F382052

General Info

Members Datasets Scaffolds Average Seq Length
277 179 249 459

Family's Representative Sequence

Representative Sequence 3300049824|Ga0501045_0016711|Ga0501045_0016711_26_1594
Length 522
Sequence VQLDGHALVHHPAQASAANVSRMPDVVTMDKIVSLAKRRGFVFPSSEIYGGLGSAWDYGPLGVELKRNIRNLWWRDVVHLRRDVLGLEAAVLMHPRVWEASGHLERFSDPMVDCKACKRRFRADQLDEQAWVHYCPATKGNRFDVPAGEPCRHCGASRTLCPECGKGELTEPRQFNLMLKTFLGPVEDAAAVTYLRPETAQGMFVNFENVAQSMRRKLPFGIAQIGRSFRNEITPGNFIFRTREFEQMELEFFVNPLDTVEGRPADEWWHDRWIEERIGWYRRYGVREENLRVREHAKEELAHYAKRTVDIEYRFAIGWSELEGIANRTDFDLRRHAEVSGRTLTYFDDERKQHVVPYVIEPAAGVDRTLLAILTDAYHVEDVRGEKRVVLRFHPEVAPVKVAVLPLLKKRDEIVARCWEIRDGLAARGWASVYDDTAAIGRLYRRQDEVGTPYCVTVDVQTVGDPAKGEAGDGRVTIRDRDSMGQVRVPVPELEPVLGDLLAGTPWATVAARYPAQTAAGG

Samples

Sample ID Description Type Environment
1 2506783011 Frankia datiscae Dg1 Isolate Nodule
2 2558860280 Kutzneria sp. 744 Isolate Unclassified
3 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
4 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
5 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
6 2773857933 Frankia sp. BMG5.30 Isolate Nodule
7 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
8 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
9 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
10 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
11 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
12 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
13 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
14 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
15 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
16 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
17 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
18 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
19 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
20 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
21 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
22 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
23 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
24 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
83 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
86 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
87 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
94 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
95 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
96 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
107 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
166 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
171 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
172 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
176 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
177 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
178 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
179 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.89
Metatranscriptomes 0
Isolates 10.11

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 3.25
Nodule 1.08
Rhizoplane 9.75
Rhizosphere 75.45
Stem 0
Stem Tuber 0
Unclassified 10.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000899 3300003203 Bacteria 13981
2 Ga0070658_10000071 3300005327 Bacteria 98592
3 Ga0070660_100088828 3300005339 Bacteria 2434
4 Ga0070669_100012397 3300005353 Bacteria 6047
5 Ga0070674_100007495 3300005356 Bacteria 6439
6 Ga0070673_100000650 3300005364 Bacteria 19053
7 Ga0070703_10000614 3300005406 Bacteria 12676
8 Ga0070710_10000241 3300005437 Bacteria 25663
9 Ga0070700_100026774 3300005441 Bacteria 3410
10 Ga0070708_100002400 3300005445 Bacteria 14521
11 Ga0070708_100003168 3300005445 Bacteria 12829
12 Ga0070708_100024198 3300005445 Bacteria 5175
13 Ga0070708_100033988 3300005445 Bacteria 4432
14 Ga0070678_100002198 3300005456 Bacteria 10607
15 Ga0068867_100003799 3300005459 Bacteria 10626
16 Ga0070685_10011486 3300005466 Bacteria 4635
17 Ga0070706_100067513 3300005467 Bacteria 3307
18 Ga0070706_100135653 3300005467 Bacteria 2297
19 Ga0070707_100005099 3300005468 Bacteria 12314
20 Ga0070707_100170595 3300005468 Bacteria 2120
21 Ga0070698_100004159 3300005471 Bacteria 15911
22 Ga0070698_100049713 3300005471 Bacteria 4278
23 Ga0070698_100087507 3300005471 Bacteria 3101
24 Ga0070699_100017805 3300005518 Bacteria 6101
25 Ga0070699_100080758 3300005518 Bacteria 2834
26 Ga0070699_100104460 3300005518 Bacteria 2484
27 Ga0070704_100110406 3300005549 Bacteria 2091
28 Ga0068856_100330023 3300005614 Bacteria 1543
29 Ga0081455_10009292 3300005937 Bacteria 10124
30 Ga0081455_10009550 3300005937 Bacteria 9964
31 Ga0081455_10011011 3300005937 Bacteria 9112
32 Ga0081455_10051742 3300005937 Bacteria 3521
33 Ga0081455_10082295 3300005937 Bacteria 2633
34 Ga0081539_10000128 3300005985 Bacteria 179041
35 Ga0081539_10004053 3300005985 Bacteria 16773
36 Ga0075365_10020132 3300006038 Bacteria 4131
37 Ga0075365_10063456 3300006038 Bacteria 2474
38 Ga0075369_10009575 3300006186 Bacteria 3769
39 Ga0075370_10079811 3300006353 Bacteria 1880
40 Ga0075428_100168932 3300006844 Bacteria 2372
41 Ga0075428_100245292 3300006844 Bacteria 1932
42 Ga0075433_10006691 3300006852 Bacteria 9130
43 Ga0075434_100029474 3300006871 Bacteria 5401
44 Ga0075429_100123149 3300006880 Bacteria 2267
45 Ga0105240_10000003 3300009093 Bacteria 1183681
46 Ga0111539_10021077 3300009094 Bacteria 8026
47 Ga0105245_10000093 3300009098 Bacteria 86866
48 Ga0105245_10270372 3300009098 Bacteria 1658
49 Ga0114129_10001808 3300009147 Bacteria 29161
50 Ga0114129_10001841 3300009147 Bacteria 28877
51 Ga0114129_10009414 3300009147 Bacteria 13923
52 Ga0114129_10009430 3300009147 Bacteria 13914
53 Ga0114129_10028952 3300009147 Bacteria 7847
54 Ga0114129_10046730 3300009147 Bacteria 6084
55 Ga0114129_10170224 3300009147 Bacteria 2970
56 Ga0114129_10374858 3300009147 Bacteria 1880
57 Ga0105243_10000001 3300009148 Bacteria 1156578
58 Ga0105243_10004351 3300009148 Bacteria 11214
59 Ga0105243_10011898 3300009148 Bacteria 6582
60 Ga0105243_10023239 3300009148 Bacteria 4719
61 Ga0105242_10000002 3300009176 Bacteria 262559
62 Ga0105242_10028469 3300009176 Bacteria 4449
63 Ga0105242_10045811 3300009176 Bacteria 3545
64 Ga0105237_10014516 3300009545 Bacteria 8232
65 Ga0105239_10025403 3300010375 Bacteria 6522
66 Ga0105239_10079477 3300010375 Bacteria 3609
67 Ga0105239_10291867 3300010375 Bacteria 1836
68 Ga0157374_10150971 3300013296 Bacteria 2259
69 Ga0157378_10004792 3300013297 Bacteria 11856
70 Ga0157378_10011062 3300013297 Bacteria 7898
71 Ga0157378_10032583 3300013297 Bacteria 4605
72 Ga0157375_10345019 3300013308 Bacteria 1654
73 Ga0157379_10232732 3300014968 Bacteria 1670
74 Ga0213876_10007163 3300021384 Bacteria 6080
75 Ga0207653_10000194 3300025885 Bacteria 41707
76 Ga0207705_10000065 3300025909 Bacteria 137123
77 Ga0207684_10008501 3300025910 Bacteria 9134
78 Ga0207695_10000005 3300025913 Bacteria 1196715
79 Ga0207646_10013209 3300025922 Bacteria 7902
80 Ga0207646_10015973 3300025922 Bacteria 7059
81 Ga0207646_10032813 3300025922 Bacteria 4697
82 Ga0207646_10039563 3300025922 Bacteria 4244
83 Ga0207687_10014131 3300025927 Bacteria 5221
84 Ga0207664_10002024 3300025929 Bacteria 13342
85 Ga0207686_10000001 3300025934 Bacteria 1169580
86 Ga0207686_10028874 3300025934 Bacteria 3265
87 Ga0207709_10000002 3300025935 Bacteria 1171536
88 Ga0207669_10057502 3300025937 Bacteria 2368
89 Ga0207689_10218645 3300025942 Bacteria 1574
90 Ga0207658_10101812 3300025986 Bacteria 2252
91 Ga0207678_10128313 3300026067 Bacteria 2163
92 Ga0207648_10007561 3300026089 Bacteria 10664
93 Ga0207675_100196392 3300026118 Bacteria 1937
94 Ga0207428_10014817 3300027907 Bacteria 6754
95 Ga0265319_1015048 3300028563 Bacteria 3013
96 Ga0265323_10002809 3300028653 Bacteria 7840
97 Ga0265338_10070101 3300028800 Bacteria 3008
98 Ga0307511_10000962 3300030521 Bacteria 30518
99 Ga0316177_1047418 3300030731 Bacteria 2056
100 Ga0316181_1239496 3300030744 Bacteria 3957
101 Ga0307513_10051088 3300031456 Bacteria 4463
102 Ga0307513_10184949 3300031456 Bacteria 1942
103 Ga0307509_10120590 3300031507 Bacteria 2600
104 Ga0307413_10000436 3300031824 Bacteria 13567
105 Ga0307409_100068964 3300031995 Bacteria 2799
106 Ga0307411_10000816 3300032005 Bacteria 11658
107 Ga0307507_10064262 3300033179 Bacteria 3388
108 Ga0373926_0006441 3300035083 Bacteria 3898
109 Ga0373943_0077764 3300035170 Bacteria 1695
110 Ga0373931_0090460 3300035691 Bacteria 1704
111 Ga0373947_0000006 3300035725 Bacteria 223611
112 Ga0373947_0070653 3300035725 Bacteria 2140
113 Ga0395899_0017507 3300037312 Bacteria 5459
114 Ga0395900_0002192 3300037418 Bacteria 21809
115 Ga0395900_0046480 3300037418 Bacteria 4470
116 Ga0395898_0006286 3300037466 Bacteria 12697
117 Ga0395905_0003662 3300037471 Bacteria 16303
118 Ga0436364_0253556 3300037853 Bacteria 12601
119 Ga0436364_1288378 3300037853 Bacteria 9795
120 Ga0395901_0003598 3300038443 Bacteria 15633
121 Ga0395901_0008939 3300038443 Bacteria 10143
122 Ga0436365_1182134 3300039437 Bacteria 11960
123 Ga0436365_1729840 3300039437 Bacteria 2827
124 Ga0436365_1912638 3300039437 Bacteria 11153
125 Ga0436363_0803041 3300039450 Bacteria 2330
126 Ga0436362_1152383 3300039453 Bacteria 2420
127 Ga0439445_0002519 3300042004 Bacteria 4073
128 Ga0466972_0001780 3300044658 Bacteria 10545
129 Ga0453684_0014632 3300044712 Bacteria 12523
130 Ga0466960_0015311 3300044901 Bacteria 3303
131 Ga0466958_0128839 3300045836 Bacteria 1588
132 Ga0466967_0197203 3300045976 Bacteria 1905
133 Ga0495629_0003189 3300046459 Bacteria 12423
134 Ga0495582_0000481 3300046473 Bacteria 21834
135 Ga0495639_0004671 3300046475 Bacteria 5883
136 Ga0495635_0042274 3300046663 Bacteria 3147
137 Ga0495588_0012589 3300046674 Bacteria 4004
138 Ga0495658_0001126 3300046683 Bacteria 14143
139 Ga0495613_0001629 3300046689 Bacteria 17078
140 Ga0495624_0046642 3300046690 Bacteria 2755
141 Ga0495624_0077489 3300046690 Bacteria 2062
142 Ga0495581_0002663 3300047315 Bacteria 10156
143 Ga0495581_0003627 3300047315 Bacteria 8889
144 Ga0495676_0016474 3300047321 Bacteria 6558
145 Ga0496100_0000343 3300048903 Bacteria 22702
146 Ga0496101_0002687 3300048904 Bacteria 10913
147 Ga0496101_0005421 3300048904 Bacteria 8126
148 Ga0496102_0006756 3300048905 Bacteria 9795
149 Ga0496102_0058510 3300048905 Bacteria 3522
150 Ga0496102_0067334 3300048905 Bacteria 3285
151 Ga0496103_0090658 3300048906 Bacteria 1929
152 Ga0496104_0009165 3300048907 Bacteria 8803
153 Ga0496105_0000945 3300048908 Bacteria 19871
154 Ga0496105_0151114 3300048908 Bacteria 1908
155 Ga0496106_0000434 3300048909 Bacteria 29764
156 Ga0496106_0009642 3300048909 Bacteria 7130
157 Ga0496107_0017937 3300048910 Bacteria 4981
158 Ga0496108_0001902 3300048911 Bacteria 16733
159 Ga0496108_0028744 3300048911 Bacteria 4600
160 Ga0496108_0030089 3300048911 Bacteria 4501
161 Ga0496109_0004912 3300048912 Bacteria 11158
162 Ga0496109_0034977 3300048912 Bacteria 4529
163 Ga0496110_0001479 3300048913 Bacteria 17023
164 Ga0496111_0013275 3300048914 Bacteria 5600
165 Ga0496113_0018482 3300048916 Bacteria 4856
166 Ga0496114_0000588 3300048917 Bacteria 26889
167 Ga0496114_0017971 3300048917 Bacteria 5714
168 Ga0496114_0103170 3300048917 Bacteria 2437
169 Ga0496114_0176124 3300048917 Bacteria 1866
170 Ga0496114_0193664 3300048917 Bacteria 1779
171 Ga0496114_0215958 3300048917 Bacteria 1683
172 Ga0496120_0021547 3300048923 Bacteria 4072
173 Ga0496126_0000339 3300048929 Bacteria 98318
174 Ga0501031_0021592 3300049568 Bacteria 4197
175 Ga0501033_0013199 3300049570 Bacteria 6293
176 Ga0501036_0009357 3300049572 Bacteria 8058
177 Ga0501036_0176618 3300049572 Bacteria 1798
178 Ga0501037_0051739 3300049573 Bacteria 3004
179 Ga0501038_0005438 3300049574 Bacteria 11834
180 Ga0501038_0045190 3300049574 Bacteria 3824
181 Ga0501038_0049948 3300049574 Bacteria 3615
182 Ga0501039_0026416 3300049575 Bacteria 4461
183 Ga0501039_0078331 3300049575 Bacteria 2571
184 Ga0501039_0106865 3300049575 Bacteria 2186
185 Ga0501040_0003773 3300049576 Bacteria 9827
186 Ga0501040_0006695 3300049576 Bacteria 7475
187 Ga0501040_0015073 3300049576 Bacteria 5107
188 Ga0501041_0002063 3300049577 Bacteria 11303
189 Ga0501042_0001751 3300049578 Bacteria 12972
190 Ga0501042_0002424 3300049578 Bacteria 11442
191 Ga0501042_0010319 3300049578 Bacteria 6255
192 Ga0501042_0026615 3300049578 Bacteria 4063
193 Ga0501042_0061770 3300049578 Bacteria 2676
194 Ga0501043_0033206 3300049579 Bacteria 4059
195 Ga0501046_0031138 3300049580 Bacteria 4327
196 Ga0501047_0014739 3300049581 Bacteria 7440
197 Ga0501048_0066909 3300049582 Bacteria 2540
198 Ga0501048_0070332 3300049582 Bacteria 2472
199 Ga0501068_0071981 3300049584 Bacteria 2111
200 Ga0501071_0010025 3300049587 Bacteria 6333
201 Ga0501071_0127031 3300049587 Bacteria 1893
202 Ga0501072_0002623 3300049588 Bacteria 13472
203 Ga0501072_0011673 3300049588 Bacteria 6711
204 Ga0501072_0014400 3300049588 Bacteria 6062
205 Ga0501072_0079046 3300049588 Bacteria 2604
206 Ga0501072_0103335 3300049588 Bacteria 2265
207 Ga0501074_0090310 3300049590 Bacteria 2194
208 Ga0501075_0000024 3300049591 Bacteria 61793
209 Ga0501075_0050456 3300049591 Bacteria 3127
210 Ga0501076_0000078 3300049592 Bacteria 49990
211 Ga0501076_0006510 3300049592 Bacteria 8474
212 Ga0501076_0088721 3300049592 Bacteria 2485
213 Ga0501077_0002068 3300049593 Bacteria 12101
214 Ga0501077_0030377 3300049593 Bacteria 3438
215 Ga0501077_0092770 3300049593 Bacteria 1913
216 Ga0501077_0126939 3300049593 Bacteria 1617
217 Ga0501077_0136178 3300049593 Bacteria 1558
218 Ga0501080_0010495 3300049742 Bacteria 8481
219 Ga0501080_0073210 3300049742 Bacteria 3187
220 Ga0501081_0001708 3300049743 Bacteria 13636
221 Ga0501081_0021850 3300049743 Bacteria 4274
222 Ga0501081_0036875 3300049743 Bacteria 3335
223 Ga0501083_0051619 3300049744 Bacteria 2765
224 Ga0501083_0085630 3300049744 Bacteria 2085
225 Ga0501035_0001463 3300049822 Bacteria 24203
226 Ga0501035_0063750 3300049822 Bacteria 3277
227 Ga0501044_0002078 3300049823 Bacteria 23079
228 Ga0501045_0000269 3300049824 Bacteria 30227
229 Ga0501045_0016711 3300049824 Bacteria 5212
230 nmdc:mga03n38_6193_c1 3300050490 Bacteria 4138
231 nmdc:mga07m45_8177_c1 3300050496 Bacteria 5367
232 nmdc:mga05p37_2198_c1 3300050507 Bacteria 22718
233 nmdc:mga05p37_2834_c1 3300050507 Bacteria 20167
234 nmdc:mga05p37_3107_c1 3300050507 Bacteria 19296
235 nmdc:mga05p37_55529_c1 3300050507 Bacteria 4874
236 nmdc:mga0n895_74413_c1 3300050512 Bacteria 3374
237 nmdc:mga0a205_29385_c1 3300050515 Bacteria 5260
238 Ga0500643_000953 3300053087 Bacteria 18072
239 Ga0500559_0010997 3300053136 Bacteria 3875
240 Ga0500577_0012492 3300053142 Bacteria 2569
241 Ga0501084_0015228 3300054114 Bacteria 6377
242 Ga0501084_0161327 3300054114 Bacteria 1891
243 Ga0501082_0003219 3300060353 Bacteria 14230
244 Ga0501082_0030750 3300060353 Bacteria 4628
245 Ga0501082_0180217 3300060353 Bacteria 1837
246 Ga0530510_0000006 3300061734 Bacteria 180585
247 Ga0530510_0002121 3300061734 Bacteria 13587
248 Ga0530510_0007872 3300061734 Bacteria 7432
249 Ga0530510_0025315 3300061734 Bacteria 4242

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049743 Ga0501081_0036875 Ga0501081_0036875_2044_3324 379
2 3300049574 Ga0501038_0049948 Ga0501038_0049948_2311_3603 383
3 3300035691 Ga0373931_0090460 Ga0373931_0090460_460_1683 391
4 3300049593 Ga0501077_0136178 Ga0501077_0136178_104_1321 402
5 3300054114 Ga0501084_0015228 Ga0501084_0015228_5137_6354 402
6 iso_pu_bacteria 2775506925 2776377253 406
7 3300005937 Ga0081455_10009292 Ga0081455_100092927 407
8 3300028563 Ga0265319_1015048 Ga0265319_10150482 409
9 3300005327 Ga0070658_10000071 Ga0070658_1000007195 419
10 3300005339 Ga0070660_100088828 Ga0070660_1000888282 419
11 3300005356 Ga0070674_100007495 Ga0070674_1000074955 419
12 3300005364 Ga0070673_100000650 Ga0070673_10000065012 419
13 3300005456 Ga0070678_100002198 Ga0070678_1000021986 419
14 3300005466 Ga0070685_10011486 Ga0070685_100114864 419
15 3300010375 Ga0105239_10079477 Ga0105239_100794773 419
16 3300013297 Ga0157378_10032583 Ga0157378_100325833 419
17 3300025909 Ga0207705_10000065 Ga0207705_10000065119 419
18 3300009545 Ga0105237_10014516 Ga0105237_100145168 421
19 3300028653 Ga0265323_10002809 Ga0265323_100028096 421
20 3300044712 Ga0453684_0014632 Ga0453684_0014632_10741_12039 423
21 3300005445 Ga0070708_100024198 Ga0070708_1000241982 425
22 3300005467 Ga0070706_100135653 Ga0070706_1001356532 425
23 3300005468 Ga0070707_100170595 Ga0070707_1001705952 426
24 3300005459 Ga0068867_100003799 Ga0068867_10000379912 430
25 3300009093 Ga0105240_10000003 Ga0105240_100000031199 430
26 3300009098 Ga0105245_10000093 Ga0105245_1000009374 430
27 3300009148 Ga0105243_10000001 Ga0105243_1000000180 430
28 3300009176 Ga0105242_10000002 Ga0105242_10000002202 430
29 3300010375 Ga0105239_10025403 Ga0105239_100254038 430
30 3300013296 Ga0157374_10150971 Ga0157374_101509712 430
31 3300025913 Ga0207695_10000005 Ga0207695_100000051210 430
32 3300025927 Ga0207687_10014131 Ga0207687_100141312 430
33 3300025934 Ga0207686_10000001 Ga0207686_100000011064 430
34 3300025935 Ga0207709_10000002 Ga0207709_100000021181 430
35 3300026067 Ga0207678_10128313 Ga0207678_101283132 430
36 3300026089 Ga0207648_10007561 Ga0207648_1000756112 430
37 3300005441 Ga0070700_100026774 Ga0070700_1000267742 433
38 3300009148 Ga0105243_10023239 Ga0105243_100232393 433
39 3300009176 Ga0105242_10045811 Ga0105242_100458113 433
40 3300013297 Ga0157378_10004792 Ga0157378_1000479211 433
41 3300048911 Ga0496108_0028744 Ga0496108_0028744_660_1964 433
42 3300048912 Ga0496109_0034977 Ga0496109_0034977_761_2065 433
43 3300009147 Ga0114129_10009430 Ga0114129_100094307 435
44 3300009147 Ga0114129_10374858 Ga0114129_103748581 435
45 3300021384 Ga0213876_10007163 Ga0213876_100071632 435
46 3300035725 Ga0373947_0070653 Ga0373947_0070653_505_1878 435
47 3300037853 Ga0436364_0253556 Ga0436364_0253556_9758_11140 435
48 3300039437 Ga0436365_1182134 Ga0436365_1182134_9531_10913 435
49 3300039437 Ga0436365_1729840 Ga0436365_1729840_391_1755 435
50 3300039437 Ga0436365_1912638 Ga0436365_1912638_211_1593 435
51 3300039453 Ga0436362_1152383 Ga0436362_1152383_828_2210 435
52 3300050507 nmdc:mga05p37_2834_c1 nmdc:mga05p37_2834_c1_5466_6818 435
53 3300005471 Ga0070698_100004159 Ga0070698_1000041592 436
54 3300005471 Ga0070698_100049713 Ga0070698_1000497135 436
55 3300005518 Ga0070699_100080758 Ga0070699_1000807582 436
56 3300005518 Ga0070699_100104460 Ga0070699_1001044602 436
57 3300037853 Ga0436364_1288378 Ga0436364_1288378_6441_7826 436
58 3300005614 Ga0068856_100330023 Ga0068856_1003300231 437
59 3300005406 Ga0070703_10000614 Ga0070703_100006143 438
60 3300005467 Ga0070706_100067513 Ga0070706_1000675132 438
61 3300005471 Ga0070698_100087507 Ga0070698_1000875073 438
62 3300005549 Ga0070704_100110406 Ga0070704_1001104062 438
63 3300009098 Ga0105245_10270372 Ga0105245_102703722 438
64 3300009148 Ga0105243_10011898 Ga0105243_100118988 438
65 3300009176 Ga0105242_10028469 Ga0105242_100284695 438
66 3300010375 Ga0105239_10291867 Ga0105239_102918671 438
67 3300013297 Ga0157378_10011062 Ga0157378_100110622 438
68 3300013308 Ga0157375_10345019 Ga0157375_103450191 438
69 3300025885 Ga0207653_10000194 Ga0207653_1000019443 438
70 3300025910 Ga0207684_10008501 Ga0207684_100085013 438
71 3300025922 Ga0207646_10039563 Ga0207646_100395633 438
72 3300025934 Ga0207686_10028874 Ga0207686_100288745 438
73 3300025937 Ga0207669_10057502 Ga0207669_100575023 438
74 3300026118 Ga0207675_100196392 Ga0207675_1001963921 438
75 3300046690 Ga0495624_0046642 Ga0495624_0046642_151_1560 438
76 3300047315 Ga0495581_0003627 Ga0495581_0003627_344_1753 438
77 3300048905 Ga0496102_0058510 Ga0496102_0058510_1304_2623 438
78 3300048906 Ga0496103_0090658 Ga0496103_0090658_487_1806 438
79 3300048909 Ga0496106_0009642 Ga0496106_0009642_4567_5886 438
80 3300048910 Ga0496107_0017937 Ga0496107_0017937_1317_2636 438
81 3300035170 Ga0373943_0077764 Ga0373943_0077764_165_1490 440
82 3300046459 Ga0495629_0003189 Ga0495629_0003189_982_2307 440
83 3300046473 Ga0495582_0000481 Ga0495582_0000481_10273_11598 440
84 3300046475 Ga0495639_0004671 Ga0495639_0004671_301_1626 440
85 3300046674 Ga0495588_0012589 Ga0495588_0012589_2271_3596 440
86 3300046683 Ga0495658_0001126 Ga0495658_0001126_1946_3271 440
87 3300046689 Ga0495613_0001629 Ga0495613_0001629_10346_11671 440
88 3300046690 Ga0495624_0077489 Ga0495624_0077489_576_1901 440
89 3300047315 Ga0495581_0002663 Ga0495581_0002663_4288_5613 440
90 3300047321 Ga0495676_0016474 Ga0495676_0016474_2524_3849 440
91 3300005445 Ga0070708_100002400 Ga0070708_1000024005 441
92 3300005468 Ga0070707_100005099 Ga0070707_1000050996 441
93 3300025922 Ga0207646_10013209 Ga0207646_100132092 441
94 3300025922 Ga0207646_10015973 Ga0207646_100159733 441
95 3300025922 Ga0207646_10032813 Ga0207646_100328132 441
96 iso_pu_bacteria 2837183177 2837183765 442
97 3300028800 Ga0265338_10070101 Ga0265338_100701013 443
98 3300006844 Ga0075428_100245292 Ga0075428_1002452921 450
99 3300009147 Ga0114129_10009414 Ga0114129_1000941414 450
100 3300009147 Ga0114129_10170224 Ga0114129_101702243 450
101 3300014968 Ga0157379_10232732 Ga0157379_102327321 450
102 3300049572 Ga0501036_0009357 Ga0501036_0009357_6478_7971 450
103 3300049574 Ga0501038_0005438 Ga0501038_0005438_1616_3109 450
104 3300049575 Ga0501039_0078331 Ga0501039_0078331_558_2051 450
105 3300049576 Ga0501040_0003773 Ga0501040_0003773_91_1584 450
106 3300049576 Ga0501040_0015073 Ga0501040_0015073_2017_3378 450
107 3300049577 Ga0501041_0002063 Ga0501041_0002063_8459_9952 450
108 3300049578 Ga0501042_0001751 Ga0501042_0001751_4916_6277 450
109 3300049578 Ga0501042_0002424 Ga0501042_0002424_102_1595 450
110 3300049578 Ga0501042_0026615 Ga0501042_0026615_2146_3639 450
111 3300049578 Ga0501042_0061770 Ga0501042_0061770_1123_2616 450
112 3300049580 Ga0501046_0031138 Ga0501046_0031138_2201_3694 450
113 3300049582 Ga0501048_0070332 Ga0501048_0070332_509_1993 450
114 3300049587 Ga0501071_0010025 Ga0501071_0010025_4820_6313 450
115 3300049587 Ga0501071_0127031 Ga0501071_0127031_260_1756 450
116 3300049588 Ga0501072_0002623 Ga0501072_0002623_5702_7195 450
117 3300049588 Ga0501072_0014400 Ga0501072_0014400_2973_4466 450
118 3300049590 Ga0501074_0090310 Ga0501074_0090310_473_1969 450
119 3300049591 Ga0501075_0000024 Ga0501075_0000024_10612_12105 450
120 3300049591 Ga0501075_0050456 Ga0501075_0050456_1520_3013 450
121 3300049592 Ga0501076_0000078 Ga0501076_0000078_18208_19701 450
122 3300049592 Ga0501076_0006510 Ga0501076_0006510_2162_3655 450
123 3300049592 Ga0501076_0088721 Ga0501076_0088721_543_2036 450
124 3300049593 Ga0501077_0002068 Ga0501077_0002068_1014_2507 450
125 3300049593 Ga0501077_0030377 Ga0501077_0030377_569_2065 450
126 3300049593 Ga0501077_0092770 Ga0501077_0092770_79_1572 450
127 3300049593 Ga0501077_0126939 Ga0501077_0126939_102_1586 450
128 3300049742 Ga0501080_0010495 Ga0501080_0010495_5905_7398 450
129 3300049742 Ga0501080_0073210 Ga0501080_0073210_1599_3092 450
130 3300049743 Ga0501081_0001708 Ga0501081_0001708_5974_7467 450
131 3300049743 Ga0501081_0021850 Ga0501081_0021850_1426_2919 450
132 3300049744 Ga0501083_0051619 Ga0501083_0051619_90_1586 450
133 3300049744 Ga0501083_0085630 Ga0501083_0085630_375_1868 450
134 3300049824 Ga0501045_0000269 Ga0501045_0000269_25342_26835 450
135 3300050507 nmdc:mga05p37_2198_c1 nmdc:mga05p37_2198_c1_18472_19968 450
136 3300054114 Ga0501084_0161327 Ga0501084_0161327_73_1566 450
137 3300060353 Ga0501082_0003219 Ga0501082_0003219_11445_12938 450
138 3300060353 Ga0501082_0030750 Ga0501082_0030750_1998_3491 450
139 3300061734 Ga0530510_0000006 Ga0530510_0000006_16480_17973 450
140 3300061734 Ga0530510_0002121 Ga0530510_0002121_8225_9718 450
141 3300061734 Ga0530510_0007872 Ga0530510_0007872_2136_3611 450
142 3300045976 Ga0466967_0197203 Ga0466967_0197203_492_1862 451
143 3300048929 Ga0496126_0000339 Ga0496126_0000339_42728_44098 451
144 3300049824 Ga0501045_0016711 Ga0501045_0016711_26_1594 451
145 3300053087 Ga0500643_000953 Ga0500643_000953_10971_12338 452
146 3300005937 Ga0081455_10082295 Ga0081455_100822951 453
147 3300006844 Ga0075428_100168932 Ga0075428_1001689323 453
148 3300006880 Ga0075429_100123149 Ga0075429_1001231492 453
149 3300009147 Ga0114129_10046730 Ga0114129_100467307 453
150 3300005445 Ga0070708_100003168 Ga0070708_1000031683 454
151 3300005518 Ga0070699_100017805 Ga0070699_1000178055 454
152 3300005937 Ga0081455_10009550 Ga0081455_100095505 454
153 3300005937 Ga0081455_10011011 Ga0081455_100110113 454
154 3300005937 Ga0081455_10051742 Ga0081455_100517423 454
155 3300005985 Ga0081539_10004053 Ga0081539_1000405315 454
156 3300006852 Ga0075433_10006691 Ga0075433_100066916 454
157 3300006871 Ga0075434_100029474 Ga0075434_1000294745 454
158 3300009094 Ga0111539_10021077 Ga0111539_100210776 454
159 3300009147 Ga0114129_10001808 Ga0114129_100018085 454
160 3300009147 Ga0114129_10001841 Ga0114129_1000184121 454
161 3300009147 Ga0114129_10028952 Ga0114129_100289522 454
162 3300027907 Ga0207428_10014817 Ga0207428_100148173 454
163 3300037312 Ga0395899_0017507 Ga0395899_0017507_479_1852 454
164 3300037418 Ga0395900_0002192 Ga0395900_0002192_8092_9465 454
165 3300037418 Ga0395900_0046480 Ga0395900_0046480_1422_2795 454
166 3300037466 Ga0395898_0006286 Ga0395898_0006286_6278_7651 454
167 3300037471 Ga0395905_0003662 Ga0395905_0003662_4902_6275 454
168 3300038443 Ga0395901_0003598 Ga0395901_0003598_876_2249 454
169 3300038443 Ga0395901_0008939 Ga0395901_0008939_651_2024 454
170 3300049568 Ga0501031_0021592 Ga0501031_0021592_364_1737 454
171 3300049575 Ga0501039_0106865 Ga0501039_0106865_697_2070 454
172 3300049582 Ga0501048_0066909 Ga0501048_0066909_709_2082 454
173 3300049588 Ga0501072_0079046 Ga0501072_0079046_567_1940 454
174 3300049588 Ga0501072_0103335 Ga0501072_0103335_496_1869 454
175 3300050507 nmdc:mga05p37_3107_c1 nmdc:mga05p37_3107_c1_15971_17344 454
176 3300050507 nmdc:mga05p37_55529_c1 nmdc:mga05p37_55529_c1_2772_4145 454
177 3300050512 nmdc:mga0n895_74413_c1 nmdc:mga0n895_74413_c1_457_1830 454
178 3300050515 nmdc:mga0a205_29385_c1 nmdc:mga0a205_29385_c1_1270_2643 454
179 3300061734 Ga0530510_0025315 Ga0530510_0025315_2598_3971 454
180 3300035083 Ga0373926_0006441 Ga0373926_0006441_819_2189 455
181 3300035725 Ga0373947_0000006 Ga0373947_0000006_145744_147114 455
182 3300049584 Ga0501068_0071981 Ga0501068_0071981_276_1658 455
183 iso_pu_bacteria 2984592036 2984595158 455
184 iso_pu_bacteria 8047710418 8047711595 455
185 3300005445 Ga0070708_100033988 Ga0070708_1000339885 456
186 iso_pu_bacteria 2902810491 2902812477 456
187 iso_pu_bacteria 2929212328 2929216459 456
188 3300009148 Ga0105243_10004351 Ga0105243_100043516 457
189 3300048917 Ga0496114_0103170 Ga0496114_0103170_188_1564 457
190 iso_pu_bacteria 2506783011 2506866186 457
191 iso_pu_bacteria 2751185734 2753070426 457
192 iso_pu_bacteria 2773857933 2774902437 457
193 iso_pu_bacteria 2791354901 2791910661 457
194 iso_pu_bacteria 2795385470 2795784541 457
195 iso_pu_bacteria 2866612099 2866613940 457
196 iso_pu_bacteria 2870721527 2870729742 457
197 iso_pu_bacteria 2873314349 2873321217 457
198 iso_pu_bacteria 2891326441 2891329897 457
199 iso_pu_bacteria 8055066027 8055067222 457
200 iso_pu_bacteria 8055172936 8055174252 457
201 iso_pu_bacteria 8056207758 8056215823 457
202 3300032005 Ga0307411_10000816 Ga0307411_1000081613 458
203 iso_pu_bacteria 2738543011 2739237213 458
204 iso_pu_bacteria 2889300758 2889302354 458
205 iso_pu_bacteria 2939743619 2939748220 458
206 3300046663 Ga0495635_0042274 Ga0495635_0042274_550_1929 459
207 3300048905 Ga0496102_0006756 Ga0496102_0006756_243_1667 459
208 3300048907 Ga0496104_0009165 Ga0496104_0009165_4981_6390 459
209 3300048908 Ga0496105_0000945 Ga0496105_0000945_5309_6718 459
210 3300048911 Ga0496108_0001902 Ga0496108_0001902_11888_13297 459
211 3300048911 Ga0496108_0030089 Ga0496108_0030089_346_1809 459
212 3300048912 Ga0496109_0004912 Ga0496109_0004912_4348_5757 459
213 3300048913 Ga0496110_0001479 Ga0496110_0001479_2034_3443 459
214 3300048914 Ga0496111_0013275 Ga0496111_0013275_132_1541 459
215 3300048916 Ga0496113_0018482 Ga0496113_0018482_1723_3132 459
216 3300048917 Ga0496114_0017971 Ga0496114_0017971_390_1799 459
217 3300048917 Ga0496114_0193664 Ga0496114_0193664_169_1548 459
218 3300048917 Ga0496114_0215958 Ga0496114_0215958_236_1615 459
219 iso_pu_bacteria 2842134933 2842137326 459
220 iso_pu_bacteria 2863067949 2863068430 459
221 iso_pu_bacteria 3001889506 3001891730 459
222 3300005353 Ga0070669_100012397 Ga0070669_1000123975 460
223 3300006038 Ga0075365_10063456 Ga0075365_100634563 460
224 3300025942 Ga0207689_10218645 Ga0207689_102186452 460
225 3300039450 Ga0436363_0803041 Ga0436363_0803041_15_1406 460
226 3300048903 Ga0496100_0000343 Ga0496100_0000343_21287_22669 460
227 3300048904 Ga0496101_0005421 Ga0496101_0005421_6700_8082 460
228 3300048905 Ga0496102_0067334 Ga0496102_0067334_740_2122 460
229 3300048908 Ga0496105_0151114 Ga0496105_0151114_20_1402 460
230 3300048909 Ga0496106_0000434 Ga0496106_0000434_6341_7723 460
231 3300048917 Ga0496114_0000588 Ga0496114_0000588_49_1431 460
232 3300049570 Ga0501033_0013199 Ga0501033_0013199_2842_4239 460
233 3300049581 Ga0501047_0014739 Ga0501047_0014739_1199_2596 460
234 3300049822 Ga0501035_0001463 Ga0501035_0001463_1351_2748 460
235 3300049823 Ga0501044_0002078 Ga0501044_0002078_21381_22778 460
236 3300050490 nmdc:mga03n38_6193_c1 nmdc:mga03n38_6193_c1_1472_2857 460
237 iso_pu_bacteria 2773857762 2774397139 460
238 iso_pu_bacteria 2808606439 2809198788 460
239 iso_pu_bacteria 2891968417 2891969812 460
240 3300003203 JGI25406J46586_10000899 JGI25406J46586_1000089910 461
241 3300005437 Ga0070710_10000241 Ga0070710_1000024135 461
242 3300005985 Ga0081539_10000128 Ga0081539_1000012810 461
243 3300006038 Ga0075365_10020132 Ga0075365_100201327 461
244 3300006186 Ga0075369_10009575 Ga0075369_100095752 461
245 3300006353 Ga0075370_10079811 Ga0075370_100798112 461
246 3300025929 Ga0207664_10002024 Ga0207664_1000202414 461
247 3300025986 Ga0207658_10101812 Ga0207658_101018121 461
248 3300030521 Ga0307511_10000962 Ga0307511_1000096210 461
249 3300030731 Ga0316177_1047418 Ga0316177_10474182 461
250 3300030744 Ga0316181_1239496 Ga0316181_12394963 461
251 3300031456 Ga0307513_10051088 Ga0307513_100510885 461
252 3300031456 Ga0307513_10184949 Ga0307513_101849492 461
253 3300031507 Ga0307509_10120590 Ga0307509_101205903 461
254 3300031824 Ga0307413_10000436 Ga0307413_100004365 461
255 3300031995 Ga0307409_100068964 Ga0307409_1000689641 461
256 3300033179 Ga0307507_10064262 Ga0307507_100642622 461
257 3300042004 Ga0439445_0002519 Ga0439445_0002519_2575_3978 461
258 3300044658 Ga0466972_0001780 Ga0466972_0001780_2905_4302 461
259 3300044901 Ga0466960_0015311 Ga0466960_0015311_1250_2647 461
260 3300045836 Ga0466958_0128839 Ga0466958_0128839_54_1511 461
261 3300048904 Ga0496101_0002687 Ga0496101_0002687_142_1536 461
262 3300048917 Ga0496114_0176124 Ga0496114_0176124_178_1572 461
263 3300048923 Ga0496120_0021547 Ga0496120_0021547_838_2229 461
264 3300049572 Ga0501036_0176618 Ga0501036_0176618_94_1482 461
265 3300049573 Ga0501037_0051739 Ga0501037_0051739_910_2298 461
266 3300049574 Ga0501038_0045190 Ga0501038_0045190_457_1845 461
267 3300049575 Ga0501039_0026416 Ga0501039_0026416_749_2137 461
268 3300049576 Ga0501040_0006695 Ga0501040_0006695_2308_3696 461
269 3300049578 Ga0501042_0010319 Ga0501042_0010319_2980_4368 461
270 3300049579 Ga0501043_0033206 Ga0501043_0033206_1464_2852 461
271 3300049588 Ga0501072_0011673 Ga0501072_0011673_3035_4423 461
272 3300049822 Ga0501035_0063750 Ga0501035_0063750_1167_2555 461
273 3300050496 nmdc:mga07m45_8177_c1 nmdc:mga07m45_8177_c1_2986_4380 461
274 3300053136 Ga0500559_0010997 Ga0500559_0010997_142_1539 461
275 3300053142 Ga0500577_0012492 Ga0500577_0012492_426_1901 461
276 3300060353 Ga0501082_0180217 Ga0501082_0180217_146_1534 461
277 iso_pu_bacteria 2558860280 2559425876 461

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03129

HGTP_anticodon

Anticodon binding domain

401

501

0.94

PF00587

tRNA-synt_2b

tRNA synthetase class II core domain (G, H, P, S and T)

186

377

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sld-assembly1.cif.gz_A-2 crystal structure of glycine trna ligase from mycobacterium thermoresistibile (apo) 0.9669 5 460
8u2p-assembly1.cif.gz_A-2 crystal structure of glycine--trna ligase from mycobacterium tuberculosis (g5a bound) 0.9668 5 461
8slf-assembly1.cif.gz_A crystal structure of glycine trna ligase from mycobacterium thermoresistibile (amp bound) 0.9661 5 461
8u2q-assembly1.cif.gz_A crystal structure of glycine--trna ligase active site chimera from mycobacterium thermoresistibile/tuberculosis (g5a bound) 0.9638 5 461
8slh-assembly1.cif.gz_A-2 crystal structure of glycine trna ligase from mycobacterium thermoresistibile (amp bound, hexagonal form) 0.9631 5 458
ID Description Score Start End Superfamily
af_Q57681_481_577_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9795 366 458 3.40.50.800
af_Q2FY08_370_463_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9736 367 457 3.40.50.800
af_Q54PF9_562_677_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9533 366 454 3.40.50.800
af_Q58406_325_416_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9516 366 452 3.40.50.800
af_Q8ILP6_771_886_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9483 366 458 3.40.50.800
ID Description Score Start End GO Terms
AF-A0A2W5EM24-F1-model_v4 deleted 0.9933 353 458
AF-A0A3D0RVW4-F1-model_v4 Glycine--tRNA ligase 0.9886 212 326 GO:0004820
GO:0005737
GO:0006426
AF-A0A7J4DR71-F1-model_v4 Glycine--tRNA ligase 0.9842 356 459 GO:0004820
GO:0005737
GO:0006426
AF-A0A2H0FKP9-F1-model_v4 Anticodon-binding domain-containing protein 0.9825 359 458 GO:0004820
GO:0005737
GO:0006426
AF-A0A3D4Z5R9-F1-model_v4 Glycine--tRNA ligase (EC 6.1.1.14) 0.9813 352 458 GO:0004820
GO:0005737
GO:0006426

Feature Viewer

pLDDT pTM Quality
89.44 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map