F381932

General Info

Members Datasets Scaffolds Average Seq Length
277 187 554 137

Family's Representative Sequence

Representative Sequence 3300042015|Ga0439462_0190060|Ga0439462_0190060_46_516
Length 156
Sequence MSTTVTTNHQPPTRKARRDVWALLFTTAFFVCAARTLPAHHAFAAEFDAKKPVKLRGVVSMVEWINPHAWIHIEVKLPDGKVENWMIEGGTPNTLFRRGVNKNSLPVGTEIIVDGYQAKDGTLKANGRDITFPDGRKLFIGSTGTGAPGDPQPPQK

Samples

Sample ID Description Type Environment
1 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
155 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.78
Metatranscriptomes 7.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 1.44
Rhizosphere 95.67
Stem 0
Stem Tuber 0
Unclassified 26.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439462_0190060 3300042015 Bacteria 583
2 JGI25406J46586_10003770 3300003203 Bacteria 7084
3 Ga0007410J51695_1022604 3300003574 Unclassified 518
4 Ga0058859_11768361 3300004798 Bacteria 830
5 Ga0058859_11815928 3300004798 Bacteria 523
6 Ga0058863_11621898 3300004799 Unclassified 1071
7 Ga0058861_11875922 3300004800 Bacteria 685
8 Ga0058860_12241587 3300004801 Unclassified 501
9 Ga0058860_12244864 3300004801 Bacteria 657
10 Ga0058862_12171266 3300004803 Unclassified 742
11 Ga0058862_12437306 3300004803 Bacteria 547
12 Ga0070676_10057857 3300005328 Bacteria 2295
13 Ga0070683_100391500 3300005329 Unclassified 1325
14 Ga0070690_100012706 3300005330 Bacteria 4959
15 Ga0070670_100013499 3300005331 Bacteria 6998
16 Ga0070670_100330254 3300005331 Bacteria 1337
17 Ga0070677_10001083 3300005333 Bacteria 8780
18 Ga0070677_10006016 3300005333 Bacteria 4024
19 Ga0068869_100009267 3300005334 Bacteria 6382
20 Ga0068869_100136177 3300005334 Bacteria 1892
21 Ga0070666_10305871 3300005335 Bacteria 1133
22 Ga0070666_11289935 3300005335 Bacteria 545
23 Ga0068868_100595992 3300005338 Unclassified 978
24 Ga0070689_100881668 3300005340 Bacteria 791
25 Ga0070691_10319328 3300005341 Viruses 854
26 Ga0070687_100435203 3300005343 Bacteria 869
27 Ga0070669_100054871 3300005353 Bacteria 2919
28 Ga0070669_100880287 3300005353 Bacteria 764
29 Ga0070675_100005324 3300005354 Bacteria 9832
30 Ga0070675_100090033 3300005354 Unclassified 2570
31 Ga0070675_100151105 3300005354 Unclassified 1991
32 Ga0070675_100593278 3300005354 Bacteria 1004
33 Ga0070671_100014010 3300005355 Bacteria 6475
34 Ga0070674_100041644 3300005356 Bacteria 3114
35 Ga0070674_101237038 3300005356 Bacteria 664
36 Ga0070673_100070948 3300005364 Bacteria 2797
37 Ga0070673_100249464 3300005364 Bacteria 1546
38 Ga0070673_101886377 3300005364 Unclassified 567
39 Ga0070688_100550966 3300005365 Unclassified 877
40 Ga0070667_101009254 3300005367 Bacteria 777
41 Ga0070701_10201025 3300005438 Bacteria 1178
42 Ga0070701_10451025 3300005438 Bacteria 825
43 Ga0070700_100088779 3300005441 Bacteria 2012
44 Ga0070694_100160136 3300005444 Bacteria 1651
45 Ga0070678_100023365 3300005456 Bacteria 4118
46 Ga0070678_100063412 3300005456 Bacteria 2734
47 Ga0070678_101273392 3300005456 Unclassified 683
48 Ga0070662_101106673 3300005457 Unclassified 680
49 Ga0068867_100260314 3300005459 Bacteria 1414
50 Ga0068867_100310432 3300005459 Unclassified 1303
51 Ga0068867_102000442 3300005459 Unclassified 548
52 Ga0070685_10102780 3300005466 Bacteria 1748
53 Ga0070698_100091884 3300005471 Unclassified 3017
54 Ga0070699_100012686 3300005518 Bacteria 7267
55 Ga0070672_100030175 3300005543 Bacteria 4071
56 Ga0070672_100059646 3300005543 Bacteria 3002
57 Ga0070672_100387971 3300005543 Bacteria 1195
58 Ga0070686_100119740 3300005544 Bacteria 1806
59 Ga0070686_100295743 3300005544 Bacteria 1199
60 Ga0070696_100574354 3300005546 Unclassified 906
61 Ga0070704_100982728 3300005549 Viruses 763
62 Ga0070664_100007118 3300005564 Bacteria 9024
63 Ga0070664_100534113 3300005564 Bacteria 1083
64 Ga0070664_101102105 3300005564 Bacteria 748
65 Ga0068854_100691640 3300005578 Unclassified 879
66 Ga0068859_100776251 3300005617 Bacteria 1047
67 Ga0068864_100206844 3300005618 Bacteria 1805
68 Ga0068864_101609439 3300005618 Viruses 654
69 Ga0068864_101716662 3300005618 Unclassified 633
70 Ga0068866_10068776 3300005718 Bacteria 1863
71 Ga0068861_100127334 3300005719 Bacteria 2062
72 Ga0068861_100140988 3300005719 Bacteria 1967
73 Ga0068870_10387118 3300005840 Viruses 906
74 Ga0068858_101210374 3300005842 Bacteria 743
75 Ga0068858_101252134 3300005842 Bacteria 730
76 Ga0068860_100071024 3300005843 Bacteria 3309
77 Ga0068860_100201016 3300005843 Bacteria 1931
78 Ga0068862_100390100 3300005844 Bacteria 1300
79 Ga0081539_10000280 3300005985 Bacteria 115290
80 Ga0075367_10206769 3300006178 Unclassified 1227
81 Ga0068871_100535877 3300006358 Unclassified 1059
82 Ga0075428_100000008 3300006844 Bacteria 271300
83 Ga0075430_101041506 3300006846 Unclassified 674
84 Ga0075431_100264160 3300006847 Unclassified 1746
85 Ga0075431_100387428 3300006847 Unclassified 1401
86 Ga0075433_10200438 3300006852 Bacteria 1774
87 Ga0075433_10202720 3300006852 Bacteria 1764
88 Ga0075434_100042196 3300006871 Bacteria 4522
89 Ga0075434_100905516 3300006871 Unclassified 897
90 Ga0075429_100199925 3300006880 Unclassified 1751
91 Ga0075429_100430587 3300006880 Bacteria 1156
92 Ga0068865_100022919 3300006881 Bacteria 4081
93 Ga0068865_101333812 3300006881 Unclassified 639
94 Ga0075436_100352038 3300006914 Bacteria 1061
95 Ga0097620_100776197 3300006931 Bacteria 1047
96 Ga0075435_100099781 3300007076 Bacteria 2405
97 Ga0075435_100454477 3300007076 Bacteria 1105
98 Ga0111539_10000020 3300009094 Bacteria 265282
99 Ga0111539_10014178 3300009094 Bacteria 9953
100 Ga0111539_10123874 3300009094 Bacteria 3030
101 Ga0105245_10345314 3300009098 Viruses 1473
102 Ga0105245_10421262 3300009098 Bacteria 1338
103 Ga0114129_10187756 3300009147 Bacteria 2808
104 Ga0114129_10806597 3300009147 Bacteria 1197
105 Ga0114129_12229760 3300009147 Bacteria 658
106 Ga0105243_10103662 3300009148 Bacteria 2366
107 Ga0105242_10052446 3300009176 Bacteria 3328
108 Ga0105242_10521579 3300009176 Bacteria 1134
109 Ga0105248_10065209 3300009177 Bacteria 4089
110 Ga0105248_10082795 3300009177 Unclassified 3609
111 Ga0105248_10088073 3300009177 Bacteria 3494
112 Ga0105248_10275578 3300009177 Bacteria 1894
113 Ga0105248_10327180 3300009177 Unclassified 1726
114 Ga0105248_10761476 3300009177 Bacteria 1093
115 Ga0105249_10999411 3300009553 Unclassified 905
116 Ga0105249_11974862 3300009553 Unclassified 656
117 Ga0105239_10165546 3300010375 Bacteria 2472
118 Ga0157325_1026774 3300012485 Viruses 553
119 Ga0157369_10588253 3300013105 Bacteria 1149
120 Ga0157378_10312688 3300013297 Bacteria 1524
121 Ga0157378_11845108 3300013297 Bacteria 653
122 Ga0157375_11676997 3300013308 Unclassified 752
123 Ga0163163_10049967 3300014325 Bacteria 4117
124 Ga0163163_10152018 3300014325 Bacteria 2358
125 Ga0157380_10126787 3300014326 Unclassified 2170
126 Ga0157380_11901562 3300014326 Unclassified 656
127 Ga0157379_10101709 3300014968 Bacteria 2579
128 Ga0157376_10659869 3300014969 Unclassified 1047
129 Ga0206356_10578362 3300020070 Bacteria 571
130 Ga0207682_10007775 3300025893 Bacteria 4261
131 Ga0207682_10030557 3300025893 Bacteria 2158
132 Ga0207682_10281799 3300025893 Bacteria 777
133 Ga0207642_10069851 3300025899 Bacteria 1667
134 Ga0207688_10142558 3300025901 Bacteria 1411
135 Ga0207688_10218192 3300025901 Bacteria 1148
136 Ga0207688_10274658 3300025901 Bacteria 1026
137 Ga0207680_10603568 3300025903 Unclassified 785
138 Ga0207680_10682041 3300025903 Unclassified 736
139 Ga0207699_10846715 3300025906 Unclassified 673
140 Ga0207645_10007155 3300025907 Bacteria 7914
141 Ga0207643_10039421 3300025908 Bacteria 2658
142 Ga0207643_10063069 3300025908 Bacteria 2118
143 Ga0207662_10474030 3300025918 Bacteria 859
144 Ga0207649_11512552 3300025920 Viruses 531
145 Ga0207646_10830762 3300025922 Bacteria 822
146 Ga0207681_10072211 3300025923 Unclassified 2410
147 Ga0207681_10089704 3300025923 Bacteria 2192
148 Ga0207650_10006100 3300025925 Bacteria 8214
149 Ga0207659_10305968 3300025926 Bacteria 1307
150 Ga0207659_10831341 3300025926 Unclassified 794
151 Ga0207687_10374229 3300025927 Bacteria 1165
152 Ga0207644_10003844 3300025931 Bacteria 9732
153 Ga0207686_10035519 3300025934 Bacteria 2993
154 Ga0207686_10340882 3300025934 Bacteria 1126
155 Ga0207709_10017702 3300025935 Bacteria 3981
156 Ga0207670_10051089 3300025936 Bacteria 2774
157 Ga0207670_10478004 3300025936 Bacteria 1009
158 Ga0207669_10032718 3300025937 Bacteria 2924
159 Ga0207704_10068738 3300025938 Bacteria 2234
160 Ga0207691_10043466 3300025940 Bacteria 4141
161 Ga0207691_10078459 3300025940 Bacteria 2973
162 Ga0207711_10177964 3300025941 Unclassified 1933
163 Ga0207711_10524727 3300025941 Bacteria 1104
164 Ga0207689_10012932 3300025942 Bacteria 7125
165 Ga0207689_10163629 3300025942 Bacteria 1833
166 Ga0207661_10671805 3300025944 Bacteria 952
167 Ga0207661_11102002 3300025944 Bacteria 731
168 Ga0207679_10068819 3300025945 Bacteria 2661
169 Ga0207679_10342053 3300025945 Bacteria 1301
170 Ga0207679_11038670 3300025945 Bacteria 751
171 Ga0207679_11054802 3300025945 Unclassified 745
172 Ga0207651_10010715 3300025960 Bacteria 5093
173 Ga0207651_10618735 3300025960 Bacteria 948
174 Ga0207640_10070726 3300025981 Bacteria 2348
175 Ga0207658_11279895 3300025986 Viruses 670
176 Ga0207677_10234889 3300026023 Bacteria 1479
177 Ga0207639_11264598 3300026041 Viruses 693
178 Ga0207708_10047638 3300026075 Bacteria 3262
179 Ga0207641_10459683 3300026088 Bacteria 1231
180 Ga0207641_10572878 3300026088 Bacteria 1103
181 Ga0207648_10006187 3300026089 Bacteria 11923
182 Ga0207648_10235615 3300026089 Bacteria 1629
183 Ga0207648_10806726 3300026089 Bacteria 874
184 Ga0207648_11208196 3300026089 Bacteria 710
185 Ga0207676_10088299 3300026095 Bacteria 2538
186 Ga0207676_10357425 3300026095 Bacteria 1353
187 Ga0207676_11979394 3300026095 Unclassified 581
188 Ga0207674_10101188 3300026116 Bacteria 2863
189 Ga0207675_100922792 3300026118 Unclassified 890
190 Ga0207698_10274444 3300026142 Bacteria 1556
191 Ga0209966_1114289 3300027695 Unclassified 616
192 Ga0209998_10070009 3300027717 Unclassified 837
193 Ga0209974_10025877 3300027876 Bacteria 1942
194 Ga0207428_10000051 3300027907 Bacteria 176522
195 Ga0207428_10009495 3300027907 Bacteria 8714
196 Ga0268265_10270723 3300028380 Bacteria 1515
197 Ga0268265_12137337 3300028380 Unclassified 567
198 Ga0268265_12292973 3300028380 Unclassified 547
199 Ga0268264_10294574 3300028381 Bacteria 1525
200 Ga0265338_11186071 3300028800 Unclassified 512
201 Ga0265777_110142 3300030877 Bacteria 687
202 Ga0265764_115449 3300030882 Unclassified 523
203 Ga0265325_10170024 3300031241 Unclassified 1020
204 Ga0265331_10038562 3300031250 Bacteria 2335
205 Ga0265331_10144136 3300031250 Bacteria 1082
206 Ga0307408_100159495 3300031548 Unclassified 1790
207 Ga0265314_10022469 3300031711 Bacteria 4831
208 Ga0265342_10013118 3300031712 Bacteria 5575
209 Ga0307413_11293466 3300031824 Unclassified 638
210 Ga0307407_11041259 3300031903 Bacteria 634
211 Ga0307416_100100575 3300032002 Bacteria 2515
212 Ga0316053_111806 3300032120 Bacteria 620
213 Ga0373957_0231372 3300035120 Bacteria 775
214 Ga0373943_0024847 3300035170 Bacteria 2797
215 Ga0373946_0114959 3300035171 Bacteria 1222
216 Ga0373924_0234842 3300035410 Bacteria 811
217 Ga0373935_0530694 3300035692 Unclassified 857
218 Ga0373947_0004586 3300035725 Bacteria 8108
219 Ga0373937_0944643 3300036401 Unclassified 811
220 Ga0373937_1225205 3300036401 Unclassified 699
221 Ga0265778_025080 3300036457 Bacteria 751
222 Ga0373925_0016876 3300037068 Bacteria 5287
223 Ga0373925_0104920 3300037068 Bacteria 2177
224 Ga0451802_0168998 3300041460 Bacteria 745
225 Ga0451802_0854758 3300041460 Bacteria 652
226 Ga0451853_0601829 3300041512 Unclassified 708
227 Ga0451853_1783693 3300041512 Bacteria 1086
228 Ga0450895_025054 3300042132 Unclassified 567
229 Ga0495629_0531414 3300046459 Bacteria 791
230 Ga0495580_0029452 3300046472 Bacteria 3985
231 Ga0495580_0302955 3300046472 Bacteria 1088
232 Ga0495582_0578475 3300046473 Unclassified 650
233 Ga0495663_0239116 3300046525 Bacteria 642
234 Ga0495668_0442434 3300046616 Viruses 715
235 Ga0495635_0687763 3300046663 Unclassified 664
236 Ga0495658_0026034 3300046683 Unclassified 3131
237 Ga0495589_0598576 3300046794 Unclassified 502
238 Ga0495636_0016511 3300047318 Unclassified 2950
239 Ga0495684_0820056 3300047471 Unclassified 606
240 Ga0496108_0946129 3300048911 Unclassified 738
241 Ga0496114_0657977 3300048917 Bacteria 921
242 Ga0501315_049300 3300049531 Bacteria 658
243 Ga0501037_0890697 3300049573 Unclassified 584
244 Ga0501040_0095757 3300049576 Bacteria 2066
245 Ga0501041_0523015 3300049577 Bacteria 755
246 Ga0501042_0194614 3300049578 Bacteria 1462
247 Ga0501042_0879650 3300049578 Bacteria 652
248 Ga0501072_0055295 3300049588 Bacteria 3128
249 Ga0501074_0270336 3300049590 Bacteria 1208
250 Ga0501075_0009651 3300049591 Bacteria 6760
251 Ga0501075_0077672 3300049591 Bacteria 2512
252 Ga0501076_0158256 3300049592 Bacteria 1844
253 Ga0501079_0175481 3300049741 Bacteria 1671
254 Ga0501080_0141540 3300049742 Bacteria 2224
255 Ga0501045_0085265 3300049824 Bacteria 2331
256 nmdc:mga06z11_201558_c1 3300050494 Unclassified 1156
257 nmdc:mga05p37_524599_c1 3300050507 Bacteria 1354
258 nmdc:mga05p37_7857_c1 3300050507 Bacteria 12591
259 nmdc:mga09592_456243_c1 3300050508 Unclassified 1102
260 nmdc:mga08y16_11206_c1 3300050511 Bacteria 9417
261 nmdc:mga08y16_13207_c1 3300050511 Bacteria 8686
262 nmdc:mga08y16_8_c1 3300050511 Bacteria 571177
263 nmdc:mga0n895_172536_c1 3300050512 Bacteria 2194
264 nmdc:mga0n895_707046_c1 3300050512 Unclassified 1003
265 nmdc:mga0rr50_140262_c1 3300050513 Bacteria 1944
266 nmdc:mga08x19_341798_c1 3300050514 Bacteria 1044
267 nmdc:mga0a205_344302_c1 3300050515 Bacteria 1359
268 nmdc:mga0a205_788445_c1 3300050515 Unclassified 798
269 Ga0495612_0036839 3300053078 Unclassified 1986
270 Ga0495619_0677541 3300053085 Bacteria 702
271 Ga0587073_0255022 3300059492 Unclassified 552
272 Ga0587080_102052 3300059503 Unclassified 615
273 Ga0587083_0287320 3300059505 Bacteria 503
274 Ga0587086_100082 3300059507 Bacteria 533
275 Ga0587111_0164442 3300060346 Unclassified 606
276 Ga0501082_0048670 3300060353 Bacteria 3654
277 Ga0530510_0250785 3300061734 Bacteria 1319
278 Ga0439462_0190060
279 JGI25406J46586_10003770
280 Ga0007410J51695_1022604
281 Ga0058859_11768361
282 Ga0058859_11815928
283 Ga0058863_11621898
284 Ga0058861_11875922
285 Ga0058860_12241587
286 Ga0058860_12244864
287 Ga0058862_12171266
288 Ga0058862_12437306
289 Ga0070676_10057857
290 Ga0070683_100391500
291 Ga0070690_100012706
292 Ga0070670_100013499
293 Ga0070670_100330254
294 Ga0070677_10001083
295 Ga0070677_10006016
296 Ga0068869_100009267
297 Ga0068869_100136177
298 Ga0070666_10305871
299 Ga0070666_11289935
300 Ga0068868_100595992
301 Ga0070689_100881668
302 Ga0070691_10319328
303 Ga0070687_100435203
304 Ga0070669_100054871
305 Ga0070669_100880287
306 Ga0070675_100005324
307 Ga0070675_100090033
308 Ga0070675_100151105
309 Ga0070675_100593278
310 Ga0070671_100014010
311 Ga0070674_100041644
312 Ga0070674_101237038
313 Ga0070673_100070948
314 Ga0070673_100249464
315 Ga0070673_101886377
316 Ga0070688_100550966
317 Ga0070667_101009254
318 Ga0070701_10201025
319 Ga0070701_10451025
320 Ga0070700_100088779
321 Ga0070694_100160136
322 Ga0070678_100023365
323 Ga0070678_100063412
324 Ga0070678_101273392
325 Ga0070662_101106673
326 Ga0068867_100260314
327 Ga0068867_100310432
328 Ga0068867_102000442
329 Ga0070685_10102780
330 Ga0070698_100091884
331 Ga0070699_100012686
332 Ga0070672_100030175
333 Ga0070672_100059646
334 Ga0070672_100387971
335 Ga0070686_100119740
336 Ga0070686_100295743
337 Ga0070696_100574354
338 Ga0070704_100982728
339 Ga0070664_100007118
340 Ga0070664_100534113
341 Ga0070664_101102105
342 Ga0068854_100691640
343 Ga0068859_100776251
344 Ga0068864_100206844
345 Ga0068864_101609439
346 Ga0068864_101716662
347 Ga0068866_10068776
348 Ga0068861_100127334
349 Ga0068861_100140988
350 Ga0068870_10387118
351 Ga0068858_101210374
352 Ga0068858_101252134
353 Ga0068860_100071024
354 Ga0068860_100201016
355 Ga0068862_100390100
356 Ga0081539_10000280
357 Ga0075367_10206769
358 Ga0068871_100535877
359 Ga0075428_100000008
360 Ga0075430_101041506
361 Ga0075431_100264160
362 Ga0075431_100387428
363 Ga0075433_10200438
364 Ga0075433_10202720
365 Ga0075434_100042196
366 Ga0075434_100905516
367 Ga0075429_100199925
368 Ga0075429_100430587
369 Ga0068865_100022919
370 Ga0068865_101333812
371 Ga0075436_100352038
372 Ga0097620_100776197
373 Ga0075435_100099781
374 Ga0075435_100454477
375 Ga0111539_10000020
376 Ga0111539_10014178
377 Ga0111539_10123874
378 Ga0105245_10345314
379 Ga0105245_10421262
380 Ga0114129_10187756
381 Ga0114129_10806597
382 Ga0114129_12229760
383 Ga0105243_10103662
384 Ga0105242_10052446
385 Ga0105242_10521579
386 Ga0105248_10065209
387 Ga0105248_10082795
388 Ga0105248_10088073
389 Ga0105248_10275578
390 Ga0105248_10327180
391 Ga0105248_10761476
392 Ga0105249_10999411
393 Ga0105249_11974862
394 Ga0105239_10165546
395 Ga0157325_1026774
396 Ga0157369_10588253
397 Ga0157378_10312688
398 Ga0157378_11845108
399 Ga0157375_11676997
400 Ga0163163_10049967
401 Ga0163163_10152018
402 Ga0157380_10126787
403 Ga0157380_11901562
404 Ga0157379_10101709
405 Ga0157376_10659869
406 Ga0206356_10578362
407 Ga0207682_10007775
408 Ga0207682_10030557
409 Ga0207682_10281799
410 Ga0207642_10069851
411 Ga0207688_10142558
412 Ga0207688_10218192
413 Ga0207688_10274658
414 Ga0207680_10603568
415 Ga0207680_10682041
416 Ga0207699_10846715
417 Ga0207645_10007155
418 Ga0207643_10039421
419 Ga0207643_10063069
420 Ga0207662_10474030
421 Ga0207649_11512552
422 Ga0207646_10830762
423 Ga0207681_10072211
424 Ga0207681_10089704
425 Ga0207650_10006100
426 Ga0207659_10305968
427 Ga0207659_10831341
428 Ga0207687_10374229
429 Ga0207644_10003844
430 Ga0207686_10035519
431 Ga0207686_10340882
432 Ga0207709_10017702
433 Ga0207670_10051089
434 Ga0207670_10478004
435 Ga0207669_10032718
436 Ga0207704_10068738
437 Ga0207691_10043466
438 Ga0207691_10078459
439 Ga0207711_10177964
440 Ga0207711_10524727
441 Ga0207689_10012932
442 Ga0207689_10163629
443 Ga0207661_10671805
444 Ga0207661_11102002
445 Ga0207679_10068819
446 Ga0207679_10342053
447 Ga0207679_11038670
448 Ga0207679_11054802
449 Ga0207651_10010715
450 Ga0207651_10618735
451 Ga0207640_10070726
452 Ga0207658_11279895
453 Ga0207677_10234889
454 Ga0207639_11264598
455 Ga0207708_10047638
456 Ga0207641_10459683
457 Ga0207641_10572878
458 Ga0207648_10006187
459 Ga0207648_10235615
460 Ga0207648_10806726
461 Ga0207648_11208196
462 Ga0207676_10088299
463 Ga0207676_10357425
464 Ga0207676_11979394
465 Ga0207674_10101188
466 Ga0207675_100922792
467 Ga0207698_10274444
468 Ga0209966_1114289
469 Ga0209998_10070009
470 Ga0209974_10025877
471 Ga0207428_10000051
472 Ga0207428_10009495
473 Ga0268265_10270723
474 Ga0268265_12137337
475 Ga0268265_12292973
476 Ga0268264_10294574
477 Ga0265338_11186071
478 Ga0265777_110142
479 Ga0265764_115449
480 Ga0265325_10170024
481 Ga0265331_10038562
482 Ga0265331_10144136
483 Ga0307408_100159495
484 Ga0265314_10022469
485 Ga0265342_10013118
486 Ga0307413_11293466
487 Ga0307407_11041259
488 Ga0307416_100100575
489 Ga0316053_111806
490 Ga0373957_0231372
491 Ga0373943_0024847
492 Ga0373946_0114959
493 Ga0373924_0234842
494 Ga0373935_0530694
495 Ga0373947_0004586
496 Ga0373937_0944643
497 Ga0373937_1225205
498 Ga0265778_025080
499 Ga0373925_0016876
500 Ga0373925_0104920
501 Ga0451802_0168998
502 Ga0451802_0854758
503 Ga0451853_0601829
504 Ga0451853_1783693
505 Ga0450895_025054
506 Ga0495629_0531414
507 Ga0495580_0029452
508 Ga0495580_0302955
509 Ga0495582_0578475
510 Ga0495663_0239116
511 Ga0495668_0442434
512 Ga0495635_0687763
513 Ga0495658_0026034
514 Ga0495589_0598576
515 Ga0495636_0016511
516 Ga0495684_0820056
517 Ga0496108_0946129
518 Ga0496114_0657977
519 Ga0501315_049300
520 Ga0501037_0890697
521 Ga0501040_0095757
522 Ga0501041_0523015
523 Ga0501042_0194614
524 Ga0501042_0879650
525 Ga0501072_0055295
526 Ga0501074_0270336
527 Ga0501075_0009651
528 Ga0501075_0077672
529 Ga0501076_0158256
530 Ga0501079_0175481
531 Ga0501080_0141540
532 Ga0501045_0085265
533 nmdc:mga06z11_201558_c1
534 nmdc:mga05p37_524599_c1
535 nmdc:mga05p37_7857_c1
536 nmdc:mga09592_456243_c1
537 nmdc:mga08y16_11206_c1
538 nmdc:mga08y16_13207_c1
539 nmdc:mga08y16_8_c1
540 nmdc:mga0n895_172536_c1
541 nmdc:mga0n895_707046_c1
542 nmdc:mga0rr50_140262_c1
543 nmdc:mga08x19_341798_c1
544 nmdc:mga0a205_344302_c1
545 nmdc:mga0a205_788445_c1
546 Ga0495612_0036839
547 Ga0495619_0677541
548 Ga0587073_0255022
549 Ga0587080_102052
550 Ga0587083_0287320
551 Ga0587086_100082
552 Ga0587111_0164442
553 Ga0501082_0048670
554 Ga0530510_0250785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

28

127

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c4k-assembly1.cif.gz_A ancestral l-amino acid oxidase (anclaao-n5) ligand free form 0.8525 45 74
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7937 41 74
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7913 41 74
8d0k-assembly1.cif.gz_F human cst-dna polymerase alpha/primase preinitiation complex bound to 4xtel-foldback template - prim2c advanced pic 0.7726 40 74
1p15-assembly2.cif.gz_B crystal structure of the d2 domain of rptpa 0.7644 43 74
ID Description Score Start End Superfamily
af_B2RYE5_272_368_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8508 44 72 2.30.29.30
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8298 39 77 2.40.50.140
af_A0A1D8PQ00_161_443_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8258 44 76 2.130.10.10
af_Q8VIG0_99_222_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.7978 42 74 3.30.1520.10
af_Q3E8Y7_122_291_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7959 44 74 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A832QAW7-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.9606 20 127
AF-A0A383CUF3-F1-model_v4 OB domain-containing protein 0.9588 33 126
AF-A0A1Q7LF84-F1-model_v4 Uncharacterized protein 0.9542 25 140
AF-A0A6L8BFJ3-F1-model_v4 Uncharacterized protein 0.9515 24 126
AF-A0A382P349-F1-model_v4 LTD domain-containing protein 0.9492 20 137

Map