F382304

General Info

Members Datasets Scaffolds Average Seq Length
278 199 556 266

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1012198|Ga0081540_10121982
Length 304
Sequence MTSERTETSARIVTQRDDNAGTPPVIDAAFARWLADRAGQTLLRVREEMGYADGKALKTAGDRAAHDLLRAELARWRPADAVLSEEDDHARLAWQDGEQATVRPERLGAGRVWIVDPLDGTREFSEQGRTDWAVHVALWTADSASPGHLAAGAVAMPAQHRTIATDHPPAYPPMPLGDARPIRIAASRTRPPAFVTALAEEIGAELLPMGSAGVKIAAVIGGEADAYVHAGGQYEWDSAAPVAVALATGLHASRIDGSALKYNEADPKLPDLVVCRKDLAPRLLAALQRHITTAVNPPKGRETA

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
25 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
42 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
43 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
44 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
45 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
46 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
47 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
48 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
49 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
50 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
51 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
52 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
53 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
54 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
59 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
60 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
61 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
62 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
63 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
64 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
65 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
66 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
67 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
68 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
69 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
70 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
71 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
82 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
83 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
84 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
85 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
86 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
87 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
88 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
95 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
96 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
97 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
98 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
99 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
100 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
101 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
107 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
108 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
109 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
112 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
120 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
147 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
151 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
152 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
153 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
154 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
155 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
156 2501939600 Micromonospora sp. L5 Isolate Unclassified
157 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
158 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
159 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
160 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
161 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
162 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
163 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
164 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
165 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
166 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
167 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
168 2855683550 Micromonospora sp. RP3T Isolate Unclassified
169 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
170 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
171 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
172 2858868258 Micromonospora sp. MH33 Isolate Unclassified
173 2858882152 Micromonospora noduli MED15 Isolate Nodule
174 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
175 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
176 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
177 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
178 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
179 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
180 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
181 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
182 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
183 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
184 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
185 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
186 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
187 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
188 2902582711 Micromonospora sp. AP08 Isolate Unclassified
189 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
190 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
191 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
192 649633069 Micromonospora sp. L5 Isolate Unclassified
193 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
194 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
195 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
196 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
197 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
198 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
199 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.45
Metatranscriptomes 0.36
Isolates 16.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.88
Nodule 2.16
Rhizoplane 3.24
Rhizosphere 73.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1012198 3300005983 Bacteria 5682
2 Ga0070658_10065620 3300005327 Bacteria 2963
3 Ga0070682_100005222 3300005337 Bacteria 7224
4 Ga0070661_100086012 3300005344 Bacteria 2324
5 Ga0070668_100018208 3300005347 Bacteria 5270
6 Ga0070659_100017351 3300005366 Bacteria 5414
7 Ga0070708_100161920 3300005445 Bacteria 2085
8 Ga0070708_100533183 3300005445 Bacteria 1107
9 Ga0070663_100111680 3300005455 Bacteria 2054
10 Ga0070706_100063854 3300005467 Bacteria 3403
11 Ga0070698_100101264 3300005471 Bacteria 2852
12 Ga0070699_100055066 3300005518 Bacteria 3444
13 Ga0070697_100169508 3300005536 Bacteria 1847
14 Ga0070665_100176787 3300005548 Bacteria 2135
15 Ga0068857_100016511 3300005577 Bacteria 6468
16 Ga0068863_100142980 3300005841 Bacteria 2287
17 Ga0068858_100048229 3300005842 Bacteria 3947
18 Ga0068858_100077773 3300005842 Bacteria 3082
19 Ga0068862_100055126 3300005844 Bacteria 3405
20 Ga0068862_100103628 3300005844 Bacteria 2492
21 Ga0081455_10153593 3300005937 Bacteria 1772
22 Ga0081539_10000094 3300005985 Bacteria 206102
23 Ga0081539_10000733 3300005985 Bacteria 65742
24 Ga0081539_10006745 3300005985 Bacteria 10784
25 Ga0081539_10015806 3300005985 Bacteria 5452
26 Ga0070717_10023820 3300006028 Bacteria 4856
27 Ga0070717_10233275 3300006028 Bacteria 1621
28 Ga0070717_10755357 3300006028 Bacteria 884
29 Ga0075363_100001651 3300006048 Bacteria 8628
30 Ga0075431_100061456 3300006847 Bacteria 3876
31 Ga0105245_10032217 3300009098 Bacteria 4640
32 Ga0105245_10411876 3300009098 Bacteria 1353
33 Ga0157378_10370601 3300013297 Bacteria 1404
34 Ga0163162_10294733 3300013306 Bacteria 1754
35 Ga0157372_10431652 3300013307 Bacteria 1536
36 Ga0157375_10412973 3300013308 Bacteria 1516
37 Ga0197907_10136971 3300020069 Bacteria 4676
38 Ga0207685_10001126 3300025905 Bacteria 5322
39 Ga0207705_10317535 3300025909 Bacteria 1197
40 Ga0207671_10020126 3300025914 Bacteria 5088
41 Ga0207646_10323345 3300025922 Bacteria 1394
42 Ga0207650_10159185 3300025925 Bacteria 1788
43 Ga0207690_10098377 3300025932 Bacteria 2084
44 Ga0207668_10000695 3300025972 Bacteria 20639
45 Ga0207668_10290218 3300025972 Bacteria 1345
46 Ga0207677_10106029 3300026023 Bacteria 2081
47 Ga0207683_10135281 3300026121 Bacteria 2219
48 Ga0207698_10050504 3300026142 Bacteria 3173
49 Ga0268266_10530740 3300028379 Bacteria 1126
50 Ga0268265_10037042 3300028380 Bacteria 3576
51 Ga0307515_10000088 3300028794 Bacteria 215810
52 Ga0307515_10043854 3300028794 Bacteria 6937
53 Ga0307515_10172511 3300028794 Bacteria 2148
54 Ga0307512_10002517 3300030522 Bacteria 22951
55 Ga0307512_10005343 3300030522 Bacteria 13443
56 Ga0307512_10128858 3300030522 Bacteria 1595
57 Ga0307513_10012419 3300031456 Bacteria 10515
58 Ga0307513_10017027 3300031456 Bacteria 8733
59 Ga0307509_10017350 3300031507 Bacteria 8289
60 Ga0307408_100008655 3300031548 Bacteria 6721
61 Ga0307508_10001555 3300031616 Bacteria 25690
62 Ga0307508_10002147 3300031616 Bacteria 21132
63 Ga0307508_10138196 3300031616 Bacteria 2040
64 Ga0316576_10146698 3300031727 Bacteria 1777
65 Ga0316578_10028871 3300031728 Bacteria 3144
66 Ga0307516_10010855 3300031730 Bacteria 9969
67 Ga0307516_10278727 3300031730 Bacteria 1354
68 Ga0307405_10003032 3300031731 Bacteria 7608
69 Ga0316577_10108013 3300031733 Bacteria 1561
70 Ga0307406_10005623 3300031901 Bacteria 6853
71 Ga0307407_10006636 3300031903 Bacteria 5169
72 Ga0307409_100003596 3300031995 Bacteria 8467
73 Ga0307409_100122109 3300031995 Bacteria 2208
74 Ga0307416_100027617 3300032002 Bacteria 4206
75 Ga0307416_100114019 3300032002 Bacteria 2390
76 Ga0307414_10351460 3300032004 Bacteria 1265
77 Ga0307415_100022686 3300032126 Bacteria 3879
78 Ga0307415_100326242 3300032126 Bacteria 1282
79 Ga0307415_100369282 3300032126 Bacteria 1214
80 Ga0373934_0006063 3300035086 Bacteria 4473
81 Ga0373934_0009779 3300035086 Bacteria 3598
82 Ga0373940_0016483 3300035088 Bacteria 1830
83 Ga0373951_0000024 3300035091 Bacteria 60660
84 Ga0373923_0065216 3300035111 Bacteria 1554
85 Ga0373932_0059531 3300035112 Bacteria 1157
86 Ga0373953_0011324 3300035117 Bacteria 3127
87 Ga0373953_0040906 3300035117 Bacteria 1843
88 Ga0373954_0000183 3300035118 Bacteria 22612
89 Ga0373954_0063733 3300035118 Bacteria 1742
90 Ga0373956_0001527 3300035119 Bacteria 9553
91 Ga0373956_0044715 3300035119 Bacteria 1974
92 Ga0373956_0124296 3300035119 Bacteria 1206
93 Ga0373956_0139310 3300035119 Bacteria 1138
94 Ga0373957_0000119 3300035120 Bacteria 19154
95 Ga0373957_0007883 3300035120 Bacteria 3427
96 Ga0373943_0026870 3300035170 Bacteria 2700
97 Ga0373955_0000126 3300035172 Bacteria 30266
98 Ga0373955_0115685 3300035172 Bacteria 1554
99 Ga0373955_0175097 3300035172 Bacteria 1271
100 Ga0373942_0000049 3300035207 Bacteria 23697
101 Ga0373962_0000155 3300035242 Bacteria 14295
102 Ga0373962_0049711 3300035242 Bacteria 1206
103 Ga0316574_0065794 3300035398 Bacteria 2282
104 Ga0373931_0139296 3300035691 Bacteria 1403
105 Ga0373935_0014065 3300035692 Bacteria 4833
106 Ga0373935_0281233 3300035692 Bacteria 1171
107 Ga0373933_0000098 3300035724 Bacteria 54263
108 Ga0373933_0028219 3300035724 Bacteria 3236
109 Ga0373933_0040638 3300035724 Bacteria 2741
110 Ga0373933_0131275 3300035724 Bacteria 1575
111 Ga0373937_0000067 3300036401 Bacteria 94291
112 Ga0373937_0001941 3300036401 Bacteria 17308
113 Ga0373937_0006071 3300036401 Bacteria 10399
114 Ga0316584_0111293 3300036712 Bacteria 2049
115 Ga0395900_0049427 3300037418 Bacteria 4333
116 Ga0395905_0023173 3300037471 Bacteria 5870
117 Ga0395901_0034696 3300038443 Bacteria 5211
118 Ga0395901_0084120 3300038443 Bacteria 3325
119 Ga0436365_0269969 3300039437 Bacteria 21391
120 Ga0439465_0110987 3300041413 Bacteria 954
121 Ga0451797_1254199 3300041453 Bacteria 894
122 Ga0451853_0988056 3300041512 Bacteria 3583
123 Ga0439459_0011868 3300042438 Bacteria 1542
124 Ga0466963_0067504 3300044694 Bacteria 2400
125 Ga0466971_0026161 3300044719 Bacteria 2607
126 Ga0466957_0005717 3300044842 Bacteria 6993
127 Ga0466957_0142294 3300044842 Bacteria 1546
128 Ga0466957_0400034 3300044842 Bacteria 939
129 Ga0466960_0004413 3300044901 Bacteria 5495
130 Ga0466967_0001378 3300045976 Bacteria 14007
131 Ga0466967_0018592 3300045976 Bacteria 5559
132 Ga0466967_0055627 3300045976 Bacteria 3486
133 Ga0466967_0854697 3300045976 Bacteria 904
134 Ga0495592_0000069 3300046454 Bacteria 94288
135 Ga0495592_0021300 3300046454 Bacteria 4930
136 Ga0495592_0121146 3300046454 Bacteria 1840
137 Ga0495629_0094311 3300046459 Bacteria 2088
138 Ga0495651_0000016 3300046462 Bacteria 125612
139 Ga0495651_0021925 3300046462 Bacteria 4967
140 Ga0495651_0031123 3300046462 Bacteria 4161
141 Ga0495651_0223037 3300046462 Bacteria 1303
142 Ga0495653_0000770 3300046463 Bacteria 24601
143 Ga0495653_0010124 3300046463 Bacteria 7715
144 Ga0495653_0031473 3300046463 Bacteria 4217
145 Ga0495662_0033168 3300046476 Bacteria 2495
146 Ga0495608_0000051 3300046511 Bacteria 94719
147 Ga0495608_0059769 3300046511 Bacteria 2510
148 Ga0495608_0255611 3300046511 Bacteria 1091
149 Ga0495618_0022838 3300046514 Bacteria 3864
150 Ga0495628_0000126 3300046516 Bacteria 63839
151 Ga0495628_0033095 3300046516 Bacteria 4168
152 Ga0495630_0019377 3300046517 Bacteria 5000
153 Ga0495630_0148405 3300046517 Bacteria 1784
154 Ga0495652_0000761 3300046529 Bacteria 37066
155 Ga0495652_0034221 3300046529 Bacteria 4429
156 Ga0495652_0087242 3300046529 Bacteria 2559
157 Ga0495652_0301292 3300046529 Bacteria 1165
158 Ga0495665_0052268 3300046531 Bacteria 2163
159 Ga0495640_0026316 3300046533 Bacteria 4205
160 Ga0495587_0000058 3300046536 Bacteria 94307
161 Ga0495587_0059973 3300046536 Bacteria 2232
162 Ga0495645_0036012 3300046543 Bacteria 3608
163 Ga0495645_0039231 3300046543 Bacteria 3455
164 Ga0495667_0000062 3300046559 Bacteria 94307
165 Ga0495667_0007401 3300046559 Bacteria 7444
166 Ga0495667_0023647 3300046559 Bacteria 4138
167 Ga0495634_0006209 3300046642 Bacteria 9105
168 Ga0495657_0000065 3300046675 Bacteria 94307
169 Ga0495657_0006244 3300046675 Bacteria 9344
170 Ga0495657_0085761 3300046675 Bacteria 2029
171 Ga0495599_0000045 3300046678 Bacteria 86086
172 Ga0495599_0006600 3300046678 Bacteria 7002
173 Ga0495599_0019207 3300046678 Bacteria 4262
174 Ga0495599_0072579 3300046678 Bacteria 2149
175 Ga0495623_0000051 3300046679 Bacteria 72814
176 Ga0495646_0111221 3300046680 Bacteria 1559
177 Ga0495613_0320282 3300046689 Bacteria 1070
178 Ga0495600_0000392 3300046809 Bacteria 22642
179 Ga0495581_0037479 3300047315 Bacteria 2806
180 Ga0495604_0000233 3300047317 Bacteria 49951
181 Ga0495604_0056288 3300047317 Bacteria 3028
182 Ga0495604_0057600 3300047317 Bacteria 2987
183 Ga0495674_0093573 3300047319 Bacteria 2564
184 Ga0495676_0416072 3300047321 Bacteria 890
185 Ga0495680_0000444 3300047322 Bacteria 46401
186 Ga0495680_0002889 3300047322 Bacteria 17262
187 Ga0495680_0009939 3300047322 Bacteria 8519
188 Ga0495675_0027125 3300047444 Bacteria 3650
189 Ga0495675_0195968 3300047444 Bacteria 1231
190 Ga0495684_0000934 3300047471 Bacteria 23721
191 Ga0495684_0018506 3300047471 Bacteria 5366
192 Ga0495593_0051275 3300047673 Bacteria 2184
193 Ga0495602_0000079 3300048088 Bacteria 94307
194 Ga0495602_0015074 3300048088 Bacteria 7817
195 Ga0495602_0077887 3300048088 Bacteria 2802
196 Ga0496105_0001777 3300048908 Bacteria 15400
197 Ga0496108_0000019 3300048911 Bacteria 234657
198 Ga0496108_0017499 3300048911 Bacteria 5864
199 Ga0496109_0092348 3300048912 Bacteria 2800
200 Ga0496111_0399492 3300048914 Bacteria 1016
201 Ga0496112_0139437 3300048915 Bacteria 2394
202 Ga0496113_0313443 3300048916 Bacteria 1257
203 Ga0496115_0007394 3300048918 Bacteria 8081
204 Ga0496121_0018213 3300048924 Bacteria 7099
205 Ga0496123_0009914 3300048926 Bacteria 8499
206 Ga0496124_0010415 3300048927 Bacteria 9412
207 Ga0496124_0047925 3300048927 Bacteria 3653
208 Ga0501033_0178400 3300049570 Bacteria 1523
209 Ga0501034_0004704 3300049571 Bacteria 15113
210 Ga0501034_0442101 3300049571 Bacteria 1219
211 Ga0501036_0110290 3300049572 Bacteria 2325
212 Ga0501037_0004686 3300049573 Bacteria 9940
213 Ga0501043_0009686 3300049579 Bacteria 7550
214 Ga0501046_0000984 3300049580 Bacteria 27839
215 Ga0501047_0009553 3300049581 Bacteria 9167
216 Ga0501048_0300710 3300049582 Bacteria 1141
217 Ga0501067_0020683 3300049583 Bacteria 3642
218 Ga0501070_0001022 3300049586 Bacteria 25144
219 Ga0501072_0068850 3300049588 Bacteria 2793
220 Ga0501073_0130094 3300049589 Bacteria 1745
221 Ga0501080_0081137 3300049742 Bacteria 3014
222 Ga0501035_0005719 3300049822 Bacteria 11725
223 Ga0501044_0002951 3300049823 Bacteria 19349
224 nmdc:mga03n38_9492_c1 3300050490 Bacteria 3543
225 nmdc:mga00v17_250447_c1 3300050491 Bacteria 1148
226 nmdc:mga06r32_2791_c1 3300050510 Bacteria 15635
227 Ga0495595_0001590 3300053084 Bacteria 8867
228 Ga0495619_0010504 3300053085 Bacteria 5826
229 Ga0500646_0025734 3300053090 Bacteria 1591
230 Ga0500583_0239879 3300053092 Bacteria 896
231 Ga0500650_0076536 3300053098 Bacteria 1564
232 Ga0500559_0027572 3300053136 Bacteria 2424
233 Ga0500600_0060042 3300053149 Bacteria 2123
234 2501944737 2501939600 Bacteria 6907073
235 2515493843 2515154088 Bacteria 5526283
236 2515755234 2515154137 Bacteria 5711575
237 2516087624 2515154203 Bacteria 5458536
238 2623586501 2622736626 Bacteria 7181580
239 2676481481 2675903059 Bacteria 8644972
240 2753270604 2751185782 Bacteria 11227053
241 2772641730 2772190715 Bacteria 6959372
242 2772646539 2772190715 Bacteria 6959372
243 2831940402 2831935698 Bacteria 5963223
244 2832007826 2832004796 Bacteria 6538017
245 2855672285 2855670206 Bacteria 7120389
246 2855678926 2855676851 Bacteria 7063653
247 2855684186 2855683550 Bacteria 7134265
248 2856860422 2856858025 Bacteria 7255264
249 2857289996 2857288857 Bacteria 7189066
250 2858849828 2858848962 Bacteria 6963058
251 2858872495 2858868258 Bacteria 7683772
252 2858888593 2858882152 Bacteria 7230291
253 2858890699 2858888857 Bacteria 7060307
254 2858898619 2858895516 Bacteria 7378898
255 2858908743 2858902515 Bacteria 7086037
256 2861524876 2861520306 Bacteria 8348283
257 2866066489 2866065130 Bacteria 6518152
258 2867303878 2867302475 Bacteria 7087181
259 2867313280 2867312974 Bacteria 7058875
260 2867325721 2867319477 Bacteria 7069771
261 2867509389 2867507094 Bacteria 6506033
262 2869054089 2869048445 Bacteria 6875584
263 2869068532 2869061728 Bacteria 7112407
264 2869072864 2869068681 Bacteria 7205615
265 2880493689 2880489317 Bacteria 7096270
266 2880498634 2880495981 Bacteria 7340502
267 2902586318 2902582711 Bacteria 6187705
268 2929220631 2929219909 Bacteria 6984360
269 2929227212 2929226422 Bacteria 7248583
270 2996227287 2996221748 Bacteria 6799777
271 649811161 649633069 Bacteria 6962533
272 8003835045 8003830390 Bacteria 6541657
273 8003861759 8003856774 Bacteria 7675274
274 8003872391 8003870546 Bacteria 7396674
275 8054708145 8054704163 Bacteria 7247792
276 8054730931 8054727385 Bacteria 7558670
277 8054735062 8054734606 Bacteria 6947278
278 8055412925 8055412473 Bacteria 6257500
279 Ga0081540_1012198
280 Ga0070658_10065620
281 Ga0070682_100005222
282 Ga0070661_100086012
283 Ga0070668_100018208
284 Ga0070659_100017351
285 Ga0070708_100161920
286 Ga0070708_100533183
287 Ga0070663_100111680
288 Ga0070706_100063854
289 Ga0070698_100101264
290 Ga0070699_100055066
291 Ga0070697_100169508
292 Ga0070665_100176787
293 Ga0068857_100016511
294 Ga0068863_100142980
295 Ga0068858_100048229
296 Ga0068858_100077773
297 Ga0068862_100055126
298 Ga0068862_100103628
299 Ga0081455_10153593
300 Ga0081539_10000094
301 Ga0081539_10000733
302 Ga0081539_10006745
303 Ga0081539_10015806
304 Ga0070717_10023820
305 Ga0070717_10233275
306 Ga0070717_10755357
307 Ga0075363_100001651
308 Ga0075431_100061456
309 Ga0105245_10032217
310 Ga0105245_10411876
311 Ga0157378_10370601
312 Ga0163162_10294733
313 Ga0157372_10431652
314 Ga0157375_10412973
315 Ga0197907_10136971
316 Ga0207685_10001126
317 Ga0207705_10317535
318 Ga0207671_10020126
319 Ga0207646_10323345
320 Ga0207650_10159185
321 Ga0207690_10098377
322 Ga0207668_10000695
323 Ga0207668_10290218
324 Ga0207677_10106029
325 Ga0207683_10135281
326 Ga0207698_10050504
327 Ga0268266_10530740
328 Ga0268265_10037042
329 Ga0307515_10000088
330 Ga0307515_10043854
331 Ga0307515_10172511
332 Ga0307512_10002517
333 Ga0307512_10005343
334 Ga0307512_10128858
335 Ga0307513_10012419
336 Ga0307513_10017027
337 Ga0307509_10017350
338 Ga0307408_100008655
339 Ga0307508_10001555
340 Ga0307508_10002147
341 Ga0307508_10138196
342 Ga0316576_10146698
343 Ga0316578_10028871
344 Ga0307516_10010855
345 Ga0307516_10278727
346 Ga0307405_10003032
347 Ga0316577_10108013
348 Ga0307406_10005623
349 Ga0307407_10006636
350 Ga0307409_100003596
351 Ga0307409_100122109
352 Ga0307416_100027617
353 Ga0307416_100114019
354 Ga0307414_10351460
355 Ga0307415_100022686
356 Ga0307415_100326242
357 Ga0307415_100369282
358 Ga0373934_0006063
359 Ga0373934_0009779
360 Ga0373940_0016483
361 Ga0373951_0000024
362 Ga0373923_0065216
363 Ga0373932_0059531
364 Ga0373953_0011324
365 Ga0373953_0040906
366 Ga0373954_0000183
367 Ga0373954_0063733
368 Ga0373956_0001527
369 Ga0373956_0044715
370 Ga0373956_0124296
371 Ga0373956_0139310
372 Ga0373957_0000119
373 Ga0373957_0007883
374 Ga0373943_0026870
375 Ga0373955_0000126
376 Ga0373955_0115685
377 Ga0373955_0175097
378 Ga0373942_0000049
379 Ga0373962_0000155
380 Ga0373962_0049711
381 Ga0316574_0065794
382 Ga0373931_0139296
383 Ga0373935_0014065
384 Ga0373935_0281233
385 Ga0373933_0000098
386 Ga0373933_0028219
387 Ga0373933_0040638
388 Ga0373933_0131275
389 Ga0373937_0000067
390 Ga0373937_0001941
391 Ga0373937_0006071
392 Ga0316584_0111293
393 Ga0395900_0049427
394 Ga0395905_0023173
395 Ga0395901_0034696
396 Ga0395901_0084120
397 Ga0436365_0269969
398 Ga0439465_0110987
399 Ga0451797_1254199
400 Ga0451853_0988056
401 Ga0439459_0011868
402 Ga0466963_0067504
403 Ga0466971_0026161
404 Ga0466957_0005717
405 Ga0466957_0142294
406 Ga0466957_0400034
407 Ga0466960_0004413
408 Ga0466967_0001378
409 Ga0466967_0018592
410 Ga0466967_0055627
411 Ga0466967_0854697
412 Ga0495592_0000069
413 Ga0495592_0021300
414 Ga0495592_0121146
415 Ga0495629_0094311
416 Ga0495651_0000016
417 Ga0495651_0021925
418 Ga0495651_0031123
419 Ga0495651_0223037
420 Ga0495653_0000770
421 Ga0495653_0010124
422 Ga0495653_0031473
423 Ga0495662_0033168
424 Ga0495608_0000051
425 Ga0495608_0059769
426 Ga0495608_0255611
427 Ga0495618_0022838
428 Ga0495628_0000126
429 Ga0495628_0033095
430 Ga0495630_0019377
431 Ga0495630_0148405
432 Ga0495652_0000761
433 Ga0495652_0034221
434 Ga0495652_0087242
435 Ga0495652_0301292
436 Ga0495665_0052268
437 Ga0495640_0026316
438 Ga0495587_0000058
439 Ga0495587_0059973
440 Ga0495645_0036012
441 Ga0495645_0039231
442 Ga0495667_0000062
443 Ga0495667_0007401
444 Ga0495667_0023647
445 Ga0495634_0006209
446 Ga0495657_0000065
447 Ga0495657_0006244
448 Ga0495657_0085761
449 Ga0495599_0000045
450 Ga0495599_0006600
451 Ga0495599_0019207
452 Ga0495599_0072579
453 Ga0495623_0000051
454 Ga0495646_0111221
455 Ga0495613_0320282
456 Ga0495600_0000392
457 Ga0495581_0037479
458 Ga0495604_0000233
459 Ga0495604_0056288
460 Ga0495604_0057600
461 Ga0495674_0093573
462 Ga0495676_0416072
463 Ga0495680_0000444
464 Ga0495680_0002889
465 Ga0495680_0009939
466 Ga0495675_0027125
467 Ga0495675_0195968
468 Ga0495684_0000934
469 Ga0495684_0018506
470 Ga0495593_0051275
471 Ga0495602_0000079
472 Ga0495602_0015074
473 Ga0495602_0077887
474 Ga0496105_0001777
475 Ga0496108_0000019
476 Ga0496108_0017499
477 Ga0496109_0092348
478 Ga0496111_0399492
479 Ga0496112_0139437
480 Ga0496113_0313443
481 Ga0496115_0007394
482 Ga0496121_0018213
483 Ga0496123_0009914
484 Ga0496124_0010415
485 Ga0496124_0047925
486 Ga0501033_0178400
487 Ga0501034_0004704
488 Ga0501034_0442101
489 Ga0501036_0110290
490 Ga0501037_0004686
491 Ga0501043_0009686
492 Ga0501046_0000984
493 Ga0501047_0009553
494 Ga0501048_0300710
495 Ga0501067_0020683
496 Ga0501070_0001022
497 Ga0501072_0068850
498 Ga0501073_0130094
499 Ga0501080_0081137
500 Ga0501035_0005719
501 Ga0501044_0002951
502 nmdc:mga03n38_9492_c1
503 nmdc:mga00v17_250447_c1
504 nmdc:mga06r32_2791_c1
505 Ga0495595_0001590
506 Ga0495619_0010504
507 Ga0500646_0025734
508 Ga0500583_0239879
509 Ga0500650_0076536
510 Ga0500559_0027572
511 Ga0500600_0060042
512 2501944737
513 2515493843
514 2515755234
515 2516087624
516 2623586501
517 2676481481
518 2753270604
519 2772641730
520 2772646539
521 2831940402
522 2832007826
523 2855672285
524 2855678926
525 2855684186
526 2856860422
527 2857289996
528 2858849828
529 2858872495
530 2858888593
531 2858890699
532 2858898619
533 2858908743
534 2861524876
535 2866066489
536 2867303878
537 2867313280
538 2867325721
539 2867509389
540 2869054089
541 2869068532
542 2869072864
543 2880493689
544 2880498634
545 2902586318
546 2929220631
547 2929227212
548 2996227287
549 649811161
550 8003835045
551 8003861759
552 8003872391
553 8054708145
554 8054730931
555 8054735062
556 8055412925

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

179

292

0.83

PF00459

Inositol_P

Inositol monophosphatase family

26

171

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5djh-assembly1.cif.gz_A structure of m. tuberculosis cysq, a pap phosphatase with amp, po4, and 3mg bound 0.9489 20 269
5dji-assembly1.cif.gz_A structure of m. tuberculosis cysq, a pap phosphatase with amp, po4, and 2mg bound 0.9447 20 269
5djg-assembly1.cif.gz_A structure of m. tuberculosis cysq, a pap phosphatase with pap, mg, and li bound 0.9396 20 269
5djf-assembly1.cif.gz_A structure of m. tuberculosis cysq, a pap phosphatase - ligand-free structure 0.9389 20 269
5djk-assembly1.cif.gz_A structure of m. tuberculosis cysq, a pap phosphatase with po4 and 2ca bound 0.9336 20 269
ID Description Score Start End Superfamily
af_P9WKJ1_154_255_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9495 159 259 3.40.190.80
af_P9WKJ1_154_255_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9317 159 259 3.40.190.80
af_P9WKJ1_12_146_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9251 20 149 3.30.540.10
af_P22255_147_245_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9106 162 255 3.40.190.80
2q74C01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.8923 19 147 3.30.540.10
ID Description Score Start End GO Terms
AF-A0A5B7RDC7-F1-model_v4 3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase (DPNPase) 0.9926 7 273 GO:0000103
GO:0008441
GO:0046872
GO:0050427
AF-A0A5B1LKV3-F1-model_v4 3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase (DPNPase) 0.9919 7 273 GO:0000103
GO:0008441
GO:0046872
GO:0050427
AF-A0A838LI24-F1-model_v4 3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase (DPNPase) 0.9907 8 273 GO:0000103
GO:0008441
GO:0046872
GO:0050427
AF-A0A1M9JJQ9-F1-model_v4 deleted 0.9896 189 269
AF-A0A2S8MMA7-F1-model_v4 deleted 0.9888 180 265

Map