F381588

General Info

Members Datasets Scaffolds Average Seq Length
277 181 554 143

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100483662|Ga0068868_1004836621
Length 165
Sequence MAAEIHPTATVHPGTVLGEGVKVLENAVVGKQPSLSPRSTAKREPLPPTEIGDGTIVSTGAIVFAXXRIGARVVLGDQPCVVTTNDNFMGRTERRHDLIAGPTIRRGARIGGGAILCPGVEIGEEAFVGAGAVVTKDVPSRVIVVGNPARVLRDVPPDELLPPSP

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
104 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
111 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
112 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
113 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
114 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
115 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
181 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 10.11
Rhizosphere 89.17
Stem 0
Stem Tuber 0
Unclassified 13.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100483662 3300005338 Unclassified 1082
2 Ga0070658_10271116 3300005327 Bacteria 1443
3 Ga0070690_100256497 3300005330 Bacteria 1239
4 Ga0070670_100010961 3300005331 Bacteria 7743
5 Ga0070670_100149160 3300005331 Bacteria 2024
6 Ga0068869_100028845 3300005334 Bacteria 3882
7 Ga0070668_100119649 3300005347 Unclassified 2104
8 Ga0070675_100022598 3300005354 Bacteria 5025
9 Ga0070671_100324296 3300005355 Unclassified 1313
10 Ga0070674_100007099 3300005356 Bacteria 6589
11 Ga0070674_100080525 3300005356 Bacteria 2326
12 Ga0070673_100986497 3300005364 Bacteria 784
13 Ga0070688_100235723 3300005365 Unclassified 1296
14 Ga0070703_10201841 3300005406 Bacteria 781
15 Ga0070709_10008237 3300005434 Bacteria 5726
16 Ga0070709_10224699 3300005434 Bacteria 1340
17 Ga0070714_100089188 3300005435 Bacteria 2699
18 Ga0070713_100452218 3300005436 Bacteria 1206
19 Ga0070701_10007280 3300005438 Unclassified 4713
20 Ga0070711_100077289 3300005439 Bacteria 2362
21 Ga0070700_100186327 3300005441 Unclassified 1448
22 Ga0070678_100564769 3300005456 Bacteria 1012
23 Ga0070685_10004486 3300005466 Bacteria 7064
24 Ga0070707_100326202 3300005468 Bacteria 1492
25 Ga0070707_100506716 3300005468 Bacteria 1169
26 Ga0070698_100379600 3300005471 Unclassified 1346
27 Ga0070679_100426915 3300005530 Bacteria 1271
28 Ga0070684_100027975 3300005535 Bacteria 4765
29 Ga0070697_100215544 3300005536 Bacteria 1635
30 Ga0070686_100066153 3300005544 Unclassified 2350
31 Ga0070704_100146166 3300005549 Unclassified 1853
32 Ga0068857_100028623 3300005577 Bacteria 4916
33 Ga0068857_100563724 3300005577 Bacteria 1074
34 Ga0070702_100008854 3300005615 Bacteria 4896
35 Ga0068859_100066876 3300005617 Bacteria 3629
36 Ga0068864_100569580 3300005618 Unclassified 1097
37 Ga0068870_10001168 3300005840 Bacteria 10510
38 Ga0068870_10058216 3300005840 Bacteria 2068
39 Ga0068870_10236901 3300005840 Bacteria 1125
40 Ga0068870_10592645 3300005840 Bacteria 752
41 Ga0070717_10011128 3300006028 Bacteria 6818
42 Ga0070715_10001649 3300006163 Bacteria 6610
43 Ga0070716_100026002 3300006173 Bacteria 3130
44 Ga0075367_10313061 3300006178 Unclassified 989
45 Ga0075428_100520086 3300006844 Bacteria 1273
46 Ga0075428_100534387 3300006844 Bacteria 1254
47 Ga0075431_100106015 3300006847 Bacteria 2900
48 Ga0075431_100214560 3300006847 Bacteria 1965
49 Ga0075433_10023009 3300006852 Bacteria 5240
50 Ga0075434_100051677 3300006871 Bacteria 4084
51 Ga0068865_100030449 3300006881 Bacteria 3590
52 Ga0068865_100876534 3300006881 Bacteria 779
53 Ga0075436_100180200 3300006914 Bacteria 1493
54 Ga0097620_100066874 3300006931 Bacteria 3629
55 Ga0075435_100001565 3300007076 Bacteria 14763
56 Ga0111539_10123327 3300009094 Unclassified 3037
57 Ga0111539_10129872 3300009094 Bacteria 2951
58 Ga0111539_11257161 3300009094 Bacteria 859
59 Ga0105245_10490893 3300009098 Bacteria 1243
60 Ga0105245_10565112 3300009098 Bacteria 1161
61 Ga0114129_10004863 3300009147 Bacteria 18959
62 Ga0114129_10032771 3300009147 Bacteria 7342
63 Ga0114129_10636562 3300009147 Unclassified 1378
64 Ga0114129_10848802 3300009147 Bacteria 1161
65 Ga0105248_10130904 3300009177 Unclassified 2830
66 Ga0105249_10669032 3300009553 Unclassified 1097
67 Ga0105246_10060855 3300011119 Unclassified 2625
68 Ga0157369_10404871 3300013105 Bacteria 1415
69 Ga0157375_10116013 3300013308 Unclassified 2781
70 Ga0163163_10003920 3300014325 Bacteria 12691
71 Ga0163163_10380210 3300014325 Bacteria 1470
72 Ga0157380_10247631 3300014326 Unclassified 1611
73 Ga0206356_10985988 3300020070 Bacteria 1358
74 Ga0206353_11033259 3300020082 Bacteria 7089
75 Ga0207642_10123344 3300025899 Unclassified 1340
76 Ga0207688_10004541 3300025901 Bacteria 7557
77 Ga0207643_10004333 3300025908 Bacteria 7630
78 Ga0207643_10067806 3300025908 Bacteria 2049
79 Ga0207643_10577552 3300025908 Bacteria 722
80 Ga0207705_10324129 3300025909 Bacteria 1184
81 Ga0207707_10283090 3300025912 Bacteria 1436
82 Ga0207693_10013870 3300025915 Bacteria 6490
83 Ga0207660_10405093 3300025917 Bacteria 1099
84 Ga0207662_10014064 3300025918 Bacteria 4483
85 Ga0207657_10002645 3300025919 Bacteria 19337
86 Ga0207649_10114507 3300025920 Bacteria 1807
87 Ga0207650_10083477 3300025925 Bacteria 2427
88 Ga0207650_10097386 3300025925 Bacteria 2258
89 Ga0207687_10061981 3300025927 Bacteria 2643
90 Ga0207687_10427218 3300025927 Bacteria 1094
91 Ga0207700_10061488 3300025928 Bacteria 2848
92 Ga0207700_10087111 3300025928 Bacteria 2455
93 Ga0207700_10261492 3300025928 Bacteria 1482
94 Ga0207664_10021463 3300025929 Bacteria 4803
95 Ga0207664_10684511 3300025929 Bacteria 922
96 Ga0207644_10552759 3300025931 Unclassified 953
97 Ga0207706_10200622 3300025933 Bacteria 1749
98 Ga0207709_10077498 3300025935 Bacteria 2131
99 Ga0207669_10142159 3300025937 Unclassified 1667
100 Ga0207669_10343381 3300025937 Bacteria 1150
101 Ga0207704_10188754 3300025938 Unclassified 1497
102 Ga0207665_10009744 3300025939 Bacteria 6307
103 Ga0207691_10018370 3300025940 Bacteria 6625
104 Ga0207689_10229607 3300025942 Bacteria 1534
105 Ga0207661_10019656 3300025944 Bacteria 5041
106 Ga0207667_10182441 3300025949 Bacteria 2155
107 Ga0207651_10779029 3300025960 Bacteria 847
108 Ga0207668_10181696 3300025972 Unclassified 1660
109 Ga0207677_10140930 3300026023 Unclassified 1846
110 Ga0207677_10533641 3300026023 Bacteria 1020
111 Ga0207708_10037357 3300026075 Unclassified 3700
112 Ga0207708_10681831 3300026075 Unclassified 877
113 Ga0207648_10070223 3300026089 Bacteria 3053
114 Ga0207676_10838706 3300026095 Unclassified 898
115 Ga0207674_10115972 3300026116 Bacteria 2650
116 Ga0207674_10392371 3300026116 Bacteria 1342
117 Ga0207683_10106938 3300026121 Bacteria 2502
118 Ga0207683_10601391 3300026121 Bacteria 1018
119 Ga0207428_10090918 3300027907 Bacteria 2370
120 Ga0268266_10381303 3300028379 Bacteria 1330
121 Ga0265334_10038726 3300028573 Bacteria 1874
122 Ga0265338_10038662 3300028800 Bacteria 4515
123 Ga0265338_10069866 3300028800 Bacteria 3015
124 Ga0265338_10135360 3300028800 Bacteria 1938
125 Ga0265338_10292187 3300028800 Unclassified 1187
126 Ga0265320_10159989 3300031240 Unclassified 1014
127 Ga0265340_10041344 3300031247 Bacteria 2267
128 Ga0265327_10017098 3300031251 Bacteria 4567
129 Ga0265327_10210865 3300031251 Bacteria 877
130 Ga0265316_10013578 3300031344 Bacteria 7227
131 Ga0265316_10551377 3300031344 Bacteria 820
132 Ga0307408_100524764 3300031548 Bacteria 1041
133 Ga0265342_10156934 3300031712 Bacteria 1260
134 Ga0307407_10043388 3300031903 Bacteria 2528
135 Ga0307409_100132010 3300031995 Bacteria 2136
136 Ga0307416_100177274 3300032002 Unclassified 1993
137 Ga0307416_100197643 3300032002 Bacteria 1904
138 Ga0307415_100090843 3300032126 Bacteria 2210
139 Ga0307415_100333111 3300032126 Bacteria 1271
140 Ga0373958_0047717 3300034819 Bacteria 896
141 Ga0373951_0033314 3300035091 Bacteria 1221
142 Ga0373937_0008365 3300036401 Bacteria 8986
143 Ga0395899_0010144 3300037312 Bacteria 7222
144 Ga0395899_0046472 3300037312 Bacteria 3234
145 Ga0395900_0044177 3300037418 Bacteria 4592
146 Ga0395900_0046184 3300037418 Bacteria 4485
147 Ga0395900_0301285 3300037418 Bacteria 1589
148 Ga0395898_0013089 3300037466 Bacteria 8553
149 Ga0395898_0094360 3300037466 Bacteria 2875
150 Ga0395901_0007603 3300038443 Bacteria 10941
151 Ga0439438_061587 3300041405 Bacteria 939
152 Ga0439453_0001537 3300041408 Bacteria 2995
153 Ga0451789_1043840 3300041443 Bacteria 849
154 Ga0439432_058983 3300042006 Bacteria 1186
155 Ga0439446_0006581 3300042156 Bacteria 3036
156 Ga0439434_0002894 3300042435 Bacteria 5012
157 Ga0466966_0032815 3300044684 Bacteria 3361
158 Ga0466963_0004472 3300044694 Bacteria 8134
159 Ga0466963_0015854 3300044694 Bacteria 4677
160 Ga0466963_0020320 3300044694 Bacteria 4175
161 Ga0466964_0014272 3300044706 Bacteria 3020
162 Ga0466964_0014681 3300044706 Bacteria 2979
163 Ga0466964_0083016 3300044706 Bacteria 1379
164 Ga0466971_0003249 3300044719 Bacteria 6936
165 Ga0466971_0005391 3300044719 Bacteria 5549
166 Ga0466971_0006854 3300044719 Bacteria 4957
167 Ga0466971_0256373 3300044719 Bacteria 834
168 Ga0466968_0096943 3300044735 Bacteria 1313
169 Ga0466968_0110303 3300044735 Bacteria 1237
170 Ga0466970_0014625 3300044765 Bacteria 4031
171 Ga0466957_0015758 3300044842 Bacteria 4416
172 Ga0466957_0016421 3300044842 Bacteria 4332
173 Ga0466957_0016738 3300044842 Bacteria 4289
174 Ga0466957_0022469 3300044842 Bacteria 3721
175 Ga0466957_0411785 3300044842 Bacteria 926
176 Ga0466959_0002698 3300045049 Bacteria 11399
177 Ga0466959_0018667 3300045049 Bacteria 5093
178 Ga0466959_0282832 3300045049 Bacteria 1138
179 Ga0451576_0592937 3300045051 Bacteria 1165
180 Ga0466958_0004595 3300045836 Bacteria 7312
181 Ga0466958_0074808 3300045836 Bacteria 2076
182 Ga0466958_0520018 3300045836 Bacteria 772
183 Ga0466967_0012551 3300045976 Bacteria 6488
184 Ga0466967_0031549 3300045976 Bacteria 4462
185 Ga0466967_0054546 3300045976 Bacteria 3518
186 Ga0495608_0348613 3300046511 Bacteria 911
187 Ga0495630_0002880 3300046517 Bacteria 11952
188 Ga0495587_0321155 3300046536 Bacteria 865
189 Ga0495657_0192455 3300046675 Bacteria 1246
190 Ga0495670_0153545 3300046691 Bacteria 1208
191 Ga0495670_0284556 3300046691 Bacteria 884
192 Ga0495589_0301129 3300046794 Bacteria 743
193 Ga0495604_0368763 3300047317 Bacteria 951
194 Ga0495636_0098744 3300047318 Bacteria 1275
195 Ga0496101_0049123 3300048904 Bacteria 3033
196 Ga0496101_1363982 3300048904 Unclassified 554
197 Ga0496102_0018759 3300048905 Bacteria 6084
198 Ga0496102_0028034 3300048905 Bacteria 5032
199 Ga0496102_0257940 3300048905 Bacteria 1644
200 Ga0496104_0775617 3300048907 Bacteria 865
201 Ga0496105_0177854 3300048908 Bacteria 1742
202 Ga0496106_0007776 3300048909 Bacteria 7932
203 Ga0496107_0119199 3300048910 Bacteria 1943
204 Ga0496108_0027141 3300048911 Bacteria 4724
205 Ga0496108_0031696 3300048911 Bacteria 4387
206 Ga0496108_0273154 3300048911 Bacteria 1471
207 Ga0496109_0001202 3300048912 Bacteria 21556
208 Ga0496109_0003436 3300048912 Bacteria 13227
209 Ga0496109_0136233 3300048912 Bacteria 2294
210 Ga0496110_0040521 3300048913 Bacteria 4059
211 Ga0496110_0077831 3300048913 Bacteria 2951
212 Ga0496111_0010736 3300048914 Bacteria 6159
213 Ga0496111_0074854 3300048914 Bacteria 2467
214 Ga0496111_0190861 3300048914 Bacteria 1523
215 Ga0496112_0004011 3300048915 Bacteria 12346
216 Ga0496112_0105106 3300048915 Bacteria 2793
217 Ga0496112_0109075 3300048915 Bacteria 2738
218 Ga0496112_0554226 3300048915 Bacteria 1083
219 Ga0496113_0036564 3300048916 Bacteria 3598
220 Ga0496114_0045440 3300048917 Bacteria 3648
221 Ga0496115_0075761 3300048918 Bacteria 2733
222 Ga0501031_0382911 3300049568 Bacteria 910
223 Ga0501038_0501990 3300049574 Bacteria 927
224 Ga0501040_0001516 3300049576 Bacteria 14748
225 Ga0501040_0338186 3300049576 Unclassified 1078
226 Ga0501041_0258468 3300049577 Bacteria 1095
227 Ga0501042_0003076 3300049578 Bacteria 10387
228 Ga0501042_0230907 3300049578 Bacteria 1335
229 Ga0501042_0401515 3300049578 Bacteria 993
230 Ga0501043_0083457 3300049579 Bacteria 2512
231 Ga0501046_0023719 3300049580 Bacteria 5042
232 Ga0501048_0001067 3300049582 Bacteria 20543
233 Ga0501067_0045142 3300049583 Bacteria 2448
234 Ga0501067_0136618 3300049583 Bacteria 1365
235 Ga0501068_0210914 3300049584 Bacteria 1233
236 Ga0501069_0106068 3300049585 Bacteria 1597
237 Ga0501071_0003147 3300049587 Bacteria 10261
238 Ga0501072_0002382 3300049588 Bacteria 14107
239 Ga0501073_0459922 3300049589 Bacteria 880
240 Ga0501075_0010274 3300049591 Bacteria 6576
241 Ga0501075_0214231 3300049591 Bacteria 1469
242 Ga0501076_0037245 3300049592 Bacteria 3813
243 Ga0501080_0292173 3300049742 Bacteria 1480
244 Ga0501081_0158359 3300049743 Bacteria 1630
245 Ga0501035_0149124 3300049822 Bacteria 2030
246 nmdc:mga06z11_350644_c1 3300050494 Unclassified 883
247 nmdc:mga05p37_111348_c1 3300050507 Bacteria 3367
248 nmdc:mga05p37_204751_c1 3300050507 Bacteria 2387
249 nmdc:mga05p37_232209_c1 3300050507 Bacteria 2222
250 nmdc:mga0qj67_467174_c1 3300050509 Bacteria 1016
251 nmdc:mga06r32_107435_c1 3300050510 Bacteria 2742
252 nmdc:mga06r32_136012_c1 3300050510 Bacteria 2432
253 nmdc:mga06r32_683909_c1 3300050510 Unclassified 992
254 nmdc:mga08y16_293305_c1 3300050511 Bacteria 1677
255 nmdc:mga08y16_488214_c1 3300050511 Viruses 1253
256 nmdc:mga08y16_65229_c1 3300050511 Unclassified 3801
257 nmdc:mga0rr50_431444_c1 3300050513 Unclassified 1116
258 nmdc:mga08x19_127549_c1 3300050514 Bacteria 1709
259 nmdc:mga08x19_151514_c1 3300050514 Bacteria 1571
260 nmdc:mga0a205_5892_c1 3300050515 Bacteria 11040
261 Ga0495595_0354352 3300053084 Bacteria 741
262 Ga0495619_0229577 3300053085 Bacteria 1286
263 Ga0501084_0006177 3300054114 Bacteria 9851
264 Ga0501084_0036614 3300054114 Bacteria 4099
265 Ga0501084_0108705 3300054114 Bacteria 2330
266 Ga0501084_0606626 3300054114 Unclassified 925
267 Ga0501082_0066385 3300060353 Bacteria 3107
268 Ga0501082_0533592 3300060353 Unclassified 1026
269 Ga0466962_0000202 3300061719 Bacteria 24851
270 Ga0466962_0006736 3300061719 Bacteria 5508
271 Ga0466962_0126603 3300061719 Bacteria 1233
272 Ga0466962_0263226 3300061719 Bacteria 849
273 Ga0530510_0010977 3300061734 Bacteria 6353
274 Ga0530510_0024474 3300061734 Bacteria 4309
275 Ga0530510_0156557 3300061734 Bacteria 1684
276 Ga0530510_0168068 3300061734 Bacteria 1624
277 Ga0530510_0282018 3300061734 Bacteria 1241
278 Ga0068868_100483662
279 Ga0070658_10271116
280 Ga0070690_100256497
281 Ga0070670_100010961
282 Ga0070670_100149160
283 Ga0068869_100028845
284 Ga0070668_100119649
285 Ga0070675_100022598
286 Ga0070671_100324296
287 Ga0070674_100007099
288 Ga0070674_100080525
289 Ga0070673_100986497
290 Ga0070688_100235723
291 Ga0070703_10201841
292 Ga0070709_10008237
293 Ga0070709_10224699
294 Ga0070714_100089188
295 Ga0070713_100452218
296 Ga0070701_10007280
297 Ga0070711_100077289
298 Ga0070700_100186327
299 Ga0070678_100564769
300 Ga0070685_10004486
301 Ga0070707_100326202
302 Ga0070707_100506716
303 Ga0070698_100379600
304 Ga0070679_100426915
305 Ga0070684_100027975
306 Ga0070697_100215544
307 Ga0070686_100066153
308 Ga0070704_100146166
309 Ga0068857_100028623
310 Ga0068857_100563724
311 Ga0070702_100008854
312 Ga0068859_100066876
313 Ga0068864_100569580
314 Ga0068870_10001168
315 Ga0068870_10058216
316 Ga0068870_10236901
317 Ga0068870_10592645
318 Ga0070717_10011128
319 Ga0070715_10001649
320 Ga0070716_100026002
321 Ga0075367_10313061
322 Ga0075428_100520086
323 Ga0075428_100534387
324 Ga0075431_100106015
325 Ga0075431_100214560
326 Ga0075433_10023009
327 Ga0075434_100051677
328 Ga0068865_100030449
329 Ga0068865_100876534
330 Ga0075436_100180200
331 Ga0097620_100066874
332 Ga0075435_100001565
333 Ga0111539_10123327
334 Ga0111539_10129872
335 Ga0111539_11257161
336 Ga0105245_10490893
337 Ga0105245_10565112
338 Ga0114129_10004863
339 Ga0114129_10032771
340 Ga0114129_10636562
341 Ga0114129_10848802
342 Ga0105248_10130904
343 Ga0105249_10669032
344 Ga0105246_10060855
345 Ga0157369_10404871
346 Ga0157375_10116013
347 Ga0163163_10003920
348 Ga0163163_10380210
349 Ga0157380_10247631
350 Ga0206356_10985988
351 Ga0206353_11033259
352 Ga0207642_10123344
353 Ga0207688_10004541
354 Ga0207643_10004333
355 Ga0207643_10067806
356 Ga0207643_10577552
357 Ga0207705_10324129
358 Ga0207707_10283090
359 Ga0207693_10013870
360 Ga0207660_10405093
361 Ga0207662_10014064
362 Ga0207657_10002645
363 Ga0207649_10114507
364 Ga0207650_10083477
365 Ga0207650_10097386
366 Ga0207687_10061981
367 Ga0207687_10427218
368 Ga0207700_10061488
369 Ga0207700_10087111
370 Ga0207700_10261492
371 Ga0207664_10021463
372 Ga0207664_10684511
373 Ga0207644_10552759
374 Ga0207706_10200622
375 Ga0207709_10077498
376 Ga0207669_10142159
377 Ga0207669_10343381
378 Ga0207704_10188754
379 Ga0207665_10009744
380 Ga0207691_10018370
381 Ga0207689_10229607
382 Ga0207661_10019656
383 Ga0207667_10182441
384 Ga0207651_10779029
385 Ga0207668_10181696
386 Ga0207677_10140930
387 Ga0207677_10533641
388 Ga0207708_10037357
389 Ga0207708_10681831
390 Ga0207648_10070223
391 Ga0207676_10838706
392 Ga0207674_10115972
393 Ga0207674_10392371
394 Ga0207683_10106938
395 Ga0207683_10601391
396 Ga0207428_10090918
397 Ga0268266_10381303
398 Ga0265334_10038726
399 Ga0265338_10038662
400 Ga0265338_10069866
401 Ga0265338_10135360
402 Ga0265338_10292187
403 Ga0265320_10159989
404 Ga0265340_10041344
405 Ga0265327_10017098
406 Ga0265327_10210865
407 Ga0265316_10013578
408 Ga0265316_10551377
409 Ga0307408_100524764
410 Ga0265342_10156934
411 Ga0307407_10043388
412 Ga0307409_100132010
413 Ga0307416_100177274
414 Ga0307416_100197643
415 Ga0307415_100090843
416 Ga0307415_100333111
417 Ga0373958_0047717
418 Ga0373951_0033314
419 Ga0373937_0008365
420 Ga0395899_0010144
421 Ga0395899_0046472
422 Ga0395900_0044177
423 Ga0395900_0046184
424 Ga0395900_0301285
425 Ga0395898_0013089
426 Ga0395898_0094360
427 Ga0395901_0007603
428 Ga0439438_061587
429 Ga0439453_0001537
430 Ga0451789_1043840
431 Ga0439432_058983
432 Ga0439446_0006581
433 Ga0439434_0002894
434 Ga0466966_0032815
435 Ga0466963_0004472
436 Ga0466963_0015854
437 Ga0466963_0020320
438 Ga0466964_0014272
439 Ga0466964_0014681
440 Ga0466964_0083016
441 Ga0466971_0003249
442 Ga0466971_0005391
443 Ga0466971_0006854
444 Ga0466971_0256373
445 Ga0466968_0096943
446 Ga0466968_0110303
447 Ga0466970_0014625
448 Ga0466957_0015758
449 Ga0466957_0016421
450 Ga0466957_0016738
451 Ga0466957_0022469
452 Ga0466957_0411785
453 Ga0466959_0002698
454 Ga0466959_0018667
455 Ga0466959_0282832
456 Ga0451576_0592937
457 Ga0466958_0004595
458 Ga0466958_0074808
459 Ga0466958_0520018
460 Ga0466967_0012551
461 Ga0466967_0031549
462 Ga0466967_0054546
463 Ga0495608_0348613
464 Ga0495630_0002880
465 Ga0495587_0321155
466 Ga0495657_0192455
467 Ga0495670_0153545
468 Ga0495670_0284556
469 Ga0495589_0301129
470 Ga0495604_0368763
471 Ga0495636_0098744
472 Ga0496101_0049123
473 Ga0496101_1363982
474 Ga0496102_0018759
475 Ga0496102_0028034
476 Ga0496102_0257940
477 Ga0496104_0775617
478 Ga0496105_0177854
479 Ga0496106_0007776
480 Ga0496107_0119199
481 Ga0496108_0027141
482 Ga0496108_0031696
483 Ga0496108_0273154
484 Ga0496109_0001202
485 Ga0496109_0003436
486 Ga0496109_0136233
487 Ga0496110_0040521
488 Ga0496110_0077831
489 Ga0496111_0010736
490 Ga0496111_0074854
491 Ga0496111_0190861
492 Ga0496112_0004011
493 Ga0496112_0105106
494 Ga0496112_0109075
495 Ga0496112_0554226
496 Ga0496113_0036564
497 Ga0496114_0045440
498 Ga0496115_0075761
499 Ga0501031_0382911
500 Ga0501038_0501990
501 Ga0501040_0001516
502 Ga0501040_0338186
503 Ga0501041_0258468
504 Ga0501042_0003076
505 Ga0501042_0230907
506 Ga0501042_0401515
507 Ga0501043_0083457
508 Ga0501046_0023719
509 Ga0501048_0001067
510 Ga0501067_0045142
511 Ga0501067_0136618
512 Ga0501068_0210914
513 Ga0501069_0106068
514 Ga0501071_0003147
515 Ga0501072_0002382
516 Ga0501073_0459922
517 Ga0501075_0010274
518 Ga0501075_0214231
519 Ga0501076_0037245
520 Ga0501080_0292173
521 Ga0501081_0158359
522 Ga0501035_0149124
523 nmdc:mga06z11_350644_c1
524 nmdc:mga05p37_111348_c1
525 nmdc:mga05p37_204751_c1
526 nmdc:mga05p37_232209_c1
527 nmdc:mga0qj67_467174_c1
528 nmdc:mga06r32_107435_c1
529 nmdc:mga06r32_136012_c1
530 nmdc:mga06r32_683909_c1
531 nmdc:mga08y16_293305_c1
532 nmdc:mga08y16_488214_c1
533 nmdc:mga08y16_65229_c1
534 nmdc:mga0rr50_431444_c1
535 nmdc:mga08x19_127549_c1
536 nmdc:mga08x19_151514_c1
537 nmdc:mga0a205_5892_c1
538 Ga0495595_0354352
539 Ga0495619_0229577
540 Ga0501084_0006177
541 Ga0501084_0036614
542 Ga0501084_0108705
543 Ga0501084_0606626
544 Ga0501082_0066385
545 Ga0501082_0533592
546 Ga0466962_0000202
547 Ga0466962_0006736
548 Ga0466962_0126603
549 Ga0466962_0263226
550 Ga0530510_0010977
551 Ga0530510_0024474
552 Ga0530510_0156557
553 Ga0530510_0168068
554 Ga0530510_0282018

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00132

Hexapep

Bacterial transferase hexapeptide (six repeats)

101

136

0.95

PF14602

Hexapep_2

Hexapeptide repeat of succinyl-transferase

103

136

0.91

Map