F382325
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 278 | 97 | 556 | 279 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_100501110|Ga0075428_1005011102 |
| Length | 306 |
| Sequence | VTAQDVRLDTGTRVSDHGLALTRRKVRVGDAVFKLALQTCFLIGFAVLAALLTWVIYKGWNRLDPRLWTNMPVRRISQIDRAGVQSAIMGTVWVISLTAVICLPIGVLSAIYLEEYADRNRWYNRILELNIQNLAGVPSIVFGILGLGIVARRFGLGFTVITAAIILSLLVLPVVIIATREAIRAVPQSIRQASYALGATKWQTVSRQVLPSAVPGIATGSILALSRAIGEAAPLVVLGAVTYITFNPDGIKSSYTVLPIQIYQFISLPQEGYKDLAAAAIVLLLGIVILMNSVAIFLRNKFQKRW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 5 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 6 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 8 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 10 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 11 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 12 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 13 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 14 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 15 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 16 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 17 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 18 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 19 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 20 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 21 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 23 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 25 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 26 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 27 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 28 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 29 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 30 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 31 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 32 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 33 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 34 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 35 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 36 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 37 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 38 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 39 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 40 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 41 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 42 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 43 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 44 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 45 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 46 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 47 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 48 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 49 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 50 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 51 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 52 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 53 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 54 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 55 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 56 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 57 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 58 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 59 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 60 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 61 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 62 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 63 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 64 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 65 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 66 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 67 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 68 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 69 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 70 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 71 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 72 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 73 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 74 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 75 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 76 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 77 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 78 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 79 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 80 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 81 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 82 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 83 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 84 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 85 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 86 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 87 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 88 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 89 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 90 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 91 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 92 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 93 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 94 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 95 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 96 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 97 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.84 |
| Metatranscriptomes | 0 |
| Isolates | 2.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.36 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 99.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075428_100501110 | 3300006844 | Bacteria | 1299 |
| 2 | JGI25407J50210_10002672 | 3300003373 | Bacteria | 4231 |
| 3 | JGI25407J50210_10003426 | 3300003373 | Bacteria | 3792 |
| 4 | JGI25407J50210_10005168 | 3300003373 | Bacteria | 3200 |
| 5 | JGI25407J50210_10013648 | 3300003373 | Bacteria | 2089 |
| 6 | Ga0065704_10028116 | 3300005289 | Bacteria | 1374 |
| 7 | Ga0070691_10086692 | 3300005341 | Bacteria | 1539 |
| 8 | Ga0070700_100005005 | 3300005441 | Bacteria | 6985 |
| 9 | Ga0070662_100299294 | 3300005457 | Bacteria | 1306 |
| 10 | Ga0068853_100626846 | 3300005539 | Bacteria | 1022 |
| 11 | Ga0070695_100055111 | 3300005545 | Bacteria | 2562 |
| 12 | Ga0068866_10109040 | 3300005718 | Bacteria | 1541 |
| 13 | Ga0081455_10008235 | 3300005937 | Bacteria | 10866 |
| 14 | Ga0081455_10018097 | 3300005937 | Bacteria | 6727 |
| 15 | Ga0081455_10039859 | 3300005937 | Bacteria | 4147 |
| 16 | Ga0081455_10124028 | 3300005937 | Bacteria | 2030 |
| 17 | Ga0081538_10000118 | 3300005981 | Bacteria | 79260 |
| 18 | Ga0081538_10000195 | 3300005981 | Bacteria | 66942 |
| 19 | Ga0081538_10000410 | 3300005981 | Bacteria | 48485 |
| 20 | Ga0081538_10000465 | 3300005981 | Bacteria | 45439 |
| 21 | Ga0081538_10001536 | 3300005981 | Bacteria | 23678 |
| 22 | Ga0081538_10003848 | 3300005981 | Bacteria | 14018 |
| 23 | Ga0081538_10004852 | 3300005981 | Bacteria | 12245 |
| 24 | Ga0081538_10035714 | 3300005981 | Bacteria | 3259 |
| 25 | Ga0081538_10040875 | 3300005981 | Bacteria | 2951 |
| 26 | Ga0081538_10052787 | 3300005981 | Bacteria | 2425 |
| 27 | Ga0081538_10064138 | 3300005981 | Bacteria | 2080 |
| 28 | Ga0081538_10065845 | 3300005981 | Bacteria | 2037 |
| 29 | Ga0081538_10084083 | 3300005981 | Bacteria | 1678 |
| 30 | Ga0075428_100000501 | 3300006844 | Bacteria | 39750 |
| 31 | Ga0075428_100021734 | 3300006844 | Bacteria | 7103 |
| 32 | Ga0075428_100114161 | 3300006844 | Bacteria | 2943 |
| 33 | Ga0075430_100001364 | 3300006846 | Bacteria | 19795 |
| 34 | Ga0075430_100007364 | 3300006846 | Bacteria | 9297 |
| 35 | Ga0075430_100181133 | 3300006846 | Bacteria | 1752 |
| 36 | Ga0075431_100003573 | 3300006847 | Bacteria | 15066 |
| 37 | Ga0075431_100013507 | 3300006847 | Bacteria | 8249 |
| 38 | Ga0075431_100078906 | 3300006847 | Bacteria | 3399 |
| 39 | Ga0075431_100189717 | 3300006847 | Bacteria | 2106 |
| 40 | Ga0075431_100364529 | 3300006847 | Bacteria | 1451 |
| 41 | Ga0075429_100002951 | 3300006880 | Bacteria | 14430 |
| 42 | Ga0075429_100107895 | 3300006880 | Bacteria | 2433 |
| 43 | Ga0075429_100130474 | 3300006880 | Bacteria | 2198 |
| 44 | Ga0111539_10008931 | 3300009094 | Bacteria | 12687 |
| 45 | Ga0114129_10000194 | 3300009147 | Bacteria | 68056 |
| 46 | Ga0114129_10055754 | 3300009147 | Bacteria | 5539 |
| 47 | Ga0114129_10069788 | 3300009147 | Bacteria | 4899 |
| 48 | Ga0114129_10096363 | 3300009147 | Bacteria | 4096 |
| 49 | Ga0105242_10205670 | 3300009176 | Bacteria | 1751 |
| 50 | Ga0157375_10371309 | 3300013308 | Bacteria | 1597 |
| 51 | Ga0157380_10298403 | 3300014326 | Bacteria | 1483 |
| 52 | Ga0207642_10078316 | 3300025899 | Bacteria | 1597 |
| 53 | Ga0207660_10261092 | 3300025917 | Bacteria | 1370 |
| 54 | Ga0207706_10062514 | 3300025933 | Bacteria | 3279 |
| 55 | Ga0209966_1009269 | 3300027695 | Bacteria | 1756 |
| 56 | Ga0207428_10022882 | 3300027907 | Bacteria | 5266 |
| 57 | Ga0307408_100028093 | 3300031548 | Bacteria | 3884 |
| 58 | Ga0307408_100199012 | 3300031548 | Bacteria | 1620 |
| 59 | Ga0307405_10008347 | 3300031731 | Bacteria | 5242 |
| 60 | Ga0307405_10088626 | 3300031731 | Bacteria | 2042 |
| 61 | Ga0307410_10113783 | 3300031852 | Bacteria | 1962 |
| 62 | Ga0307410_10114720 | 3300031852 | Bacteria | 1955 |
| 63 | Ga0307410_10180079 | 3300031852 | Bacteria | 1600 |
| 64 | Ga0307406_10037294 | 3300031901 | Bacteria | 3001 |
| 65 | Ga0307406_10098885 | 3300031901 | Bacteria | 1982 |
| 66 | Ga0307412_10147844 | 3300031911 | Bacteria | 1730 |
| 67 | Ga0307409_100001863 | 3300031995 | Bacteria | 10730 |
| 68 | Ga0307409_100006375 | 3300031995 | Bacteria | 6924 |
| 69 | Ga0307416_100093131 | 3300032002 | Bacteria | 2594 |
| 70 | Ga0307415_100000848 | 3300032126 | Bacteria | 13973 |
| 71 | Ga0307415_100001186 | 3300032126 | Bacteria | 12190 |
| 72 | Ga0307415_100030067 | 3300032126 | Bacteria | 3480 |
| 73 | Ga0307415_100055846 | 3300032126 | Bacteria | 2704 |
| 74 | Ga0307415_100057482 | 3300032126 | Bacteria | 2673 |
| 75 | Ga0395899_0012703 | 3300037312 | Bacteria | 6453 |
| 76 | Ga0395899_0057195 | 3300037312 | Bacteria | 2880 |
| 77 | Ga0395899_0068338 | 3300037312 | Bacteria | 2605 |
| 78 | Ga0395899_0098043 | 3300037312 | Bacteria | 2118 |
| 79 | Ga0395900_0005235 | 3300037418 | Bacteria | 13615 |
| 80 | Ga0395900_0005876 | 3300037418 | Bacteria | 12812 |
| 81 | Ga0395900_0015224 | 3300037418 | Bacteria | 7843 |
| 82 | Ga0395900_0037614 | 3300037418 | Bacteria | 4989 |
| 83 | Ga0395900_0190358 | 3300037418 | Bacteria | 2081 |
| 84 | Ga0395898_0021050 | 3300037466 | Bacteria | 6617 |
| 85 | Ga0395898_0021088 | 3300037466 | Bacteria | 6610 |
| 86 | Ga0395898_0109588 | 3300037466 | Bacteria | 2647 |
| 87 | Ga0395898_0382426 | 3300037466 | Bacteria | 1342 |
| 88 | Ga0395905_0009107 | 3300037471 | Bacteria | 9727 |
| 89 | Ga0395905_0014284 | 3300037471 | Bacteria | 7586 |
| 90 | Ga0395905_0023982 | 3300037471 | Bacteria | 5761 |
| 91 | Ga0395905_0088281 | 3300037471 | Bacteria | 2907 |
| 92 | Ga0395905_0088666 | 3300037471 | Bacteria | 2899 |
| 93 | Ga0395901_0000659 | 3300038443 | Bacteria | 39725 |
| 94 | Ga0395901_0001461 | 3300038443 | Bacteria | 24595 |
| 95 | Ga0395901_0003091 | 3300038443 | Bacteria | 16741 |
| 96 | Ga0395901_0012842 | 3300038443 | Bacteria | 8496 |
| 97 | Ga0395901_0065618 | 3300038443 | Bacteria | 3780 |
| 98 | Ga0395901_0088124 | 3300038443 | Bacteria | 3246 |
| 99 | Ga0395901_0129447 | 3300038443 | Bacteria | 2652 |
| 100 | Ga0395901_0133093 | 3300038443 | Bacteria | 2613 |
| 101 | Ga0439434_0003628 | 3300042435 | Bacteria | 4514 |
| 102 | Ga0495603_0257556 | 3300046455 | Archaea | 1004 |
| 103 | Ga0495629_0069932 | 3300046459 | Bacteria | 2449 |
| 104 | Ga0495641_0010837 | 3300046461 | Bacteria | 5242 |
| 105 | Ga0495596_0007072 | 3300046500 | Bacteria | 5086 |
| 106 | Ga0495620_0031285 | 3300046515 | Bacteria | 2440 |
| 107 | Ga0495644_0011399 | 3300046523 | Bacteria | 3422 |
| 108 | Ga0495654_0051376 | 3300046530 | Bacteria | 2012 |
| 109 | Ga0495656_0010742 | 3300046615 | Bacteria | 3338 |
| 110 | Ga0495658_0004468 | 3300046683 | Bacteria | 6884 |
| 111 | Ga0495673_0015592 | 3300047469 | Bacteria | 3911 |
| 112 | Ga0495686_0000020 | 3300047472 | Bacteria | 429191 |
| 113 | Ga0495686_0002076 | 3300047472 | Bacteria | 19690 |
| 114 | Ga0495686_0036007 | 3300047472 | Bacteria | 3178 |
| 115 | Ga0501031_0002959 | 3300049568 | Bacteria | 10867 |
| 116 | Ga0501031_0015922 | 3300049568 | Bacteria | 4882 |
| 117 | Ga0501031_0048863 | 3300049568 | Bacteria | 2756 |
| 118 | Ga0501032_0095308 | 3300049569 | Bacteria | 1973 |
| 119 | Ga0501032_0166517 | 3300049569 | Bacteria | 1446 |
| 120 | Ga0501033_0038590 | 3300049570 | Bacteria | 3569 |
| 121 | Ga0501033_0065906 | 3300049570 | Bacteria | 2663 |
| 122 | Ga0501036_0000308 | 3300049572 | Bacteria | 34013 |
| 123 | Ga0501036_0010913 | 3300049572 | Bacteria | 7511 |
| 124 | Ga0501036_0056341 | 3300049572 | Bacteria | 3330 |
| 125 | Ga0501036_0140171 | 3300049572 | Bacteria | 2040 |
| 126 | Ga0501036_0155280 | 3300049572 | Bacteria | 1930 |
| 127 | Ga0501036_0264637 | 3300049572 | Bacteria | 1440 |
| 128 | Ga0501037_0004274 | 3300049573 | Bacteria | 10360 |
| 129 | Ga0501037_0174679 | 3300049573 | Bacteria | 1526 |
| 130 | Ga0501037_0280401 | 3300049573 | Bacteria | 1161 |
| 131 | Ga0501038_0039243 | 3300049574 | Bacteria | 4142 |
| 132 | Ga0501039_0005652 | 3300049575 | Bacteria | 9469 |
| 133 | Ga0501039_0119966 | 3300049575 | Bacteria | 2060 |
| 134 | Ga0501039_0131006 | 3300049575 | Bacteria | 1968 |
| 135 | Ga0501039_0285597 | 3300049575 | Bacteria | 1297 |
| 136 | Ga0501040_0006766 | 3300049576 | Bacteria | 7436 |
| 137 | Ga0501040_0032190 | 3300049576 | Bacteria | 3548 |
| 138 | Ga0501040_0036872 | 3300049576 | Bacteria | 3320 |
| 139 | Ga0501040_0049469 | 3300049576 | Bacteria | 2873 |
| 140 | Ga0501040_0050354 | 3300049576 | Bacteria | 2849 |
| 141 | Ga0501040_0173192 | 3300049576 | Bacteria | 1529 |
| 142 | Ga0501041_0014386 | 3300049577 | Bacteria | 4698 |
| 143 | Ga0501041_0153555 | 3300049577 | Bacteria | 1438 |
| 144 | Ga0501041_0169145 | 3300049577 | Bacteria | 1367 |
| 145 | Ga0501042_0001435 | 3300049578 | Bacteria | 14027 |
| 146 | Ga0501042_0024670 | 3300049578 | Bacteria | 4219 |
| 147 | Ga0501042_0033924 | 3300049578 | Bacteria | 3619 |
| 148 | Ga0501042_0113554 | 3300049578 | Bacteria | 1950 |
| 149 | Ga0501042_0147924 | 3300049578 | Bacteria | 1693 |
| 150 | Ga0501043_0010000 | 3300049579 | Bacteria | 7441 |
| 151 | Ga0501043_0196934 | 3300049579 | Bacteria | 1565 |
| 152 | Ga0501043_0237478 | 3300049579 | Bacteria | 1406 |
| 153 | Ga0501046_0004588 | 3300049580 | Bacteria | 12473 |
| 154 | Ga0501046_0013557 | 3300049580 | Bacteria | 6895 |
| 155 | Ga0501046_0019057 | 3300049580 | Bacteria | 5696 |
| 156 | Ga0501046_0309959 | 3300049580 | Bacteria | 1151 |
| 157 | Ga0501047_0082872 | 3300049581 | Bacteria | 3082 |
| 158 | Ga0501048_0001957 | 3300049582 | Bacteria | 15662 |
| 159 | Ga0501048_0010335 | 3300049582 | Bacteria | 6977 |
| 160 | Ga0501048_0016516 | 3300049582 | Bacteria | 5442 |
| 161 | Ga0501048_0033221 | 3300049582 | Bacteria | 3728 |
| 162 | Ga0501048_0188127 | 3300049582 | Bacteria | 1463 |
| 163 | Ga0501068_0001237 | 3300049584 | Bacteria | 13560 |
| 164 | Ga0501068_0044209 | 3300049584 | Bacteria | 2681 |
| 165 | Ga0501068_0184774 | 3300049584 | Bacteria | 1319 |
| 166 | Ga0501069_0004675 | 3300049585 | Bacteria | 7074 |
| 167 | Ga0501070_0004679 | 3300049586 | Bacteria | 11720 |
| 168 | Ga0501070_0008333 | 3300049586 | Bacteria | 8757 |
| 169 | Ga0501070_0069736 | 3300049586 | Bacteria | 2911 |
| 170 | Ga0501071_0000057 | 3300049587 | Bacteria | 37883 |
| 171 | Ga0501071_0002187 | 3300049587 | Bacteria | 11763 |
| 172 | Ga0501071_0017704 | 3300049587 | Bacteria | 4919 |
| 173 | Ga0501071_0031625 | 3300049587 | Bacteria | 3753 |
| 174 | Ga0501071_0154925 | 3300049587 | Bacteria | 1710 |
| 175 | Ga0501072_0000387 | 3300049588 | Bacteria | 31559 |
| 176 | Ga0501072_0003064 | 3300049588 | Bacteria | 12600 |
| 177 | Ga0501072_0005666 | 3300049588 | Bacteria | 9510 |
| 178 | Ga0501072_0019238 | 3300049588 | Bacteria | 5275 |
| 179 | Ga0501072_0049901 | 3300049588 | Bacteria | 3294 |
| 180 | Ga0501073_0000148 | 3300049589 | Bacteria | 46653 |
| 181 | Ga0501073_0044561 | 3300049589 | Bacteria | 3126 |
| 182 | Ga0501073_0240164 | 3300049589 | Bacteria | 1251 |
| 183 | Ga0501074_0002850 | 3300049590 | Bacteria | 12107 |
| 184 | Ga0501074_0004135 | 3300049590 | Bacteria | 10354 |
| 185 | Ga0501074_0027513 | 3300049590 | Bacteria | 4123 |
| 186 | Ga0501075_0001751 | 3300049591 | Bacteria | 14276 |
| 187 | Ga0501075_0003671 | 3300049591 | Bacteria | 10295 |
| 188 | Ga0501075_0006571 | 3300049591 | Bacteria | 8008 |
| 189 | Ga0501075_0035563 | 3300049591 | Bacteria | 3715 |
| 190 | Ga0501075_0037341 | 3300049591 | Bacteria | 3628 |
| 191 | Ga0501075_0122602 | 3300049591 | Bacteria | 1978 |
| 192 | Ga0501075_0203334 | 3300049591 | Bacteria | 1511 |
| 193 | Ga0501076_0000937 | 3300049592 | Bacteria | 19025 |
| 194 | Ga0501076_0001062 | 3300049592 | Bacteria | 18051 |
| 195 | Ga0501076_0001698 | 3300049592 | Bacteria | 14863 |
| 196 | Ga0501076_0001770 | 3300049592 | Bacteria | 14622 |
| 197 | Ga0501076_0007232 | 3300049592 | Bacteria | 8077 |
| 198 | Ga0501076_0072671 | 3300049592 | Bacteria | 2753 |
| 199 | Ga0501076_0317344 | 3300049592 | Bacteria | 1278 |
| 200 | Ga0501077_0002902 | 3300049593 | Bacteria | 10283 |
| 201 | Ga0501077_0003502 | 3300049593 | Bacteria | 9422 |
| 202 | Ga0501077_0005954 | 3300049593 | Bacteria | 7445 |
| 203 | Ga0501077_0059037 | 3300049593 | Bacteria | 2435 |
| 204 | Ga0501079_0002282 | 3300049741 | Bacteria | 13852 |
| 205 | Ga0501079_0003743 | 3300049741 | Bacteria | 11223 |
| 206 | Ga0501079_0010835 | 3300049741 | Bacteria | 6943 |
| 207 | Ga0501079_0021249 | 3300049741 | Bacteria | 4964 |
| 208 | Ga0501079_0022675 | 3300049741 | Bacteria | 4816 |
| 209 | Ga0501079_0065983 | 3300049741 | Bacteria | 2793 |
| 210 | Ga0501079_0231236 | 3300049741 | Bacteria | 1444 |
| 211 | Ga0501079_0301668 | 3300049741 | Bacteria | 1253 |
| 212 | Ga0501080_0001415 | 3300049742 | Bacteria | 20114 |
| 213 | Ga0501080_0038465 | 3300049742 | Bacteria | 4467 |
| 214 | Ga0501080_0303896 | 3300049742 | Bacteria | 1446 |
| 215 | Ga0501080_0564403 | 3300049742 | Bacteria | 1013 |
| 216 | Ga0501081_0003256 | 3300049743 | Bacteria | 10338 |
| 217 | Ga0501081_0005118 | 3300049743 | Bacteria | 8436 |
| 218 | Ga0501081_0030276 | 3300049743 | Bacteria | 3663 |
| 219 | Ga0501081_0033434 | 3300049743 | Bacteria | 3494 |
| 220 | Ga0501081_0054912 | 3300049743 | Bacteria | 2752 |
| 221 | Ga0501081_0185252 | 3300049743 | Bacteria | 1506 |
| 222 | Ga0501081_0213892 | 3300049743 | Bacteria | 1401 |
| 223 | Ga0501083_0000209 | 3300049744 | Bacteria | 38057 |
| 224 | Ga0501083_0057178 | 3300049744 | Bacteria | 2612 |
| 225 | Ga0501035_0003290 | 3300049822 | Bacteria | 15492 |
| 226 | Ga0501044_0041047 | 3300049823 | Bacteria | 4817 |
| 227 | Ga0501044_0047858 | 3300049823 | Bacteria | 4421 |
| 228 | Ga0501045_0002829 | 3300049824 | Bacteria | 11847 |
| 229 | Ga0501045_0004026 | 3300049824 | Bacteria | 10127 |
| 230 | Ga0501045_0023716 | 3300049824 | Bacteria | 4401 |
| 231 | Ga0501045_0153520 | 3300049824 | Bacteria | 1713 |
| 232 | Ga0501212_004241 | 3300049851 | Bacteria | 1841 |
| 233 | nmdc:mga05p37_33091_c1 | 3300050507 | Bacteria | 6332 |
| 234 | nmdc:mga05p37_4163_c1 | 3300050507 | Bacteria | 16897 |
| 235 | nmdc:mga05p37_606_c1 | 3300050507 | Bacteria | 39578 |
| 236 | nmdc:mga05p37_6818_c2 | 3300050507 | Bacteria | 6371 |
| 237 | nmdc:mga09592_74_c1 | 3300050508 | Bacteria | 56650 |
| 238 | nmdc:mga0qj67_19102_c1 | 3300050509 | Bacteria | 5233 |
| 239 | nmdc:mga0qj67_20519_c1 | 3300050509 | Bacteria | 5061 |
| 240 | nmdc:mga0qj67_26_c1 | 3300050509 | Bacteria | 103914 |
| 241 | nmdc:mga0qj67_3416_c1 | 3300050509 | Bacteria | 11457 |
| 242 | nmdc:mga0qj67_5354_c1 | 3300050509 | Bacteria | 9366 |
| 243 | nmdc:mga06r32_194_c1 | 3300050510 | Bacteria | 36791 |
| 244 | nmdc:mga06r32_352644_c1 | 3300050510 | Bacteria | 1456 |
| 245 | nmdc:mga06r32_5695_c1 | 3300050510 | Bacteria | 11218 |
| 246 | nmdc:mga08y16_20133_c1 | 3300050511 | Bacteria | 7041 |
| 247 | nmdc:mga08y16_87610_c1 | 3300050511 | Bacteria | 3244 |
| 248 | Ga0500628_048711 | 3300053129 | Unclassified | 997 |
| 249 | Ga0501084_0000406 | 3300054114 | Bacteria | 33222 |
| 250 | Ga0501084_0008252 | 3300054114 | Bacteria | 8592 |
| 251 | Ga0501084_0011489 | 3300054114 | Bacteria | 7332 |
| 252 | Ga0501084_0029453 | 3300054114 | Bacteria | 4592 |
| 253 | Ga0501084_0040424 | 3300054114 | Bacteria | 3901 |
| 254 | Ga0501084_0055473 | 3300054114 | Bacteria | 3315 |
| 255 | Ga0501084_0144375 | 3300054114 | Bacteria | 2004 |
| 256 | Ga0501084_0178548 | 3300054114 | Bacteria | 1792 |
| 257 | Ga0590075_034670 | 3300059424 | Bacteria | 1284 |
| 258 | Ga0590075_037190 | 3300059424 | Bacteria | 1241 |
| 259 | Ga0501082_0005285 | 3300060353 | Bacteria | 11223 |
| 260 | Ga0501082_0029817 | 3300060353 | Bacteria | 4699 |
| 261 | Ga0501082_0030952 | 3300060353 | Bacteria | 4613 |
| 262 | Ga0501082_0080542 | 3300060353 | Bacteria | 2810 |
| 263 | Ga0501082_0219021 | 3300060353 | Bacteria | 1656 |
| 264 | Ga0501082_0278793 | 3300060353 | Bacteria | 1455 |
| 265 | Ga0530510_0000817 | 3300061734 | Bacteria | 20371 |
| 266 | Ga0530510_0001247 | 3300061734 | Bacteria | 16980 |
| 267 | Ga0530510_0006040 | 3300061734 | Bacteria | 8406 |
| 268 | Ga0530510_0037274 | 3300061734 | Bacteria | 3506 |
| 269 | Ga0530510_0097067 | 3300061734 | Bacteria | 2154 |
| 270 | Ga0530510_0195292 | 3300061734 | Bacteria | 1502 |
| 271 | Ga0530510_0215500 | 3300061734 | Bacteria | 1426 |
| 272 | Ga0530510_0237846 | 3300061734 | Bacteria | 1355 |
| 273 | 2515495428 | 2515154088 | Bacteria | 5526283 |
| 274 | 2515720216 | 2515154129 | Bacteria | 5584369 |
| 275 | 2515758200 | 2515154137 | Bacteria | 5711575 |
| 276 | 2516084462 | 2515154202 | Bacteria | 5471270 |
| 277 | 2516089590 | 2515154203 | Bacteria | 5458536 |
| 278 | 2855389701 | 2855386786 | Bacteria | 4752232 |
| 279 | Ga0075428_100501110 | |||
| 280 | JGI25407J50210_10002672 | |||
| 281 | JGI25407J50210_10003426 | |||
| 282 | JGI25407J50210_10005168 | |||
| 283 | JGI25407J50210_10013648 | |||
| 284 | Ga0065704_10028116 | |||
| 285 | Ga0070691_10086692 | |||
| 286 | Ga0070700_100005005 | |||
| 287 | Ga0070662_100299294 | |||
| 288 | Ga0068853_100626846 | |||
| 289 | Ga0070695_100055111 | |||
| 290 | Ga0068866_10109040 | |||
| 291 | Ga0081455_10008235 | |||
| 292 | Ga0081455_10018097 | |||
| 293 | Ga0081455_10039859 | |||
| 294 | Ga0081455_10124028 | |||
| 295 | Ga0081538_10000118 | |||
| 296 | Ga0081538_10000195 | |||
| 297 | Ga0081538_10000410 | |||
| 298 | Ga0081538_10000465 | |||
| 299 | Ga0081538_10001536 | |||
| 300 | Ga0081538_10003848 | |||
| 301 | Ga0081538_10004852 | |||
| 302 | Ga0081538_10035714 | |||
| 303 | Ga0081538_10040875 | |||
| 304 | Ga0081538_10052787 | |||
| 305 | Ga0081538_10064138 | |||
| 306 | Ga0081538_10065845 | |||
| 307 | Ga0081538_10084083 | |||
| 308 | Ga0075428_100000501 | |||
| 309 | Ga0075428_100021734 | |||
| 310 | Ga0075428_100114161 | |||
| 311 | Ga0075430_100001364 | |||
| 312 | Ga0075430_100007364 | |||
| 313 | Ga0075430_100181133 | |||
| 314 | Ga0075431_100003573 | |||
| 315 | Ga0075431_100013507 | |||
| 316 | Ga0075431_100078906 | |||
| 317 | Ga0075431_100189717 | |||
| 318 | Ga0075431_100364529 | |||
| 319 | Ga0075429_100002951 | |||
| 320 | Ga0075429_100107895 | |||
| 321 | Ga0075429_100130474 | |||
| 322 | Ga0111539_10008931 | |||
| 323 | Ga0114129_10000194 | |||
| 324 | Ga0114129_10055754 | |||
| 325 | Ga0114129_10069788 | |||
| 326 | Ga0114129_10096363 | |||
| 327 | Ga0105242_10205670 | |||
| 328 | Ga0157375_10371309 | |||
| 329 | Ga0157380_10298403 | |||
| 330 | Ga0207642_10078316 | |||
| 331 | Ga0207660_10261092 | |||
| 332 | Ga0207706_10062514 | |||
| 333 | Ga0209966_1009269 | |||
| 334 | Ga0207428_10022882 | |||
| 335 | Ga0307408_100028093 | |||
| 336 | Ga0307408_100199012 | |||
| 337 | Ga0307405_10008347 | |||
| 338 | Ga0307405_10088626 | |||
| 339 | Ga0307410_10113783 | |||
| 340 | Ga0307410_10114720 | |||
| 341 | Ga0307410_10180079 | |||
| 342 | Ga0307406_10037294 | |||
| 343 | Ga0307406_10098885 | |||
| 344 | Ga0307412_10147844 | |||
| 345 | Ga0307409_100001863 | |||
| 346 | Ga0307409_100006375 | |||
| 347 | Ga0307416_100093131 | |||
| 348 | Ga0307415_100000848 | |||
| 349 | Ga0307415_100001186 | |||
| 350 | Ga0307415_100030067 | |||
| 351 | Ga0307415_100055846 | |||
| 352 | Ga0307415_100057482 | |||
| 353 | Ga0395899_0012703 | |||
| 354 | Ga0395899_0057195 | |||
| 355 | Ga0395899_0068338 | |||
| 356 | Ga0395899_0098043 | |||
| 357 | Ga0395900_0005235 | |||
| 358 | Ga0395900_0005876 | |||
| 359 | Ga0395900_0015224 | |||
| 360 | Ga0395900_0037614 | |||
| 361 | Ga0395900_0190358 | |||
| 362 | Ga0395898_0021050 | |||
| 363 | Ga0395898_0021088 | |||
| 364 | Ga0395898_0109588 | |||
| 365 | Ga0395898_0382426 | |||
| 366 | Ga0395905_0009107 | |||
| 367 | Ga0395905_0014284 | |||
| 368 | Ga0395905_0023982 | |||
| 369 | Ga0395905_0088281 | |||
| 370 | Ga0395905_0088666 | |||
| 371 | Ga0395901_0000659 | |||
| 372 | Ga0395901_0001461 | |||
| 373 | Ga0395901_0003091 | |||
| 374 | Ga0395901_0012842 | |||
| 375 | Ga0395901_0065618 | |||
| 376 | Ga0395901_0088124 | |||
| 377 | Ga0395901_0129447 | |||
| 378 | Ga0395901_0133093 | |||
| 379 | Ga0439434_0003628 | |||
| 380 | Ga0495603_0257556 | |||
| 381 | Ga0495629_0069932 | |||
| 382 | Ga0495641_0010837 | |||
| 383 | Ga0495596_0007072 | |||
| 384 | Ga0495620_0031285 | |||
| 385 | Ga0495644_0011399 | |||
| 386 | Ga0495654_0051376 | |||
| 387 | Ga0495656_0010742 | |||
| 388 | Ga0495658_0004468 | |||
| 389 | Ga0495673_0015592 | |||
| 390 | Ga0495686_0000020 | |||
| 391 | Ga0495686_0002076 | |||
| 392 | Ga0495686_0036007 | |||
| 393 | Ga0501031_0002959 | |||
| 394 | Ga0501031_0015922 | |||
| 395 | Ga0501031_0048863 | |||
| 396 | Ga0501032_0095308 | |||
| 397 | Ga0501032_0166517 | |||
| 398 | Ga0501033_0038590 | |||
| 399 | Ga0501033_0065906 | |||
| 400 | Ga0501036_0000308 | |||
| 401 | Ga0501036_0010913 | |||
| 402 | Ga0501036_0056341 | |||
| 403 | Ga0501036_0140171 | |||
| 404 | Ga0501036_0155280 | |||
| 405 | Ga0501036_0264637 | |||
| 406 | Ga0501037_0004274 | |||
| 407 | Ga0501037_0174679 | |||
| 408 | Ga0501037_0280401 | |||
| 409 | Ga0501038_0039243 | |||
| 410 | Ga0501039_0005652 | |||
| 411 | Ga0501039_0119966 | |||
| 412 | Ga0501039_0131006 | |||
| 413 | Ga0501039_0285597 | |||
| 414 | Ga0501040_0006766 | |||
| 415 | Ga0501040_0032190 | |||
| 416 | Ga0501040_0036872 | |||
| 417 | Ga0501040_0049469 | |||
| 418 | Ga0501040_0050354 | |||
| 419 | Ga0501040_0173192 | |||
| 420 | Ga0501041_0014386 | |||
| 421 | Ga0501041_0153555 | |||
| 422 | Ga0501041_0169145 | |||
| 423 | Ga0501042_0001435 | |||
| 424 | Ga0501042_0024670 | |||
| 425 | Ga0501042_0033924 | |||
| 426 | Ga0501042_0113554 | |||
| 427 | Ga0501042_0147924 | |||
| 428 | Ga0501043_0010000 | |||
| 429 | Ga0501043_0196934 | |||
| 430 | Ga0501043_0237478 | |||
| 431 | Ga0501046_0004588 | |||
| 432 | Ga0501046_0013557 | |||
| 433 | Ga0501046_0019057 | |||
| 434 | Ga0501046_0309959 | |||
| 435 | Ga0501047_0082872 | |||
| 436 | Ga0501048_0001957 | |||
| 437 | Ga0501048_0010335 | |||
| 438 | Ga0501048_0016516 | |||
| 439 | Ga0501048_0033221 | |||
| 440 | Ga0501048_0188127 | |||
| 441 | Ga0501068_0001237 | |||
| 442 | Ga0501068_0044209 | |||
| 443 | Ga0501068_0184774 | |||
| 444 | Ga0501069_0004675 | |||
| 445 | Ga0501070_0004679 | |||
| 446 | Ga0501070_0008333 | |||
| 447 | Ga0501070_0069736 | |||
| 448 | Ga0501071_0000057 | |||
| 449 | Ga0501071_0002187 | |||
| 450 | Ga0501071_0017704 | |||
| 451 | Ga0501071_0031625 | |||
| 452 | Ga0501071_0154925 | |||
| 453 | Ga0501072_0000387 | |||
| 454 | Ga0501072_0003064 | |||
| 455 | Ga0501072_0005666 | |||
| 456 | Ga0501072_0019238 | |||
| 457 | Ga0501072_0049901 | |||
| 458 | Ga0501073_0000148 | |||
| 459 | Ga0501073_0044561 | |||
| 460 | Ga0501073_0240164 | |||
| 461 | Ga0501074_0002850 | |||
| 462 | Ga0501074_0004135 | |||
| 463 | Ga0501074_0027513 | |||
| 464 | Ga0501075_0001751 | |||
| 465 | Ga0501075_0003671 | |||
| 466 | Ga0501075_0006571 | |||
| 467 | Ga0501075_0035563 | |||
| 468 | Ga0501075_0037341 | |||
| 469 | Ga0501075_0122602 | |||
| 470 | Ga0501075_0203334 | |||
| 471 | Ga0501076_0000937 | |||
| 472 | Ga0501076_0001062 | |||
| 473 | Ga0501076_0001698 | |||
| 474 | Ga0501076_0001770 | |||
| 475 | Ga0501076_0007232 | |||
| 476 | Ga0501076_0072671 | |||
| 477 | Ga0501076_0317344 | |||
| 478 | Ga0501077_0002902 | |||
| 479 | Ga0501077_0003502 | |||
| 480 | Ga0501077_0005954 | |||
| 481 | Ga0501077_0059037 | |||
| 482 | Ga0501079_0002282 | |||
| 483 | Ga0501079_0003743 | |||
| 484 | Ga0501079_0010835 | |||
| 485 | Ga0501079_0021249 | |||
| 486 | Ga0501079_0022675 | |||
| 487 | Ga0501079_0065983 | |||
| 488 | Ga0501079_0231236 | |||
| 489 | Ga0501079_0301668 | |||
| 490 | Ga0501080_0001415 | |||
| 491 | Ga0501080_0038465 | |||
| 492 | Ga0501080_0303896 | |||
| 493 | Ga0501080_0564403 | |||
| 494 | Ga0501081_0003256 | |||
| 495 | Ga0501081_0005118 | |||
| 496 | Ga0501081_0030276 | |||
| 497 | Ga0501081_0033434 | |||
| 498 | Ga0501081_0054912 | |||
| 499 | Ga0501081_0185252 | |||
| 500 | Ga0501081_0213892 | |||
| 501 | Ga0501083_0000209 | |||
| 502 | Ga0501083_0057178 | |||
| 503 | Ga0501035_0003290 | |||
| 504 | Ga0501044_0041047 | |||
| 505 | Ga0501044_0047858 | |||
| 506 | Ga0501045_0002829 | |||
| 507 | Ga0501045_0004026 | |||
| 508 | Ga0501045_0023716 | |||
| 509 | Ga0501045_0153520 | |||
| 510 | Ga0501212_004241 | |||
| 511 | nmdc:mga05p37_33091_c1 | |||
| 512 | nmdc:mga05p37_4163_c1 | |||
| 513 | nmdc:mga05p37_606_c1 | |||
| 514 | nmdc:mga05p37_6818_c2 | |||
| 515 | nmdc:mga09592_74_c1 | |||
| 516 | nmdc:mga0qj67_19102_c1 | |||
| 517 | nmdc:mga0qj67_20519_c1 | |||
| 518 | nmdc:mga0qj67_26_c1 | |||
| 519 | nmdc:mga0qj67_3416_c1 | |||
| 520 | nmdc:mga0qj67_5354_c1 | |||
| 521 | nmdc:mga06r32_194_c1 | |||
| 522 | nmdc:mga06r32_352644_c1 | |||
| 523 | nmdc:mga06r32_5695_c1 | |||
| 524 | nmdc:mga08y16_20133_c1 | |||
| 525 | nmdc:mga08y16_87610_c1 | |||
| 526 | Ga0500628_048711 | |||
| 527 | Ga0501084_0000406 | |||
| 528 | Ga0501084_0008252 | |||
| 529 | Ga0501084_0011489 | |||
| 530 | Ga0501084_0029453 | |||
| 531 | Ga0501084_0040424 | |||
| 532 | Ga0501084_0055473 | |||
| 533 | Ga0501084_0144375 | |||
| 534 | Ga0501084_0178548 | |||
| 535 | Ga0590075_034670 | |||
| 536 | Ga0590075_037190 | |||
| 537 | Ga0501082_0005285 | |||
| 538 | Ga0501082_0029817 | |||
| 539 | Ga0501082_0030952 | |||
| 540 | Ga0501082_0080542 | |||
| 541 | Ga0501082_0219021 | |||
| 542 | Ga0501082_0278793 | |||
| 543 | Ga0530510_0000817 | |||
| 544 | Ga0530510_0001247 | |||
| 545 | Ga0530510_0006040 | |||
| 546 | Ga0530510_0037274 | |||
| 547 | Ga0530510_0097067 | |||
| 548 | Ga0530510_0195292 | |||
| 549 | Ga0530510_0215500 | |||
| 550 | Ga0530510_0237846 | |||
| 551 | 2515495428 | |||
| 552 | 2515720216 | |||
| 553 | 2515758200 | |||
| 554 | 2516084462 | |||
| 555 | 2516089590 | |||
| 556 | 2855389701 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
102
306
0.79
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7mc0-assembly1.cif.gz_B | inward facing conformation of the metni methionine abc transporter | 0.7471 | 71 | 283 |
| 3dhw-assembly2.cif.gz_F | crystal structure of methionine importer metni | 0.7299 | 71 | 280 |
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.7281 | 65 | 286 |
| 3dhw-assembly2.cif.gz_F | crystal structure of methionine importer metni | 0.7107 | 71 | 280 |
| 3dhw-assembly1.cif.gz_A | crystal structure of methionine importer metni | 0.7043 | 65 | 276 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WG09_26_296_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7947 | 16 | 284 | 1.10.3720.10 |
| af_P14176_140_330_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7913 | 69 | 284 | 1.10.3720.10 |
| af_P33359_41_239_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7893 | 75 | 286 | 1.10.3720.10 |
| af_P0AEQ6_1_218_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7832 | 76 | 288 | 1.10.3720.10 |
| af_P14176_140_330_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7803 | 69 | 284 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A661HMT1-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.8946 | 74 | 226 |
GO:0005886
GO:0055085 |
| AF-A0A3D0SM68-F1-model_v4 | Phosphate ABC transporter, permease protein PstA | 0.8754 | 53 | 220 |
GO:0005886
GO:0055085 |
| AF-A0A439KLU9-F1-model_v4 | ABC transporter permease subunit | 0.8729 | 53 | 209 |
GO:0005886
GO:0055085 |
| AF-A0A838MT26-F1-model_v4 | DUF3333 domain-containing protein | 0.8697 | 60 | 222 |
GO:0005886
GO:0055085 |
| AF-A0A2E7FT36-F1-model_v4 | deleted | 0.8679 | 61 | 222 |
|