F381970

General Info

Members Datasets Scaffolds Average Seq Length
277 168 554 156

Family's Representative Sequence

Representative Sequence 3300046528|Ga0495642_0023838|Ga0495642_0023838_47_586
Length 179
Sequence MKFAHFSFGPRYRVSVTANRSIADTRNFRCIDESLLTAGQPNEEQLEDAARQGVKVVVNLALHDDPRYSLRDEAGSVRALGMQYVHIPVQFKSPTEEDLRAFFAAMDAHKGEKTLVHCAANFRVTAFIGLYRVIREGWTVEKAFEPMRSVWEPDEIWKAFIERMLAHSSGRETTGDATT

Samples

Sample ID Description Type Environment
1 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
134 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
135 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
136 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.44
Nodule 0
Rhizoplane 2.17
Rhizosphere 95.31
Stem 0
Stem Tuber 0
Unclassified 32.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495642_0023838 3300046528 Bacteria 2418
2 Ga0070676_10110616 3300005328 Bacteria 1710
3 Ga0070683_100295556 3300005329 Bacteria 1540
4 Ga0070683_101603795 3300005329 Unclassified 626
5 Ga0070690_100057822 3300005330 Bacteria 2489
6 Ga0070690_100189292 3300005330 Bacteria 1426
7 Ga0070670_100014510 3300005331 Bacteria 6763
8 Ga0070670_100060657 3300005331 Bacteria 3248
9 Ga0070670_100102079 3300005331 Bacteria 2470
10 Ga0070670_100128068 3300005331 Bacteria 2191
11 Ga0070670_100838505 3300005331 Unclassified 831
12 Ga0068869_100132989 3300005334 Bacteria 1914
13 Ga0068869_100531151 3300005334 Bacteria 986
14 Ga0070666_10129275 3300005335 Bacteria 1754
15 Ga0068868_100188018 3300005338 Unclassified 1717
16 Ga0070660_100127076 3300005339 Bacteria 2037
17 Ga0070691_10103250 3300005341 Unclassified 1418
18 Ga0070691_10145885 3300005341 Bacteria 1210
19 Ga0070661_100007784 3300005344 Bacteria 7394
20 Ga0070661_100909938 3300005344 Bacteria 726
21 Ga0070668_100109530 3300005347 Bacteria 2197
22 Ga0070669_100071288 3300005353 Bacteria 2571
23 Ga0070675_100449511 3300005354 Unclassified 1155
24 Ga0070674_100562775 3300005356 Unclassified 958
25 Ga0070673_100157304 3300005364 Bacteria 1930
26 Ga0070673_100228685 3300005364 Bacteria 1613
27 Ga0070673_100229422 3300005364 Bacteria 1610
28 Ga0070673_101639472 3300005364 Bacteria 608
29 Ga0070659_100024803 3300005366 Bacteria 4600
30 Ga0070667_100341788 3300005367 Bacteria 1354
31 Ga0070710_10920843 3300005437 Bacteria 632
32 Ga0070705_100000898 3300005440 Bacteria 16608
33 Ga0070700_100238854 3300005441 Unclassified 1297
34 Ga0070700_100527652 3300005441 Unclassified 913
35 Ga0070694_100000044 3300005444 Bacteria 58304
36 Ga0070694_100021398 3300005444 Bacteria 4131
37 Ga0070694_100340362 3300005444 Unclassified 1159
38 Ga0070708_100158909 3300005445 Bacteria 2105
39 Ga0070708_100225072 3300005445 Unclassified 1760
40 Ga0068867_100097816 3300005459 Unclassified 2237
41 Ga0070706_100004142 3300005467 Bacteria 14100
42 Ga0070706_100177079 3300005467 Bacteria 1991
43 Ga0070706_100248346 3300005467 Unclassified 1661
44 Ga0070706_101003495 3300005467 Archaea 770
45 Ga0070707_100032609 3300005468 Bacteria 4963
46 Ga0070707_100197953 3300005468 Unclassified 1959
47 Ga0070707_100740228 3300005468 Unclassified 946
48 Ga0070707_100957972 3300005468 Bacteria 821
49 Ga0070698_100004168 3300005471 Bacteria 15893
50 Ga0070698_100056428 3300005471 Bacteria 3980
51 Ga0070698_100328881 3300005471 Bacteria 1459
52 Ga0070698_100536073 3300005471 Bacteria 1109
53 Ga0070698_100842745 3300005471 Bacteria 861
54 Ga0070699_100006006 3300005518 Bacteria 10615
55 Ga0070699_100082587 3300005518 Unclassified 2801
56 Ga0070699_100144945 3300005518 Bacteria 2098
57 Ga0070699_100260961 3300005518 Bacteria 1549
58 Ga0070699_100423631 3300005518 Unclassified 1205
59 Ga0070684_100030518 3300005535 Bacteria 4580
60 Ga0070684_100414082 3300005535 Unclassified 1244
61 Ga0070697_100006292 3300005536 Bacteria 9189
62 Ga0070697_100154004 3300005536 Bacteria 1939
63 Ga0070697_100932875 3300005536 Unclassified 771
64 Ga0068853_100571748 3300005539 Bacteria 1072
65 Ga0070672_100194713 3300005543 Bacteria 1693
66 Ga0070695_100000103 3300005545 Bacteria 37184
67 Ga0070695_100034942 3300005545 Bacteria 3156
68 Ga0070695_100677969 3300005545 Unclassified 816
69 Ga0070696_100016070 3300005546 Bacteria 5034
70 Ga0070696_100029399 3300005546 Bacteria 3756
71 Ga0070693_100064397 3300005547 Bacteria 2140
72 Ga0070693_100087049 3300005547 Bacteria 1875
73 Ga0070665_100037409 3300005548 Bacteria 4881
74 Ga0070665_100252079 3300005548 Bacteria 1766
75 Ga0070665_101255892 3300005548 Viruses 751
76 Ga0070704_100004652 3300005549 Bacteria 7941
77 Ga0070704_100089578 3300005549 Bacteria 2289
78 Ga0070704_100629383 3300005549 Unclassified 945
79 Ga0068855_100506099 3300005563 Bacteria 1312
80 Ga0068855_100922129 3300005563 Bacteria 922
81 Ga0070664_100012069 3300005564 Bacteria 7020
82 Ga0068854_100181987 3300005578 Bacteria 1642
83 Ga0068854_100897340 3300005578 Bacteria 779
84 Ga0070702_100063160 3300005615 Unclassified 2161
85 Ga0068852_100477019 3300005616 Unclassified 1239
86 Ga0068852_101543854 3300005616 Unclassified 686
87 Ga0068859_102192947 3300005617 Unclassified 610
88 Ga0068864_100391451 3300005618 Unclassified 1319
89 Ga0068863_100261406 3300005841 Bacteria 1673
90 Ga0068863_100261969 3300005841 Unclassified 1672
91 Ga0068860_100052276 3300005843 Bacteria 3886
92 Ga0068860_100353735 3300005843 Unclassified 1446
93 Ga0068860_101765895 3300005843 Unclassified 640
94 Ga0068862_100029854 3300005844 Unclassified 4593
95 Ga0070716_100503746 3300006173 Bacteria 894
96 Ga0075366_10070416 3300006195 Bacteria 2083
97 Ga0097621_100081775 3300006237 Unclassified 2689
98 Ga0068871_101744711 3300006358 Bacteria 591
99 Ga0075428_100071507 3300006844 Bacteria 3791
100 Ga0075428_100387561 3300006844 Bacteria 1498
101 Ga0075428_100435691 3300006844 Bacteria 1404
102 Ga0075430_100060376 3300006846 Bacteria 3186
103 Ga0075431_100023899 3300006847 Bacteria 6256
104 Ga0075433_10097705 3300006852 Unclassified 2599
105 Ga0075433_10108064 3300006852 Unclassified 2467
106 Ga0075433_10462802 3300006852 Bacteria 1118
107 Ga0075433_11352910 3300006852 Unclassified 616
108 Ga0075434_100112865 3300006871 Unclassified 2729
109 Ga0075434_100257170 3300006871 Bacteria 1765
110 Ga0075434_100970060 3300006871 Unclassified 864
111 Ga0075429_101672878 3300006880 Unclassified 553
112 Ga0068865_100595656 3300006881 Bacteria 934
113 Ga0075436_100129919 3300006914 Bacteria 1766
114 Ga0075436_100355852 3300006914 Bacteria 1055
115 Ga0097620_102192776 3300006931 Unclassified 610
116 Ga0075435_100047927 3300007076 Bacteria 3431
117 Ga0075435_100251190 3300007076 Unclassified 1505
118 Ga0075435_100350950 3300007076 Bacteria 1264
119 Ga0075435_100443906 3300007076 Unclassified 1119
120 Ga0075435_101167899 3300007076 Unclassified 673
121 Ga0111539_10214258 3300009094 Bacteria 2244
122 Ga0111539_10303381 3300009094 Bacteria 1858
123 Ga0105245_10077555 3300009098 Bacteria 3030
124 Ga0114129_10080869 3300009147 Bacteria 4517
125 Ga0114129_10086491 3300009147 Bacteria 4348
126 Ga0105243_10085669 3300009148 Unclassified 2583
127 Ga0105241_10848816 3300009174 Bacteria 845
128 Ga0105242_10067966 3300009176 Bacteria 2947
129 Ga0105242_10083305 3300009176 Bacteria 2678
130 Ga0105242_11160611 3300009176 Bacteria 790
131 Ga0105248_10407616 3300009177 Bacteria 1531
132 Ga0105248_11114095 3300009177 Bacteria 892
133 Ga0105238_10295432 3300009551 Unclassified 1603
134 Ga0105249_10795373 3300009553 Bacteria 1010
135 Ga0157374_10464483 3300013296 Bacteria 1268
136 Ga0157378_10521413 3300013297 Unclassified 1190
137 Ga0157378_12392116 3300013297 Unclassified 580
138 Ga0157375_10702636 3300013308 Bacteria 1165
139 Ga0163163_10975826 3300014325 Unclassified 911
140 Ga0157379_10075460 3300014968 Bacteria 3019
141 Ga0157376_10004220 3300014969 Bacteria 9970
142 Ga0157376_10090270 3300014969 Bacteria 2651
143 Ga0157376_10206443 3300014969 Bacteria 1811
144 Ga0157376_10232717 3300014969 Bacteria 1712
145 Ga0163161_10927945 3300017792 Viruses 739
146 Ga0207688_10368435 3300025901 Unclassified 887
147 Ga0207680_10059098 3300025903 Bacteria 2327
148 Ga0207645_10037392 3300025907 Bacteria 3114
149 Ga0207684_10842061 3300025910 Unclassified 773
150 Ga0207654_10391490 3300025911 Unclassified 964
151 Ga0207707_10103002 3300025912 Bacteria 2495
152 Ga0207657_10618814 3300025919 Bacteria 844
153 Ga0207646_10649956 3300025922 Unclassified 945
154 Ga0207681_10494142 3300025923 Viruses 1001
155 Ga0207650_10040688 3300025925 Bacteria 3402
156 Ga0207650_10668903 3300025925 Unclassified 876
157 Ga0207687_10054602 3300025927 Bacteria 2795
158 Ga0207690_10000911 3300025932 Bacteria 18874
159 Ga0207690_10230433 3300025932 Bacteria 1422
160 Ga0207686_10063774 3300025934 Bacteria 2344
161 Ga0207669_10680854 3300025937 Unclassified 844
162 Ga0207704_10549024 3300025938 Bacteria 939
163 Ga0207665_10433636 3300025939 Unclassified 1006
164 Ga0207691_10031143 3300025940 Bacteria 4981
165 Ga0207691_10781211 3300025940 Unclassified 803
166 Ga0207711_10148279 3300025941 Bacteria 2115
167 Ga0207711_11475821 3300025941 Unclassified 623
168 Ga0207689_10035156 3300025942 Bacteria 4163
169 Ga0207689_10326832 3300025942 Bacteria 1273
170 Ga0207661_10104286 3300025944 Bacteria 2387
171 Ga0207661_10168948 3300025944 Bacteria 1903
172 Ga0207679_10001057 3300025945 Bacteria 17525
173 Ga0207679_10310446 3300025945 Bacteria 1362
174 Ga0207679_10576000 3300025945 Bacteria 1012
175 Ga0207679_10709296 3300025945 Unclassified 913
176 Ga0207667_10250393 3300025949 Bacteria 1812
177 Ga0207651_10184954 3300025960 Bacteria 1657
178 Ga0207651_10216916 3300025960 Bacteria 1544
179 Ga0207668_10040282 3300025972 Bacteria 3151
180 Ga0207668_10203759 3300025972 Viruses 1577
181 Ga0207658_10006466 3300025986 Bacteria 7997
182 Ga0207677_10164400 3300026023 Unclassified 1728
183 Ga0207641_10468751 3300026088 Bacteria 1219
184 Ga0207641_11886946 3300026088 Unclassified 599
185 Ga0207648_10082074 3300026089 Bacteria 2811
186 Ga0207648_10309102 3300026089 Bacteria 1419
187 Ga0207676_10598241 3300026095 Unclassified 1059
188 Ga0207674_10058063 3300026116 Bacteria 3922
189 Ga0207674_10577322 3300026116 Unclassified 1086
190 Ga0207675_100191542 3300026118 Bacteria 1961
191 Ga0207675_100446235 3300026118 Bacteria 1281
192 Ga0268266_10036883 3300028379 Bacteria 4165
193 Ga0268266_10105234 3300028379 Bacteria 2493
194 Ga0268266_10488215 3300028379 Unclassified 1175
195 Ga0268266_11044369 3300028379 Viruses 791
196 Ga0268264_10036673 3300028381 Bacteria 4040
197 Ga0268264_10537424 3300028381 Bacteria 1145
198 Ga0268264_10823548 3300028381 Unclassified 928
199 Ga0307515_10153299 3300028794 Bacteria 2395
200 Ga0265328_10188648 3300031239 Unclassified 781
201 Ga0265331_10011949 3300031250 Unclassified 4732
202 Ga0265327_10016860 3300031251 Bacteria 4615
203 Ga0265327_10034885 3300031251 Unclassified 2786
204 Ga0307509_10128981 3300031507 Bacteria 2488
205 Ga0307408_100789765 3300031548 Unclassified 861
206 Ga0265314_10181495 3300031711 Unclassified 1261
207 Ga0316576_10603795 3300031727 Unclassified 801
208 Ga0307409_100060151 3300031995 Bacteria 2961
209 Ga0307416_100954994 3300032002 Bacteria 959
210 Ga0307414_10362755 3300032004 Bacteria 1247
211 Ga0307411_10053101 3300032005 Bacteria 2653
212 Ga0307411_10309690 3300032005 Bacteria 1270
213 Ga0307415_100145166 3300032126 Bacteria 1818
214 Ga0307510_10096628 3300033180 Bacteria 2769
215 Ga0373943_0032052 3300035170 Bacteria 2496
216 Ga0373947_0020926 3300035725 Bacteria 3783
217 Ga0373937_0347926 3300036401 Unclassified 1404
218 Ga0316582_0213594 3300036647 Unclassified 1318
219 Ga0373925_0193372 3300037068 Bacteria 1615
220 Ga0373925_0392618 3300037068 Bacteria 1131
221 Ga0395900_0020874 3300037418 Bacteria 6693
222 Ga0395905_0069706 3300037471 Unclassified 3293
223 Ga0395905_0190576 3300037471 Bacteria 1923
224 Ga0395901_0054096 3300038443 Bacteria 4171
225 Ga0451800_1460586 3300041459 Bacteria 1417
226 Ga0451807_1333930 3300041486 Bacteria 826
227 Ga0439460_0095720 3300042461 Bacteria 948
228 Ga0450893_0006800 3300042532 Bacteria 1852
229 Ga0466966_0532082 3300044684 Unclassified 707
230 Ga0451576_0108846 3300045051 Bacteria 2883
231 Ga0495629_0314145 3300046459 Bacteria 1072
232 Ga0495663_0111117 3300046525 Unclassified 911
233 Ga0495635_0367183 3300046663 Bacteria 959
234 Ga0495659_0092330 3300046664 Unclassified 1163
235 Ga0495659_0142501 3300046664 Unclassified 957
236 Ga0495658_0279976 3300046683 Unclassified 1052
237 Ga0495613_0354746 3300046689 Bacteria 1007
238 Ga0495604_0142706 3300047317 Bacteria 1709
239 Ga0495636_0269815 3300047318 Bacteria 790
240 Ga0495680_0006971 3300047322 Bacteria 10423
241 Ga0495685_017649 3300047447 Unclassified 2445
242 Ga0496105_1319819 3300048908 Unclassified 526
243 Ga0496109_0188876 3300048912 Bacteria 1936
244 Ga0496114_0191402 3300048917 Bacteria 1790
245 Ga0496114_0543558 3300048917 Bacteria 1027
246 Ga0501081_0127307 3300049743 Bacteria 1818
247 Ga0501265_107723 3300049762 Bacteria 517
248 nmdc:mga0k408_16411_c1 3300050493 Bacteria 4109
249 nmdc:mga07m45_482557_c1 3300050496 Bacteria 718
250 nmdc:mga05p37_1997780_c1 3300050507 Unclassified 549
251 nmdc:mga05p37_407133_c1 3300050507 Unclassified 1587
252 nmdc:mga05p37_91942_c1 3300050507 Bacteria 3738
253 nmdc:mga09592_1244205_c1 3300050508 Unclassified 614
254 nmdc:mga09592_835672_c1 3300050508 Unclassified 777
255 nmdc:mga06r32_12851_c1 3300050510 Bacteria 7570
256 nmdc:mga08y16_243318_c1 3300050511 Bacteria 1859
257 nmdc:mga0n895_1298962_c1 3300050512 Bacteria 699
258 nmdc:mga0n895_248982_c1 3300050512 Bacteria 1803
259 nmdc:mga0n895_61203_c1 3300050512 Unclassified 3716
260 nmdc:mga0n895_790648_c1 3300050512 Unclassified 940
261 nmdc:mga0rr50_113636_c1 3300050513 Unclassified 2146
262 nmdc:mga0rr50_508090_c1 3300050513 Unclassified 1025
263 nmdc:mga0rr50_800661_c1 3300050513 Unclassified 804
264 nmdc:mga0rr50_89912_c1 3300050513 Bacteria 2388
265 nmdc:mga08x19_140944_c1 3300050514 Bacteria 1628
266 nmdc:mga08x19_428675_c1 3300050514 Unclassified 929
267 nmdc:mga08x19_492362_c1 3300050514 Unclassified 865
268 nmdc:mga0a205_1045348_c1 3300050515 Unclassified 664
269 nmdc:mga0a205_182720_c1 3300050515 Bacteria 1991
270 nmdc:mga0a205_186563_c1 3300050515 Unclassified 1967
271 nmdc:mga0a205_209612_c1 3300050515 Bacteria 1837
272 nmdc:mga0a205_35430_c1 3300050515 Bacteria 4793
273 Ga0495601_1006808 3300053077 Unclassified 524
274 Ga0500568_0029259 3300053139 Bacteria 2288
275 Ga0501084_0624509 3300054114 Bacteria 910
276 Ga0501082_0777902 3300060353 Bacteria 837
277 Ga0530510_0325151 3300061734 Bacteria 1153
278 Ga0495642_0023838
279 Ga0070676_10110616
280 Ga0070683_100295556
281 Ga0070683_101603795
282 Ga0070690_100057822
283 Ga0070690_100189292
284 Ga0070670_100014510
285 Ga0070670_100060657
286 Ga0070670_100102079
287 Ga0070670_100128068
288 Ga0070670_100838505
289 Ga0068869_100132989
290 Ga0068869_100531151
291 Ga0070666_10129275
292 Ga0068868_100188018
293 Ga0070660_100127076
294 Ga0070691_10103250
295 Ga0070691_10145885
296 Ga0070661_100007784
297 Ga0070661_100909938
298 Ga0070668_100109530
299 Ga0070669_100071288
300 Ga0070675_100449511
301 Ga0070674_100562775
302 Ga0070673_100157304
303 Ga0070673_100228685
304 Ga0070673_100229422
305 Ga0070673_101639472
306 Ga0070659_100024803
307 Ga0070667_100341788
308 Ga0070710_10920843
309 Ga0070705_100000898
310 Ga0070700_100238854
311 Ga0070700_100527652
312 Ga0070694_100000044
313 Ga0070694_100021398
314 Ga0070694_100340362
315 Ga0070708_100158909
316 Ga0070708_100225072
317 Ga0068867_100097816
318 Ga0070706_100004142
319 Ga0070706_100177079
320 Ga0070706_100248346
321 Ga0070706_101003495
322 Ga0070707_100032609
323 Ga0070707_100197953
324 Ga0070707_100740228
325 Ga0070707_100957972
326 Ga0070698_100004168
327 Ga0070698_100056428
328 Ga0070698_100328881
329 Ga0070698_100536073
330 Ga0070698_100842745
331 Ga0070699_100006006
332 Ga0070699_100082587
333 Ga0070699_100144945
334 Ga0070699_100260961
335 Ga0070699_100423631
336 Ga0070684_100030518
337 Ga0070684_100414082
338 Ga0070697_100006292
339 Ga0070697_100154004
340 Ga0070697_100932875
341 Ga0068853_100571748
342 Ga0070672_100194713
343 Ga0070695_100000103
344 Ga0070695_100034942
345 Ga0070695_100677969
346 Ga0070696_100016070
347 Ga0070696_100029399
348 Ga0070693_100064397
349 Ga0070693_100087049
350 Ga0070665_100037409
351 Ga0070665_100252079
352 Ga0070665_101255892
353 Ga0070704_100004652
354 Ga0070704_100089578
355 Ga0070704_100629383
356 Ga0068855_100506099
357 Ga0068855_100922129
358 Ga0070664_100012069
359 Ga0068854_100181987
360 Ga0068854_100897340
361 Ga0070702_100063160
362 Ga0068852_100477019
363 Ga0068852_101543854
364 Ga0068859_102192947
365 Ga0068864_100391451
366 Ga0068863_100261406
367 Ga0068863_100261969
368 Ga0068860_100052276
369 Ga0068860_100353735
370 Ga0068860_101765895
371 Ga0068862_100029854
372 Ga0070716_100503746
373 Ga0075366_10070416
374 Ga0097621_100081775
375 Ga0068871_101744711
376 Ga0075428_100071507
377 Ga0075428_100387561
378 Ga0075428_100435691
379 Ga0075430_100060376
380 Ga0075431_100023899
381 Ga0075433_10097705
382 Ga0075433_10108064
383 Ga0075433_10462802
384 Ga0075433_11352910
385 Ga0075434_100112865
386 Ga0075434_100257170
387 Ga0075434_100970060
388 Ga0075429_101672878
389 Ga0068865_100595656
390 Ga0075436_100129919
391 Ga0075436_100355852
392 Ga0097620_102192776
393 Ga0075435_100047927
394 Ga0075435_100251190
395 Ga0075435_100350950
396 Ga0075435_100443906
397 Ga0075435_101167899
398 Ga0111539_10214258
399 Ga0111539_10303381
400 Ga0105245_10077555
401 Ga0114129_10080869
402 Ga0114129_10086491
403 Ga0105243_10085669
404 Ga0105241_10848816
405 Ga0105242_10067966
406 Ga0105242_10083305
407 Ga0105242_11160611
408 Ga0105248_10407616
409 Ga0105248_11114095
410 Ga0105238_10295432
411 Ga0105249_10795373
412 Ga0157374_10464483
413 Ga0157378_10521413
414 Ga0157378_12392116
415 Ga0157375_10702636
416 Ga0163163_10975826
417 Ga0157379_10075460
418 Ga0157376_10004220
419 Ga0157376_10090270
420 Ga0157376_10206443
421 Ga0157376_10232717
422 Ga0163161_10927945
423 Ga0207688_10368435
424 Ga0207680_10059098
425 Ga0207645_10037392
426 Ga0207684_10842061
427 Ga0207654_10391490
428 Ga0207707_10103002
429 Ga0207657_10618814
430 Ga0207646_10649956
431 Ga0207681_10494142
432 Ga0207650_10040688
433 Ga0207650_10668903
434 Ga0207687_10054602
435 Ga0207690_10000911
436 Ga0207690_10230433
437 Ga0207686_10063774
438 Ga0207669_10680854
439 Ga0207704_10549024
440 Ga0207665_10433636
441 Ga0207691_10031143
442 Ga0207691_10781211
443 Ga0207711_10148279
444 Ga0207711_11475821
445 Ga0207689_10035156
446 Ga0207689_10326832
447 Ga0207661_10104286
448 Ga0207661_10168948
449 Ga0207679_10001057
450 Ga0207679_10310446
451 Ga0207679_10576000
452 Ga0207679_10709296
453 Ga0207667_10250393
454 Ga0207651_10184954
455 Ga0207651_10216916
456 Ga0207668_10040282
457 Ga0207668_10203759
458 Ga0207658_10006466
459 Ga0207677_10164400
460 Ga0207641_10468751
461 Ga0207641_11886946
462 Ga0207648_10082074
463 Ga0207648_10309102
464 Ga0207676_10598241
465 Ga0207674_10058063
466 Ga0207674_10577322
467 Ga0207675_100191542
468 Ga0207675_100446235
469 Ga0268266_10036883
470 Ga0268266_10105234
471 Ga0268266_10488215
472 Ga0268266_11044369
473 Ga0268264_10036673
474 Ga0268264_10537424
475 Ga0268264_10823548
476 Ga0307515_10153299
477 Ga0265328_10188648
478 Ga0265331_10011949
479 Ga0265327_10016860
480 Ga0265327_10034885
481 Ga0307509_10128981
482 Ga0307408_100789765
483 Ga0265314_10181495
484 Ga0316576_10603795
485 Ga0307409_100060151
486 Ga0307416_100954994
487 Ga0307414_10362755
488 Ga0307411_10053101
489 Ga0307411_10309690
490 Ga0307415_100145166
491 Ga0307510_10096628
492 Ga0373943_0032052
493 Ga0373947_0020926
494 Ga0373937_0347926
495 Ga0316582_0213594
496 Ga0373925_0193372
497 Ga0373925_0392618
498 Ga0395900_0020874
499 Ga0395905_0069706
500 Ga0395905_0190576
501 Ga0395901_0054096
502 Ga0451800_1460586
503 Ga0451807_1333930
504 Ga0439460_0095720
505 Ga0450893_0006800
506 Ga0466966_0532082
507 Ga0451576_0108846
508 Ga0495629_0314145
509 Ga0495663_0111117
510 Ga0495635_0367183
511 Ga0495659_0092330
512 Ga0495659_0142501
513 Ga0495658_0279976
514 Ga0495613_0354746
515 Ga0495604_0142706
516 Ga0495636_0269815
517 Ga0495680_0006971
518 Ga0495685_017649
519 Ga0496105_1319819
520 Ga0496109_0188876
521 Ga0496114_0191402
522 Ga0496114_0543558
523 Ga0501081_0127307
524 Ga0501265_107723
525 nmdc:mga0k408_16411_c1
526 nmdc:mga07m45_482557_c1
527 nmdc:mga05p37_1997780_c1
528 nmdc:mga05p37_407133_c1
529 nmdc:mga05p37_91942_c1
530 nmdc:mga09592_1244205_c1
531 nmdc:mga09592_835672_c1
532 nmdc:mga06r32_12851_c1
533 nmdc:mga08y16_243318_c1
534 nmdc:mga0n895_1298962_c1
535 nmdc:mga0n895_248982_c1
536 nmdc:mga0n895_61203_c1
537 nmdc:mga0n895_790648_c1
538 nmdc:mga0rr50_113636_c1
539 nmdc:mga0rr50_508090_c1
540 nmdc:mga0rr50_800661_c1
541 nmdc:mga0rr50_89912_c1
542 nmdc:mga08x19_140944_c1
543 nmdc:mga08x19_428675_c1
544 nmdc:mga08x19_492362_c1
545 nmdc:mga0a205_1045348_c1
546 nmdc:mga0a205_182720_c1
547 nmdc:mga0a205_186563_c1
548 nmdc:mga0a205_209612_c1
549 nmdc:mga0a205_35430_c1
550 Ga0495601_1006808
551 Ga0500568_0029259
552 Ga0501084_0624509
553 Ga0501082_0777902
554 Ga0530510_0325151

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04273

BLH_phosphatase

Beta-lactamase hydrolase-like protein, phosphatase-like domain

27

133

0.86

PF22741

PTP-NADK

DSP-PTPase phosphatase fused to NAD+ Kinase

12

162

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gxh-assembly3.cif.gz_B crystal structure of putative phosphatase (duf442) (yp_001181608.1) from shewanella putrefaciens cn-32 at 1.40 a resolution 0.8915 5 151
3gxg-assembly1.cif.gz_A crystal structure of putative phosphatase (duf442) (yp_001181608.1) from shewanella putrefaciens cn-32 at 1.60 a resolution 0.8544 5 150
3gxh-assembly3.cif.gz_B crystal structure of putative phosphatase (duf442) (yp_001181608.1) from shewanella putrefaciens cn-32 at 1.40 a resolution 0.8526 5 151
2i6o-assembly1.cif.gz_A crystal structure of the complex of the archaeal sulfolobus ptp-fold phosphatase with phosphopeptides n-g-(p)y-k-n 0.8467 20 152
1fpz-assembly3.cif.gz_C crystal structure analysis of kinase associated phosphatase (kap) with a substitution of the catalytic site cysteine (cys140) to a serine 0.8439 18 155
ID Description Score Start End Superfamily
3gxhB00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8986 5 151 3.90.190.10
3gxhB00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8583 5 151 3.90.190.10
2dxpA00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8572 17 152 3.90.190.10
af_Q7XC53_86_235_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8478 11 151 3.90.190.10
1fpzC00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8439 18 155 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A317GX43-F1-model_v4 DSP-PTPase phosphatase fused to NAD+ Kinase domain-containing protein 0.993 1 152 GO:0004518
AF-A0A536T458-F1-model_v4 Phosphatase 0.9893 61 154
AF-A0A1Z4C2G6-F1-model_v4 Beta-lactamase hydrolase-like protein phosphatase-like domain-containing protein 0.9889 5 149 GO:0016787
AF-A0A4R3Y0C0-F1-model_v4 Putative phosphatase DUF442 0.9887 7 114
AF-A0A3E0MUX5-F1-model_v4 Phosphatase 0.9869 3 145

Map