F382325

General Info

Members Datasets Scaffolds Average Seq Length
278 97 556 279

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100501110|Ga0075428_1005011102
Length 306
Sequence VTAQDVRLDTGTRVSDHGLALTRRKVRVGDAVFKLALQTCFLIGFAVLAALLTWVIYKGWNRLDPRLWTNMPVRRISQIDRAGVQSAIMGTVWVISLTAVICLPIGVLSAIYLEEYADRNRWYNRILELNIQNLAGVPSIVFGILGLGIVARRFGLGFTVITAAIILSLLVLPVVIIATREAIRAVPQSIRQASYALGATKWQTVSRQVLPSAVPGIATGSILALSRAIGEAAPLVVLGAVTYITFNPDGIKSSYTVLPIQIYQFISLPQEGYKDLAAAAIVLLLGIVILMNSVAIFLRNKFQKRW

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
6 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
9 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
13 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
14 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
15 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
18 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
19 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
20 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
24 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
25 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
26 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
27 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
28 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
29 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
30 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
31 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
32 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
33 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
34 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
35 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
36 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
37 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
38 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
39 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
40 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
41 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
42 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
43 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
44 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
45 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
46 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
47 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
48 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
49 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
50 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
51 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
52 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
53 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
54 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
56 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
57 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
65 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
66 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
67 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
68 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
69 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
70 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
71 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
72 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
73 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
74 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
75 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
76 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
77 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
78 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
82 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
83 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
84 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
85 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
86 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
87 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
88 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
89 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
90 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
91 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
92 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
93 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
94 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
95 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
96 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
97 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.84
Metatranscriptomes 0
Isolates 2.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 0
Rhizosphere 99.28
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100501110 3300006844 Bacteria 1299
2 JGI25407J50210_10002672 3300003373 Bacteria 4231
3 JGI25407J50210_10003426 3300003373 Bacteria 3792
4 JGI25407J50210_10005168 3300003373 Bacteria 3200
5 JGI25407J50210_10013648 3300003373 Bacteria 2089
6 Ga0065704_10028116 3300005289 Bacteria 1374
7 Ga0070691_10086692 3300005341 Bacteria 1539
8 Ga0070700_100005005 3300005441 Bacteria 6985
9 Ga0070662_100299294 3300005457 Bacteria 1306
10 Ga0068853_100626846 3300005539 Bacteria 1022
11 Ga0070695_100055111 3300005545 Bacteria 2562
12 Ga0068866_10109040 3300005718 Bacteria 1541
13 Ga0081455_10008235 3300005937 Bacteria 10866
14 Ga0081455_10018097 3300005937 Bacteria 6727
15 Ga0081455_10039859 3300005937 Bacteria 4147
16 Ga0081455_10124028 3300005937 Bacteria 2030
17 Ga0081538_10000118 3300005981 Bacteria 79260
18 Ga0081538_10000195 3300005981 Bacteria 66942
19 Ga0081538_10000410 3300005981 Bacteria 48485
20 Ga0081538_10000465 3300005981 Bacteria 45439
21 Ga0081538_10001536 3300005981 Bacteria 23678
22 Ga0081538_10003848 3300005981 Bacteria 14018
23 Ga0081538_10004852 3300005981 Bacteria 12245
24 Ga0081538_10035714 3300005981 Bacteria 3259
25 Ga0081538_10040875 3300005981 Bacteria 2951
26 Ga0081538_10052787 3300005981 Bacteria 2425
27 Ga0081538_10064138 3300005981 Bacteria 2080
28 Ga0081538_10065845 3300005981 Bacteria 2037
29 Ga0081538_10084083 3300005981 Bacteria 1678
30 Ga0075428_100000501 3300006844 Bacteria 39750
31 Ga0075428_100021734 3300006844 Bacteria 7103
32 Ga0075428_100114161 3300006844 Bacteria 2943
33 Ga0075430_100001364 3300006846 Bacteria 19795
34 Ga0075430_100007364 3300006846 Bacteria 9297
35 Ga0075430_100181133 3300006846 Bacteria 1752
36 Ga0075431_100003573 3300006847 Bacteria 15066
37 Ga0075431_100013507 3300006847 Bacteria 8249
38 Ga0075431_100078906 3300006847 Bacteria 3399
39 Ga0075431_100189717 3300006847 Bacteria 2106
40 Ga0075431_100364529 3300006847 Bacteria 1451
41 Ga0075429_100002951 3300006880 Bacteria 14430
42 Ga0075429_100107895 3300006880 Bacteria 2433
43 Ga0075429_100130474 3300006880 Bacteria 2198
44 Ga0111539_10008931 3300009094 Bacteria 12687
45 Ga0114129_10000194 3300009147 Bacteria 68056
46 Ga0114129_10055754 3300009147 Bacteria 5539
47 Ga0114129_10069788 3300009147 Bacteria 4899
48 Ga0114129_10096363 3300009147 Bacteria 4096
49 Ga0105242_10205670 3300009176 Bacteria 1751
50 Ga0157375_10371309 3300013308 Bacteria 1597
51 Ga0157380_10298403 3300014326 Bacteria 1483
52 Ga0207642_10078316 3300025899 Bacteria 1597
53 Ga0207660_10261092 3300025917 Bacteria 1370
54 Ga0207706_10062514 3300025933 Bacteria 3279
55 Ga0209966_1009269 3300027695 Bacteria 1756
56 Ga0207428_10022882 3300027907 Bacteria 5266
57 Ga0307408_100028093 3300031548 Bacteria 3884
58 Ga0307408_100199012 3300031548 Bacteria 1620
59 Ga0307405_10008347 3300031731 Bacteria 5242
60 Ga0307405_10088626 3300031731 Bacteria 2042
61 Ga0307410_10113783 3300031852 Bacteria 1962
62 Ga0307410_10114720 3300031852 Bacteria 1955
63 Ga0307410_10180079 3300031852 Bacteria 1600
64 Ga0307406_10037294 3300031901 Bacteria 3001
65 Ga0307406_10098885 3300031901 Bacteria 1982
66 Ga0307412_10147844 3300031911 Bacteria 1730
67 Ga0307409_100001863 3300031995 Bacteria 10730
68 Ga0307409_100006375 3300031995 Bacteria 6924
69 Ga0307416_100093131 3300032002 Bacteria 2594
70 Ga0307415_100000848 3300032126 Bacteria 13973
71 Ga0307415_100001186 3300032126 Bacteria 12190
72 Ga0307415_100030067 3300032126 Bacteria 3480
73 Ga0307415_100055846 3300032126 Bacteria 2704
74 Ga0307415_100057482 3300032126 Bacteria 2673
75 Ga0395899_0012703 3300037312 Bacteria 6453
76 Ga0395899_0057195 3300037312 Bacteria 2880
77 Ga0395899_0068338 3300037312 Bacteria 2605
78 Ga0395899_0098043 3300037312 Bacteria 2118
79 Ga0395900_0005235 3300037418 Bacteria 13615
80 Ga0395900_0005876 3300037418 Bacteria 12812
81 Ga0395900_0015224 3300037418 Bacteria 7843
82 Ga0395900_0037614 3300037418 Bacteria 4989
83 Ga0395900_0190358 3300037418 Bacteria 2081
84 Ga0395898_0021050 3300037466 Bacteria 6617
85 Ga0395898_0021088 3300037466 Bacteria 6610
86 Ga0395898_0109588 3300037466 Bacteria 2647
87 Ga0395898_0382426 3300037466 Bacteria 1342
88 Ga0395905_0009107 3300037471 Bacteria 9727
89 Ga0395905_0014284 3300037471 Bacteria 7586
90 Ga0395905_0023982 3300037471 Bacteria 5761
91 Ga0395905_0088281 3300037471 Bacteria 2907
92 Ga0395905_0088666 3300037471 Bacteria 2899
93 Ga0395901_0000659 3300038443 Bacteria 39725
94 Ga0395901_0001461 3300038443 Bacteria 24595
95 Ga0395901_0003091 3300038443 Bacteria 16741
96 Ga0395901_0012842 3300038443 Bacteria 8496
97 Ga0395901_0065618 3300038443 Bacteria 3780
98 Ga0395901_0088124 3300038443 Bacteria 3246
99 Ga0395901_0129447 3300038443 Bacteria 2652
100 Ga0395901_0133093 3300038443 Bacteria 2613
101 Ga0439434_0003628 3300042435 Bacteria 4514
102 Ga0495603_0257556 3300046455 Archaea 1004
103 Ga0495629_0069932 3300046459 Bacteria 2449
104 Ga0495641_0010837 3300046461 Bacteria 5242
105 Ga0495596_0007072 3300046500 Bacteria 5086
106 Ga0495620_0031285 3300046515 Bacteria 2440
107 Ga0495644_0011399 3300046523 Bacteria 3422
108 Ga0495654_0051376 3300046530 Bacteria 2012
109 Ga0495656_0010742 3300046615 Bacteria 3338
110 Ga0495658_0004468 3300046683 Bacteria 6884
111 Ga0495673_0015592 3300047469 Bacteria 3911
112 Ga0495686_0000020 3300047472 Bacteria 429191
113 Ga0495686_0002076 3300047472 Bacteria 19690
114 Ga0495686_0036007 3300047472 Bacteria 3178
115 Ga0501031_0002959 3300049568 Bacteria 10867
116 Ga0501031_0015922 3300049568 Bacteria 4882
117 Ga0501031_0048863 3300049568 Bacteria 2756
118 Ga0501032_0095308 3300049569 Bacteria 1973
119 Ga0501032_0166517 3300049569 Bacteria 1446
120 Ga0501033_0038590 3300049570 Bacteria 3569
121 Ga0501033_0065906 3300049570 Bacteria 2663
122 Ga0501036_0000308 3300049572 Bacteria 34013
123 Ga0501036_0010913 3300049572 Bacteria 7511
124 Ga0501036_0056341 3300049572 Bacteria 3330
125 Ga0501036_0140171 3300049572 Bacteria 2040
126 Ga0501036_0155280 3300049572 Bacteria 1930
127 Ga0501036_0264637 3300049572 Bacteria 1440
128 Ga0501037_0004274 3300049573 Bacteria 10360
129 Ga0501037_0174679 3300049573 Bacteria 1526
130 Ga0501037_0280401 3300049573 Bacteria 1161
131 Ga0501038_0039243 3300049574 Bacteria 4142
132 Ga0501039_0005652 3300049575 Bacteria 9469
133 Ga0501039_0119966 3300049575 Bacteria 2060
134 Ga0501039_0131006 3300049575 Bacteria 1968
135 Ga0501039_0285597 3300049575 Bacteria 1297
136 Ga0501040_0006766 3300049576 Bacteria 7436
137 Ga0501040_0032190 3300049576 Bacteria 3548
138 Ga0501040_0036872 3300049576 Bacteria 3320
139 Ga0501040_0049469 3300049576 Bacteria 2873
140 Ga0501040_0050354 3300049576 Bacteria 2849
141 Ga0501040_0173192 3300049576 Bacteria 1529
142 Ga0501041_0014386 3300049577 Bacteria 4698
143 Ga0501041_0153555 3300049577 Bacteria 1438
144 Ga0501041_0169145 3300049577 Bacteria 1367
145 Ga0501042_0001435 3300049578 Bacteria 14027
146 Ga0501042_0024670 3300049578 Bacteria 4219
147 Ga0501042_0033924 3300049578 Bacteria 3619
148 Ga0501042_0113554 3300049578 Bacteria 1950
149 Ga0501042_0147924 3300049578 Bacteria 1693
150 Ga0501043_0010000 3300049579 Bacteria 7441
151 Ga0501043_0196934 3300049579 Bacteria 1565
152 Ga0501043_0237478 3300049579 Bacteria 1406
153 Ga0501046_0004588 3300049580 Bacteria 12473
154 Ga0501046_0013557 3300049580 Bacteria 6895
155 Ga0501046_0019057 3300049580 Bacteria 5696
156 Ga0501046_0309959 3300049580 Bacteria 1151
157 Ga0501047_0082872 3300049581 Bacteria 3082
158 Ga0501048_0001957 3300049582 Bacteria 15662
159 Ga0501048_0010335 3300049582 Bacteria 6977
160 Ga0501048_0016516 3300049582 Bacteria 5442
161 Ga0501048_0033221 3300049582 Bacteria 3728
162 Ga0501048_0188127 3300049582 Bacteria 1463
163 Ga0501068_0001237 3300049584 Bacteria 13560
164 Ga0501068_0044209 3300049584 Bacteria 2681
165 Ga0501068_0184774 3300049584 Bacteria 1319
166 Ga0501069_0004675 3300049585 Bacteria 7074
167 Ga0501070_0004679 3300049586 Bacteria 11720
168 Ga0501070_0008333 3300049586 Bacteria 8757
169 Ga0501070_0069736 3300049586 Bacteria 2911
170 Ga0501071_0000057 3300049587 Bacteria 37883
171 Ga0501071_0002187 3300049587 Bacteria 11763
172 Ga0501071_0017704 3300049587 Bacteria 4919
173 Ga0501071_0031625 3300049587 Bacteria 3753
174 Ga0501071_0154925 3300049587 Bacteria 1710
175 Ga0501072_0000387 3300049588 Bacteria 31559
176 Ga0501072_0003064 3300049588 Bacteria 12600
177 Ga0501072_0005666 3300049588 Bacteria 9510
178 Ga0501072_0019238 3300049588 Bacteria 5275
179 Ga0501072_0049901 3300049588 Bacteria 3294
180 Ga0501073_0000148 3300049589 Bacteria 46653
181 Ga0501073_0044561 3300049589 Bacteria 3126
182 Ga0501073_0240164 3300049589 Bacteria 1251
183 Ga0501074_0002850 3300049590 Bacteria 12107
184 Ga0501074_0004135 3300049590 Bacteria 10354
185 Ga0501074_0027513 3300049590 Bacteria 4123
186 Ga0501075_0001751 3300049591 Bacteria 14276
187 Ga0501075_0003671 3300049591 Bacteria 10295
188 Ga0501075_0006571 3300049591 Bacteria 8008
189 Ga0501075_0035563 3300049591 Bacteria 3715
190 Ga0501075_0037341 3300049591 Bacteria 3628
191 Ga0501075_0122602 3300049591 Bacteria 1978
192 Ga0501075_0203334 3300049591 Bacteria 1511
193 Ga0501076_0000937 3300049592 Bacteria 19025
194 Ga0501076_0001062 3300049592 Bacteria 18051
195 Ga0501076_0001698 3300049592 Bacteria 14863
196 Ga0501076_0001770 3300049592 Bacteria 14622
197 Ga0501076_0007232 3300049592 Bacteria 8077
198 Ga0501076_0072671 3300049592 Bacteria 2753
199 Ga0501076_0317344 3300049592 Bacteria 1278
200 Ga0501077_0002902 3300049593 Bacteria 10283
201 Ga0501077_0003502 3300049593 Bacteria 9422
202 Ga0501077_0005954 3300049593 Bacteria 7445
203 Ga0501077_0059037 3300049593 Bacteria 2435
204 Ga0501079_0002282 3300049741 Bacteria 13852
205 Ga0501079_0003743 3300049741 Bacteria 11223
206 Ga0501079_0010835 3300049741 Bacteria 6943
207 Ga0501079_0021249 3300049741 Bacteria 4964
208 Ga0501079_0022675 3300049741 Bacteria 4816
209 Ga0501079_0065983 3300049741 Bacteria 2793
210 Ga0501079_0231236 3300049741 Bacteria 1444
211 Ga0501079_0301668 3300049741 Bacteria 1253
212 Ga0501080_0001415 3300049742 Bacteria 20114
213 Ga0501080_0038465 3300049742 Bacteria 4467
214 Ga0501080_0303896 3300049742 Bacteria 1446
215 Ga0501080_0564403 3300049742 Bacteria 1013
216 Ga0501081_0003256 3300049743 Bacteria 10338
217 Ga0501081_0005118 3300049743 Bacteria 8436
218 Ga0501081_0030276 3300049743 Bacteria 3663
219 Ga0501081_0033434 3300049743 Bacteria 3494
220 Ga0501081_0054912 3300049743 Bacteria 2752
221 Ga0501081_0185252 3300049743 Bacteria 1506
222 Ga0501081_0213892 3300049743 Bacteria 1401
223 Ga0501083_0000209 3300049744 Bacteria 38057
224 Ga0501083_0057178 3300049744 Bacteria 2612
225 Ga0501035_0003290 3300049822 Bacteria 15492
226 Ga0501044_0041047 3300049823 Bacteria 4817
227 Ga0501044_0047858 3300049823 Bacteria 4421
228 Ga0501045_0002829 3300049824 Bacteria 11847
229 Ga0501045_0004026 3300049824 Bacteria 10127
230 Ga0501045_0023716 3300049824 Bacteria 4401
231 Ga0501045_0153520 3300049824 Bacteria 1713
232 Ga0501212_004241 3300049851 Bacteria 1841
233 nmdc:mga05p37_33091_c1 3300050507 Bacteria 6332
234 nmdc:mga05p37_4163_c1 3300050507 Bacteria 16897
235 nmdc:mga05p37_606_c1 3300050507 Bacteria 39578
236 nmdc:mga05p37_6818_c2 3300050507 Bacteria 6371
237 nmdc:mga09592_74_c1 3300050508 Bacteria 56650
238 nmdc:mga0qj67_19102_c1 3300050509 Bacteria 5233
239 nmdc:mga0qj67_20519_c1 3300050509 Bacteria 5061
240 nmdc:mga0qj67_26_c1 3300050509 Bacteria 103914
241 nmdc:mga0qj67_3416_c1 3300050509 Bacteria 11457
242 nmdc:mga0qj67_5354_c1 3300050509 Bacteria 9366
243 nmdc:mga06r32_194_c1 3300050510 Bacteria 36791
244 nmdc:mga06r32_352644_c1 3300050510 Bacteria 1456
245 nmdc:mga06r32_5695_c1 3300050510 Bacteria 11218
246 nmdc:mga08y16_20133_c1 3300050511 Bacteria 7041
247 nmdc:mga08y16_87610_c1 3300050511 Bacteria 3244
248 Ga0500628_048711 3300053129 Unclassified 997
249 Ga0501084_0000406 3300054114 Bacteria 33222
250 Ga0501084_0008252 3300054114 Bacteria 8592
251 Ga0501084_0011489 3300054114 Bacteria 7332
252 Ga0501084_0029453 3300054114 Bacteria 4592
253 Ga0501084_0040424 3300054114 Bacteria 3901
254 Ga0501084_0055473 3300054114 Bacteria 3315
255 Ga0501084_0144375 3300054114 Bacteria 2004
256 Ga0501084_0178548 3300054114 Bacteria 1792
257 Ga0590075_034670 3300059424 Bacteria 1284
258 Ga0590075_037190 3300059424 Bacteria 1241
259 Ga0501082_0005285 3300060353 Bacteria 11223
260 Ga0501082_0029817 3300060353 Bacteria 4699
261 Ga0501082_0030952 3300060353 Bacteria 4613
262 Ga0501082_0080542 3300060353 Bacteria 2810
263 Ga0501082_0219021 3300060353 Bacteria 1656
264 Ga0501082_0278793 3300060353 Bacteria 1455
265 Ga0530510_0000817 3300061734 Bacteria 20371
266 Ga0530510_0001247 3300061734 Bacteria 16980
267 Ga0530510_0006040 3300061734 Bacteria 8406
268 Ga0530510_0037274 3300061734 Bacteria 3506
269 Ga0530510_0097067 3300061734 Bacteria 2154
270 Ga0530510_0195292 3300061734 Bacteria 1502
271 Ga0530510_0215500 3300061734 Bacteria 1426
272 Ga0530510_0237846 3300061734 Bacteria 1355
273 2515495428 2515154088 Bacteria 5526283
274 2515720216 2515154129 Bacteria 5584369
275 2515758200 2515154137 Bacteria 5711575
276 2516084462 2515154202 Bacteria 5471270
277 2516089590 2515154203 Bacteria 5458536
278 2855389701 2855386786 Bacteria 4752232
279 Ga0075428_100501110
280 JGI25407J50210_10002672
281 JGI25407J50210_10003426
282 JGI25407J50210_10005168
283 JGI25407J50210_10013648
284 Ga0065704_10028116
285 Ga0070691_10086692
286 Ga0070700_100005005
287 Ga0070662_100299294
288 Ga0068853_100626846
289 Ga0070695_100055111
290 Ga0068866_10109040
291 Ga0081455_10008235
292 Ga0081455_10018097
293 Ga0081455_10039859
294 Ga0081455_10124028
295 Ga0081538_10000118
296 Ga0081538_10000195
297 Ga0081538_10000410
298 Ga0081538_10000465
299 Ga0081538_10001536
300 Ga0081538_10003848
301 Ga0081538_10004852
302 Ga0081538_10035714
303 Ga0081538_10040875
304 Ga0081538_10052787
305 Ga0081538_10064138
306 Ga0081538_10065845
307 Ga0081538_10084083
308 Ga0075428_100000501
309 Ga0075428_100021734
310 Ga0075428_100114161
311 Ga0075430_100001364
312 Ga0075430_100007364
313 Ga0075430_100181133
314 Ga0075431_100003573
315 Ga0075431_100013507
316 Ga0075431_100078906
317 Ga0075431_100189717
318 Ga0075431_100364529
319 Ga0075429_100002951
320 Ga0075429_100107895
321 Ga0075429_100130474
322 Ga0111539_10008931
323 Ga0114129_10000194
324 Ga0114129_10055754
325 Ga0114129_10069788
326 Ga0114129_10096363
327 Ga0105242_10205670
328 Ga0157375_10371309
329 Ga0157380_10298403
330 Ga0207642_10078316
331 Ga0207660_10261092
332 Ga0207706_10062514
333 Ga0209966_1009269
334 Ga0207428_10022882
335 Ga0307408_100028093
336 Ga0307408_100199012
337 Ga0307405_10008347
338 Ga0307405_10088626
339 Ga0307410_10113783
340 Ga0307410_10114720
341 Ga0307410_10180079
342 Ga0307406_10037294
343 Ga0307406_10098885
344 Ga0307412_10147844
345 Ga0307409_100001863
346 Ga0307409_100006375
347 Ga0307416_100093131
348 Ga0307415_100000848
349 Ga0307415_100001186
350 Ga0307415_100030067
351 Ga0307415_100055846
352 Ga0307415_100057482
353 Ga0395899_0012703
354 Ga0395899_0057195
355 Ga0395899_0068338
356 Ga0395899_0098043
357 Ga0395900_0005235
358 Ga0395900_0005876
359 Ga0395900_0015224
360 Ga0395900_0037614
361 Ga0395900_0190358
362 Ga0395898_0021050
363 Ga0395898_0021088
364 Ga0395898_0109588
365 Ga0395898_0382426
366 Ga0395905_0009107
367 Ga0395905_0014284
368 Ga0395905_0023982
369 Ga0395905_0088281
370 Ga0395905_0088666
371 Ga0395901_0000659
372 Ga0395901_0001461
373 Ga0395901_0003091
374 Ga0395901_0012842
375 Ga0395901_0065618
376 Ga0395901_0088124
377 Ga0395901_0129447
378 Ga0395901_0133093
379 Ga0439434_0003628
380 Ga0495603_0257556
381 Ga0495629_0069932
382 Ga0495641_0010837
383 Ga0495596_0007072
384 Ga0495620_0031285
385 Ga0495644_0011399
386 Ga0495654_0051376
387 Ga0495656_0010742
388 Ga0495658_0004468
389 Ga0495673_0015592
390 Ga0495686_0000020
391 Ga0495686_0002076
392 Ga0495686_0036007
393 Ga0501031_0002959
394 Ga0501031_0015922
395 Ga0501031_0048863
396 Ga0501032_0095308
397 Ga0501032_0166517
398 Ga0501033_0038590
399 Ga0501033_0065906
400 Ga0501036_0000308
401 Ga0501036_0010913
402 Ga0501036_0056341
403 Ga0501036_0140171
404 Ga0501036_0155280
405 Ga0501036_0264637
406 Ga0501037_0004274
407 Ga0501037_0174679
408 Ga0501037_0280401
409 Ga0501038_0039243
410 Ga0501039_0005652
411 Ga0501039_0119966
412 Ga0501039_0131006
413 Ga0501039_0285597
414 Ga0501040_0006766
415 Ga0501040_0032190
416 Ga0501040_0036872
417 Ga0501040_0049469
418 Ga0501040_0050354
419 Ga0501040_0173192
420 Ga0501041_0014386
421 Ga0501041_0153555
422 Ga0501041_0169145
423 Ga0501042_0001435
424 Ga0501042_0024670
425 Ga0501042_0033924
426 Ga0501042_0113554
427 Ga0501042_0147924
428 Ga0501043_0010000
429 Ga0501043_0196934
430 Ga0501043_0237478
431 Ga0501046_0004588
432 Ga0501046_0013557
433 Ga0501046_0019057
434 Ga0501046_0309959
435 Ga0501047_0082872
436 Ga0501048_0001957
437 Ga0501048_0010335
438 Ga0501048_0016516
439 Ga0501048_0033221
440 Ga0501048_0188127
441 Ga0501068_0001237
442 Ga0501068_0044209
443 Ga0501068_0184774
444 Ga0501069_0004675
445 Ga0501070_0004679
446 Ga0501070_0008333
447 Ga0501070_0069736
448 Ga0501071_0000057
449 Ga0501071_0002187
450 Ga0501071_0017704
451 Ga0501071_0031625
452 Ga0501071_0154925
453 Ga0501072_0000387
454 Ga0501072_0003064
455 Ga0501072_0005666
456 Ga0501072_0019238
457 Ga0501072_0049901
458 Ga0501073_0000148
459 Ga0501073_0044561
460 Ga0501073_0240164
461 Ga0501074_0002850
462 Ga0501074_0004135
463 Ga0501074_0027513
464 Ga0501075_0001751
465 Ga0501075_0003671
466 Ga0501075_0006571
467 Ga0501075_0035563
468 Ga0501075_0037341
469 Ga0501075_0122602
470 Ga0501075_0203334
471 Ga0501076_0000937
472 Ga0501076_0001062
473 Ga0501076_0001698
474 Ga0501076_0001770
475 Ga0501076_0007232
476 Ga0501076_0072671
477 Ga0501076_0317344
478 Ga0501077_0002902
479 Ga0501077_0003502
480 Ga0501077_0005954
481 Ga0501077_0059037
482 Ga0501079_0002282
483 Ga0501079_0003743
484 Ga0501079_0010835
485 Ga0501079_0021249
486 Ga0501079_0022675
487 Ga0501079_0065983
488 Ga0501079_0231236
489 Ga0501079_0301668
490 Ga0501080_0001415
491 Ga0501080_0038465
492 Ga0501080_0303896
493 Ga0501080_0564403
494 Ga0501081_0003256
495 Ga0501081_0005118
496 Ga0501081_0030276
497 Ga0501081_0033434
498 Ga0501081_0054912
499 Ga0501081_0185252
500 Ga0501081_0213892
501 Ga0501083_0000209
502 Ga0501083_0057178
503 Ga0501035_0003290
504 Ga0501044_0041047
505 Ga0501044_0047858
506 Ga0501045_0002829
507 Ga0501045_0004026
508 Ga0501045_0023716
509 Ga0501045_0153520
510 Ga0501212_004241
511 nmdc:mga05p37_33091_c1
512 nmdc:mga05p37_4163_c1
513 nmdc:mga05p37_606_c1
514 nmdc:mga05p37_6818_c2
515 nmdc:mga09592_74_c1
516 nmdc:mga0qj67_19102_c1
517 nmdc:mga0qj67_20519_c1
518 nmdc:mga0qj67_26_c1
519 nmdc:mga0qj67_3416_c1
520 nmdc:mga0qj67_5354_c1
521 nmdc:mga06r32_194_c1
522 nmdc:mga06r32_352644_c1
523 nmdc:mga06r32_5695_c1
524 nmdc:mga08y16_20133_c1
525 nmdc:mga08y16_87610_c1
526 Ga0500628_048711
527 Ga0501084_0000406
528 Ga0501084_0008252
529 Ga0501084_0011489
530 Ga0501084_0029453
531 Ga0501084_0040424
532 Ga0501084_0055473
533 Ga0501084_0144375
534 Ga0501084_0178548
535 Ga0590075_034670
536 Ga0590075_037190
537 Ga0501082_0005285
538 Ga0501082_0029817
539 Ga0501082_0030952
540 Ga0501082_0080542
541 Ga0501082_0219021
542 Ga0501082_0278793
543 Ga0530510_0000817
544 Ga0530510_0001247
545 Ga0530510_0006040
546 Ga0530510_0037274
547 Ga0530510_0097067
548 Ga0530510_0195292
549 Ga0530510_0215500
550 Ga0530510_0237846
551 2515495428
552 2515720216
553 2515758200
554 2516084462
555 2516089590
556 2855389701

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

102

306

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.7471 71 283
3dhw-assembly2.cif.gz_F crystal structure of methionine importer metni 0.7299 71 280
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7281 65 286
3dhw-assembly2.cif.gz_F crystal structure of methionine importer metni 0.7107 71 280
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.7043 65 276
ID Description Score Start End Superfamily
af_P9WG09_26_296_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7947 16 284 1.10.3720.10
af_P14176_140_330_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7913 69 284 1.10.3720.10
af_P33359_41_239_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7893 75 286 1.10.3720.10
af_P0AEQ6_1_218_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7832 76 288 1.10.3720.10
af_P14176_140_330_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7803 69 284 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A661HMT1-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.8946 74 226 GO:0005886
GO:0055085
AF-A0A3D0SM68-F1-model_v4 Phosphate ABC transporter, permease protein PstA 0.8754 53 220 GO:0005886
GO:0055085
AF-A0A439KLU9-F1-model_v4 ABC transporter permease subunit 0.8729 53 209 GO:0005886
GO:0055085
AF-A0A838MT26-F1-model_v4 DUF3333 domain-containing protein 0.8697 60 222 GO:0005886
GO:0055085
AF-A0A2E7FT36-F1-model_v4 deleted 0.8679 61 222

Map