51 Ga0070693_100095519 3300005547 Bacteria 1800
52 Ga0070665_100018624 3300005548 Bacteria 6959
53 Ga0068855_100481244 3300005563 Unclassified 1351
54 Ga0068855_100984306 3300005563 Unclassified 887
55 Ga0068857_100415169 3300005577 Unclassified 1254
56 Ga0068857_100536294 3300005577 Bacteria 1101
57 Ga0068856_100301156 3300005614 Unclassified 1621
58 Ga0068859_100023843 3300005617 Bacteria 6143
59 Ga0068859_100122706 3300005617 Bacteria 2665
60 Ga0068864_100434680 3300005618 Bacteria 1253
61 Ga0068866_10847334 3300005718 Unclassified 639
62 Ga0068858_100005989 3300005842 Bacteria 11873
63 Ga0068860_100344339 3300005843 Unclassified 1466
64 Ga0068862_100166610 3300005844 Bacteria 1970
65 Ga0068862_100583405 3300005844 Bacteria 1071
66 Ga0068862_100766117 3300005844 Unclassified 940
67 Ga0068862_101912120 3300005844 Unclassified 603
68 Ga0081455_10186383 3300005937 Bacteria 1567
69 Ga0075432_10312905 3300006058 Unclassified 655
70 Ga0097621_100001862 3300006237 Bacteria 14468
71 Ga0097621_100017338 3300006237 Bacteria 5467
72 Ga0097621_100248331 3300006237 Bacteria 1557
73 Ga0097621_100263972 3300006237 Unclassified 1511
74 Ga0097621_101890532 3300006237 Unclassified 569
75 Ga0068871_100000536 3300006358 Bacteria 25860
76 Ga0068871_100244853 3300006358 Bacteria 1560
77 Ga0068871_100572940 3300006358 Unclassified 1024
78 Ga0075428_100524879 3300006844 Bacteria 1266
79 Ga0075428_100601109 3300006844 Bacteria 1175
80 Ga0075431_100135936 3300006847 Unclassified 2534
81 Ga0075431_101807113 3300006847 Unclassified 567
82 Ga0075433_10006686 3300006852 Bacteria 9132
83 Ga0075433_10080014 3300006852 Bacteria 2880
84 Ga0075434_100035927 3300006871 Bacteria 4899
85 Ga0075434_100150335 3300006871 Unclassified 2349
86 Ga0075434_100162798 3300006871 Bacteria 2251
87 Ga0075434_100170670 3300006871 Bacteria 2195
88 Ga0075429_100254869 3300006880 Bacteria 1536
89 Ga0075429_100710407 3300006880 Unclassified 880
90 Ga0068865_100283635 3300006881 Bacteria 1319
91 Ga0075436_100591164 3300006914 Unclassified 817
92 Ga0097620_100023843 3300006931 Bacteria 6143
93 Ga0097620_100122712 3300006931 Bacteria 2665
94 Ga0097620_100342969 3300006931 Bacteria 1588
95 Ga0075435_100003133 3300007076 Bacteria 11173
96 Ga0075435_100025811 3300007076 Bacteria 4578
97 Ga0099795_10109418 3300007788 Bacteria 1093
98 Ga0105240_10609148 3300009093 Bacteria 1201
99 Ga0111539_10005935 3300009094 Bacteria 15774
100 Ga0111539_10327950 3300009094 Bacteria 1782
101 Ga0111539_10483309 3300009094 Bacteria 1442
102 Ga0105245_10009333 3300009098 Bacteria 8556
103 Ga0114129_10058770 3300009147 Bacteria 5379
104 Ga0114129_10109700 3300009147 Bacteria 3809
105 Ga0114129_11792379 3300009147 Unclassified 747
106 Ga0105243_10798299 3300009148 Bacteria 930
107 Ga0105242_10105263 3300009176 Bacteria 2396
108 Ga0105248_10234375 3300009177 Bacteria 2066
109 Ga0105248_10318443 3300009177 Bacteria 1752
110 Ga0105248_10552639 3300009177 Unclassified 1299
111 Ga0105248_10826776 3300009177 Bacteria 1045
112 Ga0105248_12146378 3300009177 Bacteria 635
113 Ga0105238_10342453 3300009551 Bacteria 1483
114 Ga0105239_12146419 3300010375 Bacteria 649
115 Ga0157374_11881657 3300013296 Unclassified 624
116 Ga0157378_10007456 3300013297 Bacteria 9558
117 Ga0163162_10817794 3300013306 Bacteria 1048
118 Ga0163162_11380832 3300013306 Unclassified 801
119 Ga0163162_12032984 3300013306 Unclassified 659
120 Ga0157375_10082985 3300013308 Unclassified 3248
121 Ga0163163_10015334 3300014325 Bacteria 7083
122 Ga0157380_10874927 3300014326 Bacteria 922
123 Ga0157379_10082741 3300014968 Bacteria 2876
124 Ga0157379_10366683 3300014968 Unclassified 1320
125 Ga0157379_10371269 3300014968 Bacteria 1312
126 Ga0157376_10084639 3300014969 Bacteria 2731
127 Ga0157376_10126438 3300014969 Unclassified 2274
128 Ga0207697_10044048 3300025315 Bacteria 1835
129 Ga0207682_10082124 3300025893 Bacteria 1383
130 Ga0207642_10660733 3300025899 Unclassified 656
131 Ga0207642_11027788 3300025899 Bacteria 531
132 Ga0207699_10413051 3300025906 Bacteria 963
133 Ga0207645_10311952 3300025907 Bacteria 1048
134 Ga0207684_10722113 3300025910 Bacteria 846
135 Ga0207707_10058722 3300025912 Bacteria 3347
136 Ga0207695_10888656 3300025913 Bacteria 771
137 Ga0207663_10151449 3300025916 Bacteria 1627
138 Ga0207662_10440885 3300025918 Bacteria 889
139 Ga0207652_10207142 3300025921 Unclassified 1765
140 Ga0207652_10318996 3300025921 Bacteria 1403
141 Ga0207646_10096126 3300025922 Unclassified 2654
142 Ga0207681_11411250 3300025923 Bacteria 584
143 Ga0207694_10335020 3300025924 Unclassified 1251
144 Ga0207694_10733922 3300025924 Unclassified 833
145 Ga0207687_10044990 3300025927 Bacteria 3050
146 Ga0207700_11713161 3300025928 Unclassified 554
147 Ga0207690_10032288 3300025932 Bacteria 3358
148 Ga0207686_10003504 3300025934 Bacteria 8430
149 Ga0207670_10180039 3300025936 Bacteria 1592
150 Ga0207669_10052087 3300025937 Bacteria 2457
151 Ga0207669_10927966 3300025937 Unclassified 728
152 Ga0207669_11558063 3300025937 Bacteria 564
153 Ga0207704_10007840 3300025938 Bacteria 5067
154 Ga0207711_10101082 3300025941 Bacteria 2551
155 Ga0207711_10345975 3300025941 Bacteria 1376
156 Ga0207711_10537411 3300025941 Bacteria 1090
157 Ga0207661_10056362 3300025944 Bacteria 3155
158 Ga0207667_10895954 3300025949 Bacteria 879
159 Ga0207651_10096404 3300025960 Unclassified 2181
160 Ga0207651_10135784 3300025960 Unclassified 1892
161 Ga0207712_10207778 3300025961 Bacteria 1557
162 Ga0207677_10349689 3300026023 Bacteria 1238
163 Ga0207703_10295529 3300026035 Bacteria 1475
164 Ga0207641_11903822 3300026088 Unclassified 596
165 Ga0207648_10097825 3300026089 Bacteria 2569
166 Ga0207676_10036243 3300026095 Bacteria 3751
167 Ga0207674_10096037 3300026116 Bacteria 2949
168 Ga0207675_100112474 3300026118 Bacteria 2570
169 Ga0207683_10040569 3300026121 Bacteria 4063
170 Ga0207683_10123666 3300026121 Bacteria 2324
171 Ga0207428_10098952 3300027907 Bacteria 2256
172 Ga0207428_11008874 3300027907 Unclassified 585
173 Ga0268266_10015169 3300028379 Bacteria 6615
174 Ga0268266_11109812 3300028379 Unclassified 765
175 Ga0268265_10200543 3300028380 Bacteria 1731
176 Ga0268264_10106759 3300028381 Bacteria 2445
177 Ga0268264_10716386 3300028381 Unclassified 995
178 Ga0265332_10042688 3300031238 Bacteria 1960
179 Ga0265316_10657520 3300031344 Bacteria 741
180 Ga0373948_0006377 3300034817 Bacteria 1948
181 Ga0373938_0000954 3300034957 Bacteria 4637
182 Ga0373926_0130698 3300035083 Bacteria 951
183 Ga0373929_0001191 3300035085 Bacteria 5032
184 Ga0373934_0022385 3300035086 Bacteria 2438
185 Ga0373934_0072073 3300035086 Bacteria 1383
186 Ga0373940_0003478 3300035088 Bacteria 3220
187 Ga0373949_0000162 3300035090 Bacteria 25518
188 Ga0373951_0000272 3300035091 Bacteria 16526
189 Ga0373952_0000111 3300035092 Bacteria 11097
190 Ga0373923_0007779 3300035111 Bacteria 3787
191 Ga0373932_0000163 3300035112 Bacteria 19481
192 Ga0373941_0001779 3300035115 Bacteria 4634
193 Ga0373941_0027560 3300035115 Bacteria 1660
194 Ga0373953_0079603 3300035117 Bacteria 1361
195 Ga0373956_0278286 3300035119 Bacteria 796
196 Ga0373955_0072431 3300035172 Bacteria 1930
197 Ga0373942_0000021 3300035207 Bacteria 30804
198 Ga0373961_0004591 3300035241 Bacteria 3333
199 Ga0373962_0001134 3300035242 Bacteria 6224
200 Ga0373931_0000446 3300035691 Bacteria 16799
201 Ga0373935_0028206 3300035692 Bacteria 3470
202 Ga0373935_0509123 3300035692 Bacteria 875
203 Ga0373927_0073640 3300035695 Bacteria 2212
204 Ga0373933_0682604 3300035724 Bacteria 675
205 Ga0373947_0007831 3300035725 Bacteria 6172
206 Ga0373947_0593829 3300035725 Bacteria 754
207 Ga0373937_0158899 3300036401 Bacteria 2119
208 Ga0373937_0357792 3300036401 Bacteria 1383
209 Ga0373937_0420102 3300036401 Unclassified 1269
210 Ga0373937_0571622 3300036401 Unclassified 1074
211 Ga0373937_1869111 3300036401 Unclassified 547
212 Ga0373925_0047823 3300037068 Unclassified 3186
213 Ga0373925_0063681 3300037068 Unclassified 2775
214 Ga0436365_0245567 3300039437 Bacteria 1168
215 Ga0439435_0029973 3300042436 Bacteria 1472
216 Ga0451576_0021152 3300045051 Bacteria 7072
217 Ga0451576_0109631 3300045051 Bacteria 2873
218 Ga0495651_0532844 3300046462 Bacteria 748
219 Ga0495580_0067547 3300046472 Bacteria 2501
220 Ga0495582_0019581 3300046473 Bacteria 3702
221 Ga0495608_0005249 3300046511 Bacteria 9255
222 Ga0495608_0893042 3300046511 Unclassified 520
223 Ga0495628_0031433 3300046516 Bacteria 4294
224 Ga0495630_0019767 3300046517 Bacteria 4955
225 Ga0495621_0012103 3300046539 Bacteria 2685
226 Ga0495645_0018277 3300046543 Bacteria 5033
227 Ga0495667_0500403 3300046559 Bacteria 761
228 Ga0495657_0097002 3300046675 Bacteria 1883
229 Ga0495623_0112473 3300046679 Bacteria 1649
230 Ga0495647_0133558 3300046681 Unclassified 1053
231 Ga0495658_0078795 3300046683 Unclassified 1929
232 Ga0495669_0061585 3300046684 Bacteria 1698
233 Ga0495613_0000291 3300046689 Bacteria 46041
234 Ga0495613_0334038 3300046689 Bacteria 1044
235 Ga0495624_0279200 3300046690 Bacteria 1009
236 Ga0495600_0725458 3300046809 Bacteria 596
237 Ga0495604_0020760 3300047317 Bacteria 5245
238 Ga0495604_0658235 3300047317 Unclassified 668
239 Ga0495674_0081718 3300047319 Bacteria 2771
240 Ga0495684_0000138 3300047471 Bacteria 53459
241 Ga0496100_0571870 3300048903 Unclassified 876
242 Ga0496104_0496910 3300048907 Unclassified 1131
243 Ga0496104_1133846 3300048907 Unclassified 685
244 Ga0496105_0308825 3300048908 Unclassified 1270
245 Ga0496106_0639278 3300048909 Unclassified 851
246 Ga0496108_0102127 3300048911 Unclassified 2447
247 Ga0496112_0109688 3300048915 Bacteria 2730
248 Ga0496112_0184828 3300048915 Unclassified 2048
249 Ga0496114_0289118 3300048917 Bacteria 1446
250 Ga0496114_0306651 3300048917 Unclassified 1402
251 Ga0501075_1200431 3300049591 Bacteria 575
252 nmdc:mga05p37_100231_c1 3300050507 Bacteria 3567
253 nmdc:mga05p37_262681_c1 3300050507 Bacteria 2065
254 nmdc:mga05p37_53036_c1 3300050507 Bacteria 4988
255 nmdc:mga09592_1211125_c1 3300050508 Unclassified 624
256 nmdc:mga08y16_202561_c1 3300050511 Bacteria 2057
257 nmdc:mga08y16_4692_c1 3300050511 Bacteria 14243
258 nmdc:mga0n895_147066_c1 3300050512 Unclassified 2386
259 nmdc:mga0n895_297506_c1 3300050512 Bacteria 1636
260 nmdc:mga0n895_401311_c1 3300050512 Unclassified 1386
261 nmdc:mga0rr50_2164_c1 3300050513 Bacteria 10993
262 nmdc:mga0rr50_567875_c1 3300050513 Bacteria 966
263 nmdc:mga0rr50_686869_c1 3300050513 Bacteria 874
264 nmdc:mga08x19_210772_c1 3300050514 Unclassified 1334
265 nmdc:mga08x19_711087_c1 3300050514 Bacteria 713
266 nmdc:mga0a205_171685_c1 3300050515 Bacteria 2064
267 nmdc:mga0a205_193568_c1 3300050515 Unclassified 1925
268 nmdc:mga0a205_669921_c1 3300050515 Unclassified 888
269 Ga0495601_0041693 3300053077 Bacteria 2878
270 Ga0495601_0065799 3300053077 Bacteria 2307
271 Ga0495601_0528086 3300053077 Bacteria 760
272 Ga0495595_0024989 3300053084 Bacteria 2642
273 Ga0495595_0051636 3300053084 Bacteria 1906
274 Ga0495619_0007291 3300053085 Bacteria 7002
275 Ga0495619_0168908 3300053085 Bacteria 1512
276 Ga0495619_0302451 3300053085 Bacteria 1108
277 Ga0501082_0115110 3300060353 Bacteria 2329
278 Ga0501082_0668771 3300060353 Bacteria 909
279 Ga0114129_11287297
280 JGI24751J29686_10002504
281 Ga0058862_12782733
282 Ga0065712_10200069
283 Ga0065715_10162330
284 Ga0065707_10138943
285 Ga0070676_10123721
286 Ga0070690_100164120
287 Ga0070677_10083264
288 Ga0068869_100841023
289 Ga0070680_100204723
290 Ga0068868_100105818
291 Ga0070689_100075690
292 Ga0070687_100260982
293 Ga0070669_101507797
294 Ga0070671_100478341
295 Ga0070674_100160063
296 Ga0070674_100391013
297 Ga0070674_101551347
298 Ga0070673_100228505
299 Ga0070673_101149477
300 Ga0070659_100038976
301 Ga0070709_10412400
302 Ga0070709_10457182
303 Ga0070713_100055885
304 Ga0070700_100557985
305 Ga0070694_100174451
306 Ga0070694_100563914
307 Ga0070678_100559130
308 Ga0070681_10007768
309 Ga0070681_10203984
310 Ga0068867_100584695
311 Ga0068867_100761075
312 Ga0070685_10130279
313 Ga0070685_10310532
314 Ga0070706_100675803
315 Ga0070698_100057855
316 Ga0070698_100343087
317 Ga0070698_100565192
318 Ga0070699_100366934
319 Ga0070679_100223631
320 Ga0070679_100279358
321 Ga0070684_100045081
322 Ga0070697_100985628
323 Ga0068853_100264155
324 Ga0070672_100404316
325 Ga0070686_100001161
326 Ga0070686_100030785
327 Ga0070686_100115391
328 Ga0070696_100285211
329 Ga0070693_100095519
330 Ga0070665_100018624
331 Ga0068855_100481244
332 Ga0068855_100984306
333 Ga0068857_100415169
334 Ga0068857_100536294
335 Ga0068856_100301156
336 Ga0068859_100023843
337 Ga0068859_100122706
338 Ga0068864_100434680
339 Ga0068866_10847334
340 Ga0068858_100005989
341 Ga0068860_100344339
342 Ga0068862_100166610
343 Ga0068862_100583405
344 Ga0068862_100766117
345 Ga0068862_101912120
346 Ga0081455_10186383
347 Ga0075432_10312905
348 Ga0097621_100001862
349 Ga0097621_100017338
350 Ga0097621_100248331
351 Ga0097621_100263972
352 Ga0097621_101890532
353 Ga0068871_100000536
354 Ga0068871_100244853
355 Ga0068871_100572940
356 Ga0075428_100524879
357 Ga0075428_100601109
358 Ga0075431_100135936
359 Ga0075431_101807113
360 Ga0075433_10006686
361 Ga0075433_10080014
362 Ga0075434_100035927
363 Ga0075434_100150335
364 Ga0075434_100162798
365 Ga0075434_100170670
366 Ga0075429_100254869
367 Ga0075429_100710407
368 Ga0068865_100283635
369 Ga0075436_100591164
370 Ga0097620_100023843
371 Ga0097620_100122712
372 Ga0097620_100342969
373 Ga0075435_100003133
374 Ga0075435_100025811
375 Ga0099795_10109418
376 Ga0105240_10609148
377 Ga0111539_10005935
378 Ga0111539_10327950
379 Ga0111539_10483309
380 Ga0105245_10009333
381 Ga0114129_10058770
382 Ga0114129_10109700
383 Ga0114129_11792379
384 Ga0105243_10798299
385 Ga0105242_10105263
386 Ga0105248_10234375
387 Ga0105248_10318443
388 Ga0105248_10552639
389 Ga0105248_10826776
390 Ga0105248_12146378
391 Ga0105238_10342453
392 Ga0105239_12146419
393 Ga0157374_11881657
394 Ga0157378_10007456
395 Ga0163162_10817794
396 Ga0163162_11380832
397 Ga0163162_12032984
398 Ga0157375_10082985
399 Ga0163163_10015334
400 Ga0157380_10874927
401 Ga0157379_10082741
402 Ga0157379_10366683
403 Ga0157379_10371269
404 Ga0157376_10084639
405 Ga0157376_10126438
406 Ga0207697_10044048
407 Ga0207682_10082124
408 Ga0207642_10660733
409 Ga0207642_11027788
410 Ga0207699_10413051
411 Ga0207645_10311952
412 Ga0207684_10722113
413 Ga0207707_10058722
414 Ga0207695_10888656
415 Ga0207663_10151449
416 Ga0207662_10440885
417 Ga0207652_10207142
418 Ga0207652_10318996
419 Ga0207646_10096126
420 Ga0207681_11411250
421 Ga0207694_10335020
422 Ga0207694_10733922
423 Ga0207687_10044990
424 Ga0207700_11713161
425 Ga0207690_10032288
426 Ga0207686_10003504
427 Ga0207670_10180039
428 Ga0207669_10052087
429 Ga0207669_10927966
430 Ga0207669_11558063
431 Ga0207704_10007840
432 Ga0207711_10101082
433 Ga0207711_10345975
434 Ga0207711_10537411
435 Ga0207661_10056362
436 Ga0207667_10895954
437 Ga0207651_10096404
438 Ga0207651_10135784
439 Ga0207712_10207778
440 Ga0207677_10349689
441 Ga0207703_10295529
442 Ga0207641_11903822
443 Ga0207648_10097825
444 Ga0207676_10036243
445 Ga0207674_10096037
446 Ga0207675_100112474
447 Ga0207683_10040569
448 Ga0207683_10123666
449 Ga0207428_10098952
450 Ga0207428_11008874
451 Ga0268266_10015169
452 Ga0268266_11109812
453 Ga0268265_10200543
454 Ga0268264_10106759
455 Ga0268264_10716386
456 Ga0265332_10042688
457 Ga0265316_10657520
458 Ga0373948_0006377
459 Ga0373938_0000954
460 Ga0373926_0130698
461 Ga0373929_0001191
462 Ga0373934_0022385
463 Ga0373934_0072073
464 Ga0373940_0003478
465 Ga0373949_0000162
466 Ga0373951_0000272
467 Ga0373952_0000111
468 Ga0373923_0007779
469 Ga0373932_0000163
470 Ga0373941_0001779
471 Ga0373941_0027560
472 Ga0373953_0079603
473 Ga0373956_0278286
474 Ga0373955_0072431
475 Ga0373942_0000021
476 Ga0373961_0004591
477 Ga0373962_0001134
478 Ga0373931_0000446
479 Ga0373935_0028206
480 Ga0373935_0509123
481 Ga0373927_0073640
482 Ga0373933_0682604
483 Ga0373947_0007831
484 Ga0373947_0593829
485 Ga0373937_0158899
486 Ga0373937_0357792
487 Ga0373937_0420102
488 Ga0373937_0571622
489 Ga0373937_1869111
490 Ga0373925_0047823
491 Ga0373925_0063681
492 Ga0436365_0245567
493 Ga0439435_0029973
494 Ga0451576_0021152
495 Ga0451576_0109631
496 Ga0495651_0532844
497 Ga0495580_0067547
498 Ga0495582_0019581
499 Ga0495608_0005249
500 Ga0495608_0893042
501 Ga0495628_0031433
502 Ga0495630_0019767
503 Ga0495621_0012103
504 Ga0495645_0018277
505 Ga0495667_0500403
506 Ga0495657_0097002
507 Ga0495623_0112473
508 Ga0495647_0133558
509 Ga0495658_0078795
510 Ga0495669_0061585
511 Ga0495613_0000291
512 Ga0495613_0334038
513 Ga0495624_0279200
514 Ga0495600_0725458
515 Ga0495604_0020760
516 Ga0495604_0658235
517 Ga0495674_0081718
518 Ga0495684_0000138
519 Ga0496100_0571870
520 Ga0496104_0496910
521 Ga0496104_1133846
522 Ga0496105_0308825
523 Ga0496106_0639278
524 Ga0496108_0102127
525 Ga0496112_0109688
526 Ga0496112_0184828
527 Ga0496114_0289118
528 Ga0496114_0306651
529 Ga0501075_1200431
530 nmdc:mga05p37_100231_c1
531 nmdc:mga05p37_262681_c1
532 nmdc:mga05p37_53036_c1
533 nmdc:mga09592_1211125_c1
534 nmdc:mga08y16_202561_c1
535 nmdc:mga08y16_4692_c1
536 nmdc:mga0n895_147066_c1
537 nmdc:mga0n895_297506_c1
538 nmdc:mga0n895_401311_c1
539 nmdc:mga0rr50_2164_c1
540 nmdc:mga0rr50_567875_c1
541 nmdc:mga0rr50_686869_c1
542 nmdc:mga08x19_210772_c1
543 nmdc:mga08x19_711087_c1
544 nmdc:mga0a205_171685_c1
545 nmdc:mga0a205_193568_c1
546 nmdc:mga0a205_669921_c1
547 Ga0495601_0041693
548 Ga0495601_0065799
549 Ga0495601_0528086
550 Ga0495595_0024989
551 Ga0495595_0051636
552 Ga0495619_0007291
553 Ga0495619_0168908
554 Ga0495619_0302451
555 Ga0501082_0115110
556 Ga0501082_0668771

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nb3-assembly1.cif.gz_A the host outer membrane proteins ompa and ompc are packed at specific sites in the shigella phage sf6 virion as structural components 0.8038 21 159
1bxw-assembly1.cif.gz_A outer membrane protein a (ompa) transmembrane domain 0.7754 21 159
3nb3-assembly1.cif.gz_A the host outer membrane proteins ompa and ompc are packed at specific sites in the shigella phage sf6 virion as structural components 0.7656 21 159
1p4t-assembly1.cif.gz_A crystal structure of neisserial surface protein a (nspa) 0.7584 22 159
6x9z-assembly1.cif.gz_A de novo design of transmembrane beta-barrels 0.7319 19 159
ID Description Score Start End Superfamily
1qjpA00 Mainly Beta;Beta Barrel;Porin; 0.8038 21 159 2.40.160.20
1qjpA00 Mainly Beta;Beta Barrel;Porin; 0.7656 21 159 2.40.160.20
1p4tA00 Mainly Beta;Beta Barrel;Porin; 0.7584 22 159 2.40.160.20
4rlcA00 Mainly Beta;Beta Barrel;Porin; 0.6925 20 159 2.40.160.20
2lhfA00 Mainly Beta;Beta Barrel;Porin; 0.688 23 159 2.40.160.20
ID Description Score Start End GO Terms
AF-A0A2V8EFR1-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.9888 19 159
AF-A0A2V8C0U6-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.9826 39 159
AF-A0A2V8EFR1-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.9616 19 159
AF-A0A382M2G5-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.9265 9 159
AF-A0A143PT14-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.9213 8 159

Map