F381781

General Info

Members Datasets Scaffolds Average Seq Length
277 166 554 177

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10017838|Ga0157374_100178381
Length 160
Sequence MRIISGSLGGRRINPPAKMPYTRPTTDIAKEGLFNILQTRVDFDEAKTLDLFSGTGSISYELASRGITDFKIEHANVLRMDVFNFLSTCNEQYDFIFAGPPYALNTIDELPKIIVEKKLIADEGYFVLEHTPRNDYEKFEGFSFKRNYGTTVFSFFTSIS

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
159 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
160 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
161 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
162 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
163 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
164 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 0
Rhizosphere 97.11
Stem 0
Stem Tuber 0
Unclassified 22.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10017838 3300013296 Bacteria 6254
2 JGI24744J21845_10019690 3300002077 Bacteria 1334
3 JGI24742J22300_10044894 3300002244 Bacteria 792
4 rootH2_10024076 3300003320 Bacteria 1706
5 rootL2_10023764 3300003322 Unclassified 4137
6 rootH1_10103728 3300003323 Bacteria 3816
7 Ga0070676_10028499 3300005328 Bacteria 3172
8 Ga0070676_10049450 3300005328 Bacteria 2461
9 Ga0070683_100025485 3300005329 Bacteria 5311
10 Ga0070683_100512214 3300005329 Bacteria 1146
11 Ga0070683_101121572 3300005329 Bacteria 756
12 Ga0070690_100157050 3300005330 Unclassified 1556
13 Ga0070670_100022464 3300005331 Bacteria 5429
14 Ga0068869_100060164 3300005334 Unclassified 2783
15 Ga0068869_100082793 3300005334 Bacteria 2399
16 Ga0068869_100353751 3300005334 Bacteria 1198
17 Ga0068869_101151194 3300005334 Bacteria 680
18 Ga0068868_100006466 3300005338 Bacteria 8294
19 Ga0068868_100179096 3300005338 Bacteria 1758
20 Ga0070660_100058248 3300005339 Bacteria 2994
21 Ga0070689_100879338 3300005340 Unclassified 792
22 Ga0070691_10000902 3300005341 Bacteria 12056
23 Ga0070687_100026195 3300005343 Unclassified 2805
24 Ga0070687_100191386 3300005343 Bacteria 1233
25 Ga0070661_100095256 3300005344 Unclassified 2208
26 Ga0070668_100219912 3300005347 Bacteria 1566
27 Ga0070669_100929096 3300005353 Unclassified 744
28 Ga0070675_100056652 3300005354 Unclassified 3230
29 Ga0070675_100488281 3300005354 Unclassified 1109
30 Ga0070671_100102484 3300005355 Bacteria 2402
31 Ga0070671_100915369 3300005355 Bacteria 766
32 Ga0070674_100100905 3300005356 Unclassified 2102
33 Ga0070674_100131060 3300005356 Bacteria 1869
34 Ga0070673_100008595 3300005364 Bacteria 6800
35 Ga0070673_100217969 3300005364 Unclassified 1650
36 Ga0070673_100218796 3300005364 Bacteria 1647
37 Ga0070688_100736726 3300005365 Bacteria 766
38 Ga0070667_100147554 3300005367 Bacteria 2064
39 Ga0070710_10617521 3300005437 Bacteria 756
40 Ga0070663_100531200 3300005455 Bacteria 981
41 Ga0070678_100103264 3300005456 Bacteria 2214
42 Ga0070662_100244396 3300005457 Bacteria 1440
43 Ga0068867_100020950 3300005459 Bacteria 4663
44 Ga0068867_100371669 3300005459 Bacteria 1199
45 Ga0070685_10119807 3300005466 Bacteria 1633
46 Ga0070679_100589519 3300005530 Bacteria 1055
47 Ga0070679_100742315 3300005530 Bacteria 924
48 Ga0070684_100106610 3300005535 Bacteria 2509
49 Ga0070684_100938473 3300005535 Bacteria 811
50 Ga0068853_100033339 3300005539 Unclassified 4369
51 Ga0068853_100054908 3300005539 Bacteria 3433
52 Ga0068853_100201691 3300005539 Bacteria 1810
53 Ga0068853_100558693 3300005539 Bacteria 1085
54 Ga0070672_100140028 3300005543 Bacteria 1995
55 Ga0070672_100374481 3300005543 Unclassified 1217
56 Ga0070686_100046416 3300005544 Unclassified 2741
57 Ga0070693_100958842 3300005547 Bacteria 644
58 Ga0070664_100018624 3300005564 Bacteria 5708
59 Ga0070664_100042930 3300005564 Bacteria 3815
60 Ga0070664_100117387 3300005564 Bacteria 2327
61 Ga0070664_100261837 3300005564 Bacteria 1556
62 Ga0068857_100125996 3300005577 Bacteria 2308
63 Ga0068854_100039241 3300005578 Bacteria 3335
64 Ga0068854_100112568 3300005578 Unclassified 2055
65 Ga0068854_100398559 3300005578 Bacteria 1138
66 Ga0068852_100130409 3300005616 Bacteria 2314
67 Ga0068852_100362601 3300005616 Bacteria 1418
68 Ga0068852_100515483 3300005616 Bacteria 1192
69 Ga0068852_100712491 3300005616 Bacteria 1014
70 Ga0068852_101052217 3300005616 Bacteria 833
71 Ga0068859_100173926 3300005617 Bacteria 2235
72 Ga0068864_100125209 3300005618 Bacteria 2302
73 Ga0068864_100466893 3300005618 Bacteria 1209
74 Ga0068866_10014742 3300005718 Bacteria 3458
75 Ga0068866_10896521 3300005718 Bacteria 623
76 Ga0068861_101512210 3300005719 Bacteria 659
77 Ga0068851_10159777 3300005834 Unclassified 1237
78 Ga0068851_10195303 3300005834 Bacteria 1127
79 Ga0068851_10336841 3300005834 Unclassified 875
80 Ga0068870_10039948 3300005840 Bacteria 2430
81 Ga0068870_10856414 3300005840 Bacteria 639
82 Ga0068858_100106502 3300005842 Unclassified 2617
83 Ga0068860_100636289 3300005843 Bacteria 1074
84 Ga0081539_10079714 3300005985 Bacteria 1724
85 Ga0070717_10884145 3300006028 Bacteria 813
86 Ga0097621_100040018 3300006237 Unclassified 3767
87 Ga0097621_100697415 3300006237 Bacteria 934
88 Ga0068871_100056744 3300006358 Unclassified 3185
89 Ga0068871_100086976 3300006358 Unclassified 2597
90 Ga0068871_100146170 3300006358 Bacteria 2013
91 Ga0068871_100164689 3300006358 Unclassified 1897
92 Ga0068871_100315039 3300006358 Bacteria 1376
93 Ga0068865_100041816 3300006881 Bacteria 3122
94 Ga0068865_100056383 3300006881 Bacteria 2737
95 Ga0097620_100173929 3300006931 Bacteria 2235
96 Ga0105240_10005151 3300009093 Bacteria 19554
97 Ga0105240_10591878 3300009093 Bacteria 1222
98 Ga0105243_10680506 3300009148 Bacteria 1000
99 Ga0105241_10009664 3300009174 Bacteria 7088
100 Ga0105241_10582496 3300009174 Bacteria 1009
101 Ga0105242_10106530 3300009176 Unclassified 2382
102 Ga0105242_10376802 3300009176 Bacteria 1318
103 Ga0105242_10567098 3300009176 Bacteria 1091
104 Ga0105237_10225780 3300009545 Bacteria 1873
105 Ga0105237_10263693 3300009545 Bacteria 1726
106 Ga0105249_10006520 3300009553 Bacteria 10153
107 Ga0105249_10776902 3300009553 Bacteria 1021
108 Ga0105239_10172281 3300010375 Bacteria 2420
109 Ga0105239_10356305 3300010375 Bacteria 1652
110 Ga0105246_10038816 3300011119 Bacteria 3204
111 Ga0105246_10692047 3300011119 Unclassified 892
112 Ga0157373_10013965 3300013100 Bacteria 5888
113 Ga0157371_10041305 3300013102 Bacteria 3292
114 Ga0157371_10478066 3300013102 Unclassified 918
115 Ga0157370_10004443 3300013104 Bacteria 16068
116 Ga0157370_10529080 3300013104 Bacteria 1082
117 Ga0157370_10777348 3300013104 Bacteria 872
118 Ga0157369_10011424 3300013105 Bacteria 10085
119 Ga0157369_10056472 3300013105 Bacteria 4237
120 Ga0157374_10196037 3300013296 Bacteria 1976
121 Ga0157374_10241043 3300013296 Unclassified 1778
122 Ga0157374_10369584 3300013296 Unclassified 1427
123 Ga0157374_10648015 3300013296 Bacteria 1068
124 Ga0157374_10729432 3300013296 Bacteria 1005
125 Ga0157378_10000623 3300013297 Bacteria 33314
126 Ga0157378_10007694 3300013297 Bacteria 9399
127 Ga0157378_10268356 3300013297 Unclassified 1640
128 Ga0163162_10053717 3300013306 Bacteria 4050
129 Ga0157372_10009376 3300013307 Bacteria 10413
130 Ga0157372_10034236 3300013307 Bacteria 5584
131 Ga0157372_10072165 3300013307 Unclassified 3890
132 Ga0157372_10119659 3300013307 Bacteria 3023
133 Ga0157372_10185546 3300013307 Bacteria 2408
134 Ga0157372_11118978 3300013307 Bacteria 911
135 Ga0157372_11200774 3300013307 Unclassified 876
136 Ga0157372_11441033 3300013307 Bacteria 794
137 Ga0157375_10096424 3300013308 Bacteria 3030
138 Ga0157375_10256078 3300013308 Bacteria 1912
139 Ga0157375_10485451 3300013308 Bacteria 1400
140 Ga0157375_10586708 3300013308 Unclassified 1274
141 Ga0163163_10802044 3300014325 Bacteria 1005
142 Ga0157380_10102938 3300014326 Bacteria 2382
143 Ga0157377_10016778 3300014745 Unclassified 3774
144 Ga0157377_10104661 3300014745 Bacteria 1692
145 Ga0157376_10069368 3300014969 Bacteria 2988
146 Ga0157376_10506349 3300014969 Bacteria 1188
147 Ga0157376_11174464 3300014969 Bacteria 795
148 Ga0163161_10239220 3300017792 Bacteria 1411
149 Ga0163161_10244552 3300017792 Bacteria 1396
150 Ga0207682_10032853 3300025893 Bacteria 2086
151 Ga0207692_10539736 3300025898 Bacteria 744
152 Ga0207642_10016891 3300025899 Bacteria 2762
153 Ga0207642_10722809 3300025899 Bacteria 629
154 Ga0207688_10005217 3300025901 Bacteria 7061
155 Ga0207680_10152150 3300025903 Unclassified 1543
156 Ga0207647_10081559 3300025904 Unclassified 1938
157 Ga0207647_10130337 3300025904 Bacteria 1478
158 Ga0207645_10002651 3300025907 Bacteria 13931
159 Ga0207645_10053954 3300025907 Bacteria 2568
160 Ga0207645_10118354 3300025907 Bacteria 1719
161 Ga0207643_10036390 3300025908 Bacteria 2760
162 Ga0207654_10070852 3300025911 Bacteria 2071
163 Ga0207707_10038093 3300025912 Bacteria 4201
164 Ga0207695_10026578 3300025913 Bacteria 6460
165 Ga0207660_10006572 3300025917 Bacteria 7546
166 Ga0207660_10362884 3300025917 Unclassified 1162
167 Ga0207660_10369572 3300025917 Bacteria 1151
168 Ga0207657_10037895 3300025919 Bacteria 4299
169 Ga0207649_10271872 3300025920 Unclassified 1229
170 Ga0207649_10310536 3300025920 Unclassified 1155
171 Ga0207681_10468521 3300025923 Bacteria 1027
172 Ga0207681_10503555 3300025923 Unclassified 992
173 Ga0207650_10099404 3300025925 Bacteria 2237
174 Ga0207659_10047153 3300025926 Bacteria 3047
175 Ga0207659_10262139 3300025926 Unclassified 1406
176 Ga0207659_10475353 3300025926 Bacteria 1055
177 Ga0207644_10911459 3300025931 Bacteria 737
178 Ga0207690_10035969 3300025932 Bacteria 3203
179 Ga0207706_10001156 3300025933 Bacteria 26853
180 Ga0207706_10124207 3300025933 Bacteria 2270
181 Ga0207686_10025319 3300025934 Bacteria 3449
182 Ga0207670_10303998 3300025936 Bacteria 1250
183 Ga0207669_10211324 3300025937 Bacteria 1416
184 Ga0207669_10473354 3300025937 Bacteria 997
185 Ga0207704_10107495 3300025938 Bacteria 1877
186 Ga0207691_10056943 3300025940 Bacteria 3560
187 Ga0207691_10150687 3300025940 Bacteria 2045
188 Ga0207689_10027951 3300025942 Bacteria 4719
189 Ga0207689_10074344 3300025942 Bacteria 2792
190 Ga0207661_10062912 3300025944 Bacteria 3004
191 Ga0207661_10645239 3300025944 Bacteria 973
192 Ga0207679_10037624 3300025945 Unclassified 3441
193 Ga0207679_10038839 3300025945 Bacteria 3396
194 Ga0207679_10040347 3300025945 Bacteria 3341
195 Ga0207679_10201438 3300025945 Bacteria 1663
196 Ga0207679_10325667 3300025945 Bacteria 1332
197 Ga0207679_10704093 3300025945 Unclassified 917
198 Ga0207651_10210073 3300025960 Unclassified 1566
199 Ga0207651_10261026 3300025960 Unclassified 1422
200 Ga0207651_10263926 3300025960 Bacteria 1415
201 Ga0207712_10674779 3300025961 Bacteria 900
202 Ga0207640_10091492 3300025981 Bacteria 2107
203 Ga0207640_10288773 3300025981 Bacteria 1292
204 Ga0207640_11012129 3300025981 Bacteria 731
205 Ga0207658_10135684 3300025986 Bacteria 1984
206 Ga0207677_10231601 3300026023 Bacteria 1488
207 Ga0207677_10294735 3300026023 Bacteria 1338
208 Ga0207703_10251320 3300026035 Unclassified 1594
209 Ga0207703_10875050 3300026035 Unclassified 860
210 Ga0207639_10128128 3300026041 Unclassified 2097
211 Ga0207639_10296745 3300026041 Unclassified 1427
212 Ga0207678_10523377 3300026067 Unclassified 1035
213 Ga0207678_10931868 3300026067 Bacteria 768
214 Ga0207702_10260599 3300026078 Unclassified 1632
215 Ga0207648_10001367 3300026089 Bacteria 26953
216 Ga0207648_10002631 3300026089 Bacteria 19216
217 Ga0207648_10095330 3300026089 Bacteria 2603
218 Ga0207676_10058843 3300026095 Bacteria 3033
219 Ga0207676_10453799 3300026095 Bacteria 1209
220 Ga0207676_10479710 3300026095 Bacteria 1178
221 Ga0207674_10117290 3300026116 Bacteria 2633
222 Ga0207674_10305510 3300026116 Bacteria 1540
223 Ga0207674_10470482 3300026116 Bacteria 1215
224 Ga0207675_100917729 3300026118 Bacteria 892
225 Ga0207683_10021873 3300026121 Bacteria 5484
226 Ga0207683_10193381 3300026121 Unclassified 1848
227 Ga0207698_10076555 3300026142 Bacteria 2678
228 Ga0207698_10837240 3300026142 Bacteria 924
229 Ga0209974_10013302 3300027876 Bacteria 2742
230 Ga0268266_10083409 3300028379 Unclassified 2790
231 Ga0268265_10228456 3300028380 Bacteria 1634
232 Ga0268264_10007948 3300028381 Bacteria 8826
233 Ga0268264_10056969 3300028381 Bacteria 3268
234 Ga0268264_11286849 3300028381 Bacteria 741
235 Ga0307405_10788100 3300031731 Unclassified 795
236 Ga0307412_11056175 3300031911 Unclassified 720
237 Ga0307510_10056706 3300033180 Bacteria 4074
238 Ga0373954_0122314 3300035118 Unclassified 1264
239 Ga0373955_0271280 3300035172 Bacteria 1020
240 Ga0373937_0876280 3300036401 Bacteria 846
241 Ga0395899_0553825 3300037312 Bacteria 739
242 Ga0395900_0907399 3300037418 Bacteria 804
243 Ga0395905_0003278 3300037471 Bacteria 17377
244 Ga0395901_1587637 3300038443 Bacteria 608
245 Ga0436365_1246144 3300039437 Bacteria 678
246 Ga0436363_0633160 3300039450 Bacteria 1225
247 Ga0466969_0008387 3300044656 Bacteria 5478
248 Ga0466966_0066378 3300044684 Bacteria 2267
249 Ga0453684_0094845 3300044712 Bacteria 3669
250 Ga0466971_0183185 3300044719 Bacteria 985
251 Ga0466959_0000039 3300045049 Bacteria 101186
252 Ga0495629_0530475 3300046459 Bacteria 792
253 Ga0495650_0032626 3300046471 Unclassified 2327
254 Ga0495580_0236384 3300046472 Unclassified 1253
255 Ga0495582_0489958 3300046473 Bacteria 710
256 Ga0495664_0438423 3300046477 Unclassified 783
257 Ga0495606_0014392 3300046507 Bacteria 6180
258 Ga0495618_0511559 3300046514 Bacteria 723
259 Ga0495665_0053454 3300046531 Unclassified 2136
260 Ga0495586_0133462 3300046535 Bacteria 1391
261 Ga0495668_0000677 3300046616 Bacteria 41080
262 Ga0495623_0200435 3300046679 Bacteria 1148
263 Ga0495647_0144294 3300046681 Unclassified 1017
264 Ga0495624_0385182 3300046690 Unclassified 842
265 Ga0495600_0348428 3300046809 Bacteria 928
266 Ga0495674_0246236 3300047319 Bacteria 1472
267 Ga0495676_0256965 3300047321 Unclassified 1190
268 Ga0495686_0001743 3300047472 Bacteria 22322
269 Ga0501300_060605 3300049523 Bacteria 598
270 Ga0501253_005478 3300049683 Bacteria 1668
271 Ga0501219_000332 3300049703 Bacteria 8136
272 Ga0501225_0231759 3300049705 Bacteria 599
273 Ga0501269_001012 3300049766 Bacteria 4005
274 Ga0501284_00039 3300050005 Bacteria 53400
275 nmdc:mga0k408_57356_c1 3300050493 Bacteria 2260
276 nmdc:mga06r32_153050_c1 3300050510 Bacteria 2286
277 Ga0500556_0071444 3300053104 Unclassified 1297
278 Ga0157374_10017838
279 JGI24744J21845_10019690
280 JGI24742J22300_10044894
281 rootH2_10024076
282 rootL2_10023764
283 rootH1_10103728
284 Ga0070676_10028499
285 Ga0070676_10049450
286 Ga0070683_100025485
287 Ga0070683_100512214
288 Ga0070683_101121572
289 Ga0070690_100157050
290 Ga0070670_100022464
291 Ga0068869_100060164
292 Ga0068869_100082793
293 Ga0068869_100353751
294 Ga0068869_101151194
295 Ga0068868_100006466
296 Ga0068868_100179096
297 Ga0070660_100058248
298 Ga0070689_100879338
299 Ga0070691_10000902
300 Ga0070687_100026195
301 Ga0070687_100191386
302 Ga0070661_100095256
303 Ga0070668_100219912
304 Ga0070669_100929096
305 Ga0070675_100056652
306 Ga0070675_100488281
307 Ga0070671_100102484
308 Ga0070671_100915369
309 Ga0070674_100100905
310 Ga0070674_100131060
311 Ga0070673_100008595
312 Ga0070673_100217969
313 Ga0070673_100218796
314 Ga0070688_100736726
315 Ga0070667_100147554
316 Ga0070710_10617521
317 Ga0070663_100531200
318 Ga0070678_100103264
319 Ga0070662_100244396
320 Ga0068867_100020950
321 Ga0068867_100371669
322 Ga0070685_10119807
323 Ga0070679_100589519
324 Ga0070679_100742315
325 Ga0070684_100106610
326 Ga0070684_100938473
327 Ga0068853_100033339
328 Ga0068853_100054908
329 Ga0068853_100201691
330 Ga0068853_100558693
331 Ga0070672_100140028
332 Ga0070672_100374481
333 Ga0070686_100046416
334 Ga0070693_100958842
335 Ga0070664_100018624
336 Ga0070664_100042930
337 Ga0070664_100117387
338 Ga0070664_100261837
339 Ga0068857_100125996
340 Ga0068854_100039241
341 Ga0068854_100112568
342 Ga0068854_100398559
343 Ga0068852_100130409
344 Ga0068852_100362601
345 Ga0068852_100515483
346 Ga0068852_100712491
347 Ga0068852_101052217
348 Ga0068859_100173926
349 Ga0068864_100125209
350 Ga0068864_100466893
351 Ga0068866_10014742
352 Ga0068866_10896521
353 Ga0068861_101512210
354 Ga0068851_10159777
355 Ga0068851_10195303
356 Ga0068851_10336841
357 Ga0068870_10039948
358 Ga0068870_10856414
359 Ga0068858_100106502
360 Ga0068860_100636289
361 Ga0081539_10079714
362 Ga0070717_10884145
363 Ga0097621_100040018
364 Ga0097621_100697415
365 Ga0068871_100056744
366 Ga0068871_100086976
367 Ga0068871_100146170
368 Ga0068871_100164689
369 Ga0068871_100315039
370 Ga0068865_100041816
371 Ga0068865_100056383
372 Ga0097620_100173929
373 Ga0105240_10005151
374 Ga0105240_10591878
375 Ga0105243_10680506
376 Ga0105241_10009664
377 Ga0105241_10582496
378 Ga0105242_10106530
379 Ga0105242_10376802
380 Ga0105242_10567098
381 Ga0105237_10225780
382 Ga0105237_10263693
383 Ga0105249_10006520
384 Ga0105249_10776902
385 Ga0105239_10172281
386 Ga0105239_10356305
387 Ga0105246_10038816
388 Ga0105246_10692047
389 Ga0157373_10013965
390 Ga0157371_10041305
391 Ga0157371_10478066
392 Ga0157370_10004443
393 Ga0157370_10529080
394 Ga0157370_10777348
395 Ga0157369_10011424
396 Ga0157369_10056472
397 Ga0157374_10196037
398 Ga0157374_10241043
399 Ga0157374_10369584
400 Ga0157374_10648015
401 Ga0157374_10729432
402 Ga0157378_10000623
403 Ga0157378_10007694
404 Ga0157378_10268356
405 Ga0163162_10053717
406 Ga0157372_10009376
407 Ga0157372_10034236
408 Ga0157372_10072165
409 Ga0157372_10119659
410 Ga0157372_10185546
411 Ga0157372_11118978
412 Ga0157372_11200774
413 Ga0157372_11441033
414 Ga0157375_10096424
415 Ga0157375_10256078
416 Ga0157375_10485451
417 Ga0157375_10586708
418 Ga0163163_10802044
419 Ga0157380_10102938
420 Ga0157377_10016778
421 Ga0157377_10104661
422 Ga0157376_10069368
423 Ga0157376_10506349
424 Ga0157376_11174464
425 Ga0163161_10239220
426 Ga0163161_10244552
427 Ga0207682_10032853
428 Ga0207692_10539736
429 Ga0207642_10016891
430 Ga0207642_10722809
431 Ga0207688_10005217
432 Ga0207680_10152150
433 Ga0207647_10081559
434 Ga0207647_10130337
435 Ga0207645_10002651
436 Ga0207645_10053954
437 Ga0207645_10118354
438 Ga0207643_10036390
439 Ga0207654_10070852
440 Ga0207707_10038093
441 Ga0207695_10026578
442 Ga0207660_10006572
443 Ga0207660_10362884
444 Ga0207660_10369572
445 Ga0207657_10037895
446 Ga0207649_10271872
447 Ga0207649_10310536
448 Ga0207681_10468521
449 Ga0207681_10503555
450 Ga0207650_10099404
451 Ga0207659_10047153
452 Ga0207659_10262139
453 Ga0207659_10475353
454 Ga0207644_10911459
455 Ga0207690_10035969
456 Ga0207706_10001156
457 Ga0207706_10124207
458 Ga0207686_10025319
459 Ga0207670_10303998
460 Ga0207669_10211324
461 Ga0207669_10473354
462 Ga0207704_10107495
463 Ga0207691_10056943
464 Ga0207691_10150687
465 Ga0207689_10027951
466 Ga0207689_10074344
467 Ga0207661_10062912
468 Ga0207661_10645239
469 Ga0207679_10037624
470 Ga0207679_10038839
471 Ga0207679_10040347
472 Ga0207679_10201438
473 Ga0207679_10325667
474 Ga0207679_10704093
475 Ga0207651_10210073
476 Ga0207651_10261026
477 Ga0207651_10263926
478 Ga0207712_10674779
479 Ga0207640_10091492
480 Ga0207640_10288773
481 Ga0207640_11012129
482 Ga0207658_10135684
483 Ga0207677_10231601
484 Ga0207677_10294735
485 Ga0207703_10251320
486 Ga0207703_10875050
487 Ga0207639_10128128
488 Ga0207639_10296745
489 Ga0207678_10523377
490 Ga0207678_10931868
491 Ga0207702_10260599
492 Ga0207648_10001367
493 Ga0207648_10002631
494 Ga0207648_10095330
495 Ga0207676_10058843
496 Ga0207676_10453799
497 Ga0207676_10479710
498 Ga0207674_10117290
499 Ga0207674_10305510
500 Ga0207674_10470482
501 Ga0207675_100917729
502 Ga0207683_10021873
503 Ga0207683_10193381
504 Ga0207698_10076555
505 Ga0207698_10837240
506 Ga0209974_10013302
507 Ga0268266_10083409
508 Ga0268265_10228456
509 Ga0268264_10007948
510 Ga0268264_10056969
511 Ga0268264_11286849
512 Ga0307405_10788100
513 Ga0307412_11056175
514 Ga0307510_10056706
515 Ga0373954_0122314
516 Ga0373955_0271280
517 Ga0373937_0876280
518 Ga0395899_0553825
519 Ga0395900_0907399
520 Ga0395905_0003278
521 Ga0395901_1587637
522 Ga0436365_1246144
523 Ga0436363_0633160
524 Ga0466969_0008387
525 Ga0466966_0066378
526 Ga0453684_0094845
527 Ga0466971_0183185
528 Ga0466959_0000039
529 Ga0495629_0530475
530 Ga0495650_0032626
531 Ga0495580_0236384
532 Ga0495582_0489958
533 Ga0495664_0438423
534 Ga0495606_0014392
535 Ga0495618_0511559
536 Ga0495665_0053454
537 Ga0495586_0133462
538 Ga0495668_0000677
539 Ga0495623_0200435
540 Ga0495647_0144294
541 Ga0495624_0385182
542 Ga0495600_0348428
543 Ga0495674_0246236
544 Ga0495676_0256965
545 Ga0495686_0001743
546 Ga0501300_060605
547 Ga0501253_005478
548 Ga0501219_000332
549 Ga0501225_0231759
550 Ga0501269_001012
551 Ga0501284_00039
552 nmdc:mga0k408_57356_c1
553 nmdc:mga06r32_153050_c1
554 Ga0500556_0071444

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

1

72

0.94

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

67

157

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p9n-assembly1.cif.gz_A rv2966c of m. tuberculosis is a rsmd-like methyltransferase 0.904 4 160
6m1c-assembly1.cif.gz_A crystal structure of rsmd methyltransferase of m. tuberculosis in complex with sinefungin reveals key interactions 0.8985 2 160
2fpo-assembly3.cif.gz_C putative methyltransferase yhhf from escherichia coli. 0.8928 5 161
2fpo-assembly4.cif.gz_D putative methyltransferase yhhf from escherichia coli. 0.8844 3 161
2fpo-assembly6.cif.gz_F putative methyltransferase yhhf from escherichia coli. 0.8823 2 161
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9284 26 89 3.40.50.150
6aieC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9167 5 160 3.40.50.150
af_A0A5K1K930_343_529_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8986 3 159 3.40.50.150
af_A0A0R0EHR2_116_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8832 5 162 3.40.50.150
2fpoF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8807 2 161 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A4Q5YDZ7-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9881 60 160
AF-A0A352J4S7-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9873 45 158 GO:0003676
GO:0008168
GO:0031167
AF-A0A4Q5RP60-F1-model_v4 Methyltransferase domain-containing protein 0.9871 17 163 GO:0008168
GO:0031167
AF-A0A3M1ZDU0-F1-model_v4 Methyltransferase domain-containing protein 0.9859 31 158 GO:0008168
GO:0031167
AF-A0A3B8YNB2-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9857 80 158 GO:0003676
GO:0008168
GO:0032259

Map