F381528

General Info

Members Datasets Scaffolds Average Seq Length
277 191 278 76

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10058930|rootH1_100589302
Length 89
Sequence MPVIQVKVKPNARQSLLEPAGDGTWLAQLKSPPIDGKANTELIALIARHFGCAKSAVTIRSGASGRTKLVHVAAAETQEPPRPVRERTK

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
116 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
117 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
129 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
142 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
143 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
144 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
149 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
150 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
153 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
154 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
155 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
162 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
167 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
168 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
169 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
170 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
171 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
175 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
176 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
177 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
182 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
183 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
184 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
185 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
186 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
187 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
188 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
189 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.19
Nodule 0
Rhizoplane 0
Rhizosphere 71.84
Stem 0
Stem Tuber 0
Unclassified 3.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10058930 3300003316 Bacteria 1521
2 rootH1_10058930 3300003323 Bacteria 5501
3 rootL2_10044705 3300003322 Bacteria 3459
4 Ga0065707_10860707 3300005295 Unclassified 579
5 Ga0070658_11718596 3300005327 Unclassified 543
6 Ga0068869_100072884 3300005334 Bacteria 2545
7 Ga0068869_100541246 3300005334 Unclassified 977
8 Ga0070689_100850078 3300005340 Bacteria 805
9 Ga0070687_100572067 3300005343 Bacteria 772
10 Ga0070692_10424370 3300005345 Bacteria 845
11 Ga0070675_101786376 3300005354 Bacteria 567
12 Ga0070674_100845062 3300005356 Bacteria 794
13 Ga0070674_102081957 3300005356 Bacteria 517
14 Ga0070673_100075977 3300005364 Bacteria 2711
15 Ga0070688_100734963 3300005365 Bacteria 767
16 Ga0070667_100112213 3300005367 Bacteria 2365
17 Ga0070705_100122018 3300005440 Bacteria 1684
18 Ga0070705_101021464 3300005440 Bacteria 672
19 Ga0070694_100372019 3300005444 Bacteria 1112
20 Ga0070663_100040669 3300005455 Bacteria 3257
21 Ga0070662_100048909 3300005457 Bacteria 3048
22 Ga0070681_10003116 3300005458 Bacteria 15401
23 Ga0068867_102387896 3300005459 Bacteria 503
24 Ga0070706_100001321 3300005467 Bacteria 26375
25 Ga0070706_101522111 3300005467 Bacteria 611
26 Ga0070698_100012106 3300005471 Bacteria 9144
27 Ga0070699_100146456 3300005518 Bacteria 2087
28 Ga0070699_100257637 3300005518 Bacteria 1560
29 Ga0070679_100709212 3300005530 Bacteria 949
30 Ga0070672_101754567 3300005543 Bacteria 558
31 Ga0070672_101771224 3300005543 Bacteria 555
32 Ga0070695_100131709 3300005545 Bacteria 1724
33 Ga0070693_100000328 3300005547 Bacteria 21805
34 Ga0070704_100024240 3300005549 Bacteria 3979
35 Ga0070704_100325535 3300005549 Bacteria 1289
36 Ga0068855_100984806 3300005563 Unclassified 887
37 Ga0068857_100118510 3300005577 Bacteria 2382
38 Ga0068854_100559210 3300005578 Bacteria 971
39 Ga0068856_101434855 3300005614 Bacteria 704
40 Ga0068852_100113927 3300005616 Bacteria 2463
41 Ga0068859_100002322 3300005617 Bacteria 19325
42 Ga0068859_101631825 3300005617 Bacteria 712
43 Ga0068861_100152102 3300005719 Bacteria 1900
44 Ga0068861_100285037 3300005719 Bacteria 1424
45 Ga0068870_10337103 3300005840 Bacteria 963
46 Ga0068863_101577315 3300005841 Bacteria 665
47 Ga0068858_100051329 3300005842 Bacteria 3815
48 Ga0068858_102165488 3300005842 Bacteria 550
49 Ga0068860_101010577 3300005843 Bacteria 850
50 Ga0068860_102361833 3300005843 Bacteria 552
51 Ga0068862_100441591 3300005844 Bacteria 1225
52 Ga0068862_100486982 3300005844 Bacteria 1168
53 Ga0075365_10584383 3300006038 Unclassified 790
54 Ga0075368_10289301 3300006042 Bacteria 705
55 Ga0075363_100011486 3300006048 Bacteria 4242
56 Ga0075363_100349769 3300006048 Bacteria 863
57 Ga0075364_10322441 3300006051 Unclassified 1052
58 Ga0075364_11031752 3300006051 Bacteria 559
59 Ga0075362_10020687 3300006177 Bacteria 2752
60 Ga0075362_10172145 3300006177 Bacteria 1047
61 Ga0075362_10305942 3300006177 Bacteria 789
62 Ga0075367_10003340 3300006178 Bacteria 7625
63 Ga0075367_10125882 3300006178 Bacteria 1581
64 Ga0075367_10162735 3300006178 Bacteria 1388
65 Ga0075369_10012962 3300006186 Bacteria 3299
66 Ga0075369_10068668 3300006186 Unclassified 1558
67 Ga0075366_10004870 3300006195 Bacteria 7242
68 Ga0075366_10008460 3300006195 Bacteria 5723
69 Ga0075366_10070859 3300006195 Bacteria 2077
70 Ga0075366_10101992 3300006195 Bacteria 1722
71 Ga0075366_10127633 3300006195 Bacteria 1534
72 Ga0075366_10235422 3300006195 Bacteria 1116
73 Ga0075366_10428356 3300006195 Unclassified 815
74 Ga0075366_10428369 3300006195 Unclassified 815
75 Ga0075370_10002789 3300006353 Bacteria 8190
76 Ga0075370_10012223 3300006353 Bacteria 4531
77 Ga0075370_10020391 3300006353 Bacteria 3622
78 Ga0075370_10027526 3300006353 Bacteria 3155
79 Ga0075370_10074024 3300006353 Bacteria 1952
80 Ga0075370_10901477 3300006353 Bacteria 540
81 Ga0075370_10904767 3300006353 Bacteria 539
82 Ga0075431_100591504 3300006847 Bacteria 1094
83 Ga0097620_101631461 3300006931 Bacteria 712
84 Ga0105240_10130469 3300009093 Bacteria 3015
85 Ga0105240_10715810 3300009093 Bacteria 1091
86 Ga0111539_10076924 3300009094 Bacteria 3929
87 Ga0105245_10247432 3300009098 Bacteria 1731
88 Ga0114129_11613052 3300009147 Bacteria 794
89 Ga0114129_12314902 3300009147 Bacteria 645
90 Ga0105243_10024169 3300009148 Bacteria 4634
91 Ga0105241_11109595 3300009174 Bacteria 745
92 Ga0105242_10541552 3300009176 Bacteria 1114
93 Ga0105237_10057642 3300009545 Bacteria 3887
94 Ga0105249_10064454 3300009553 Bacteria 3369
95 Ga0105239_10040126 3300010375 Bacteria 5129
96 Ga0157370_10469499 3300013104 Bacteria 1156
97 Ga0157378_10970084 3300013297 Bacteria 883
98 Ga0157378_11648720 3300013297 Bacteria 688
99 Ga0157378_12121008 3300013297 Bacteria 613
100 Ga0157372_10129039 3300013307 Unclassified 2908
101 Ga0163163_10004692 3300014325 Bacteria 11702
102 Ga0182008_10280358 3300014497 Bacteria 867
103 Ga0157377_11200393 3300014745 Bacteria 587
104 Ga0157379_10233981 3300014968 Bacteria 1666
105 Ga0207645_10091588 3300025907 Bacteria 1955
106 Ga0207643_10213078 3300025908 Bacteria 1180
107 Ga0207705_11308633 3300025909 Unclassified 553
108 Ga0207684_10008620 3300025910 Bacteria 9060
109 Ga0207654_11370316 3300025911 Bacteria 516
110 Ga0207707_10000036 3300025912 Bacteria 146159
111 Ga0207695_10167703 3300025913 Bacteria 2123
112 Ga0207695_11331021 3300025913 Unclassified 599
113 Ga0207671_10337478 3300025914 Unclassified 1194
114 Ga0207657_10537726 3300025919 Bacteria 914
115 Ga0207657_10755797 3300025919 Unclassified 753
116 Ga0207652_10534188 3300025921 Bacteria 1055
117 Ga0207687_10401813 3300025927 Unclassified 1127
118 Ga0207706_10140717 3300025933 Bacteria 2123
119 Ga0207686_10511301 3300025934 Bacteria 933
120 Ga0207709_10299050 3300025935 Bacteria 1196
121 Ga0207709_10625375 3300025935 Unclassified 855
122 Ga0207670_10658958 3300025936 Bacteria 864
123 Ga0207669_10303887 3300025937 Bacteria 1214
124 Ga0207691_11024241 3300025940 Bacteria 688
125 Ga0207689_10055677 3300025942 Bacteria 3255
126 Ga0207667_10157990 3300025949 Bacteria 2333
127 Ga0207667_10870293 3300025949 Unclassified 894
128 Ga0207651_10802858 3300025960 Unclassified 834
129 Ga0207712_10549401 3300025961 Bacteria 993
130 Ga0207712_10907068 3300025961 Unclassified 779
131 Ga0207640_10203493 3300025981 Bacteria 1502
132 Ga0207677_10320816 3300026023 Bacteria 1287
133 Ga0207703_10012838 3300026035 Bacteria 6532
134 Ga0207639_10143158 3300026041 Bacteria 1994
135 Ga0207678_10364652 3300026067 Unclassified 1247
136 Ga0207641_12288437 3300026088 Bacteria 540
137 Ga0207648_10121092 3300026089 Bacteria 2301
138 Ga0207674_10536369 3300026116 Bacteria 1130
139 Ga0207674_11042374 3300026116 Bacteria 787
140 Ga0207675_100151147 3300026118 Bacteria 2210
141 Ga0207675_100422495 3300026118 Bacteria 1317
142 Ga0207698_10256038 3300026142 Bacteria 1605
143 Ga0207698_10273153 3300026142 Unclassified 1559
144 Ga0268266_10179660 3300028379 Bacteria 1926
145 Ga0268265_10223492 3300028380 Bacteria 1649
146 Ga0268264_10879234 3300028381 Bacteria 898
147 Ga0307517_10101294 3300028786 Bacteria 2268
148 Ga0307517_10117953 3300028786 Bacteria 1978
149 Ga0307513_10493368 3300031456 Bacteria 943
150 Ga0307509_10981971 3300031507 Unclassified 511
151 Ga0307408_100247247 3300031548 Bacteria 1469
152 Ga0307508_10261503 3300031616 Bacteria 1325
153 Ga0265314_10112472 3300031711 Bacteria 1728
154 Ga0307516_10022871 3300031730 Bacteria 6415
155 Ga0307516_10040491 3300031730 Bacteria 4638
156 Ga0307406_10396945 3300031901 Bacteria 1092
157 Ga0307407_10853389 3300031903 Bacteria 696
158 Ga0307412_10046308 3300031911 Bacteria 2849
159 Ga0307416_100344977 3300032002 Bacteria 1504
160 Ga0307416_101142444 3300032002 Bacteria 884
161 Ga0307416_101524919 3300032002 Bacteria 774
162 Ga0307411_10448083 3300032005 Bacteria 1079
163 Ga0307411_10502015 3300032005 Unclassified 1026
164 Ga0307415_100343334 3300032126 Bacteria 1254
165 Ga0307510_10533222 3300033180 Unclassified 619
166 Ga0373958_0117271 3300034819 Bacteria 640
167 Ga0373940_0227984 3300035088 Bacteria 621
168 Ga0373956_0401911 3300035119 Unclassified 653
169 Ga0373955_0000731 3300035172 Bacteria 14077
170 Ga0373924_0001831 3300035410 Bacteria 7030
171 Ga0451837_1331984 3300041494 Unclassified 514
172 Ga0453684_0018326 3300044712 Bacteria 10759
173 Ga0451576_0296205 3300045051 Bacteria 1691
174 Ga0495617_052765 3300046452 Bacteria 1351
175 Ga0495617_140636 3300046452 Bacteria 771
176 Ga0495592_0010622 3300046454 Bacteria 6943
177 Ga0495590_0016077 3300046457 Bacteria 2706
178 Ga0495610_0088163 3300046512 Bacteria 1411
179 Ga0495620_0088133 3300046515 Bacteria 1248
180 Ga0495631_0054785 3300046518 Bacteria 1738
181 Ga0495632_0003106 3300046519 Bacteria 12035
182 Ga0495643_0293728 3300046522 Bacteria 743
183 Ga0495648_0481265 3300046524 Bacteria 536
184 Ga0495654_0222733 3300046530 Bacteria 797
185 Ga0495609_0044876 3300046538 Bacteria 1982
186 Ga0495621_0301603 3300046539 Bacteria 664
187 Ga0495597_0059365 3300046542 Bacteria 1670
188 Ga0495597_0187811 3300046542 Bacteria 832
189 Ga0495597_0340378 3300046542 Bacteria 577
190 Ga0495668_0052296 3300046616 Bacteria 2260
191 Ga0495668_0529342 3300046616 Bacteria 650
192 Ga0495668_0837383 3300046616 Unclassified 510
193 Ga0495611_0067112 3300046648 Bacteria 1637
194 Ga0495625_0023869 3300046660 Bacteria 4665
195 Ga0495625_0126653 3300046660 Bacteria 1733
196 Ga0495625_0615766 3300046660 Bacteria 650
197 Ga0495657_0303487 3300046675 Bacteria 952
198 Ga0495623_0105800 3300046679 Bacteria 1710
199 Ga0495670_0382018 3300046691 Bacteria 760
200 Ga0495671_0099721 3300046692 Bacteria 1420
201 Ga0495671_0264779 3300046692 Bacteria 829
202 Ga0495649_0008052 3300046694 Bacteria 6366
203 Ga0495600_0689431 3300046809 Unclassified 615
204 Ga0495660_0043232 3300046810 Bacteria 2486
205 Ga0495674_0260796 3300047319 Bacteria 1424
206 Ga0495683_0396821 3300047323 Bacteria 574
207 Ga0495687_001446 3300047443 Bacteria 21795
208 Ga0495687_005402 3300047443 Bacteria 8157
209 Ga0495673_0220478 3300047469 Bacteria 702
210 Ga0495686_0001644 3300047472 Bacteria 23312
211 Ga0495626_0068743 3300048091 Bacteria 1597
212 Ga0495626_0205376 3300048091 Bacteria 806
213 Ga0495626_0395001 3300048091 Bacteria 535
214 Ga0501291_001298 3300049514 Bacteria 2887
215 Ga0501299_027937 3300049522 Bacteria 1073
216 Ga0501300_005280 3300049523 Bacteria 1909
217 Ga0501046_1202683 3300049580 Unclassified 521
218 Ga0501047_0454330 3300049581 Bacteria 1110
219 Ga0501047_0576810 3300049581 Bacteria 948
220 Ga0501047_0888408 3300049581 Bacteria 705
221 Ga0501047_1007559 3300049581 Bacteria 646
222 Ga0501070_0245288 3300049586 Bacteria 1466
223 Ga0501075_0310419 3300049591 Bacteria 1202
224 Ga0501076_0874788 3300049592 Unclassified 741
225 Ga0501077_0116942 3300049593 Bacteria 1690
226 Ga0501216_078455 3300049660 Bacteria 695
227 Ga0501080_0071488 3300049742 Bacteria 3227
228 Ga0501081_1378669 3300049743 Bacteria 535
229 Ga0501083_0022168 3300049744 Bacteria 4408
230 Ga0501268_072343 3300049765 Bacteria 700
231 Ga0501279_083042 3300049775 Bacteria 555
232 Ga0501283_020851 3300049779 Bacteria 1047
233 Ga0501212_055515 3300049851 Bacteria 677
234 nmdc:mga03683_155105_c1 3300050489 Unclassified 1035
235 nmdc:mga03683_3760_c2 3300050489 Bacteria 2804
236 nmdc:mga03683_702006_c1 3300050489 Bacteria 501
237 nmdc:mga03n38_3563_c1 3300050490 Bacteria 5026
238 nmdc:mga03n38_373345_c1 3300050490 Bacteria 780
239 nmdc:mga00v17_414353_c1 3300050491 Bacteria 875
240 nmdc:mga00v17_541653_c1 3300050491 Bacteria 753
241 nmdc:mga0yw44_880333_c1 3300050492 Bacteria 607
242 nmdc:mga0k408_154277_c1 3300050493 Bacteria 1368
243 nmdc:mga0k408_3106_c1 3300050493 Bacteria 8801
244 nmdc:mga0k408_37920_c1 3300050493 Bacteria 2767
245 nmdc:mga0k408_404614_c1 3300050493 Bacteria 812
246 nmdc:mga0k408_404742_c1 3300050493 Unclassified 812
247 nmdc:mga0k408_52028_c1 3300050493 Bacteria 2373
248 nmdc:mga0k408_525189_c1 3300050493 Bacteria 701
249 nmdc:mga0k408_671109_c1 3300050493 Bacteria 609
250 nmdc:mga0k408_841766_c1 3300050493 Bacteria 534
251 nmdc:mga06z11_113893_c1 3300050494 Bacteria 1501
252 nmdc:mga06z11_11937_c1 3300050494 Bacteria 2903
253 nmdc:mga06z11_405409_c1 3300050494 Bacteria 821
254 nmdc:mga04h51_224454_c1 3300050495 Bacteria 745
255 nmdc:mga07m45_112230_c1 3300050496 Unclassified 1571
256 nmdc:mga07m45_1462_c1 3300050496 Bacteria 10840
257 nmdc:mga07m45_184368_c2 3300050496 Bacteria 589
258 nmdc:mga07m45_218816_c1 3300050496 Bacteria 1108
259 nmdc:mga07m45_286691_c1 3300050496 Bacteria 958
260 nmdc:mga07m45_31227_c1 3300050496 Bacteria 2952
261 nmdc:mga06r32_581741_c1 3300050510 Bacteria 1092
262 nmdc:mga08y16_218904_c1 3300050511 Bacteria 1971
263 nmdc:mga0rr50_1423920_c1 3300050513 Bacteria 586
264 nmdc:mga0rr50_900286_c1 3300050513 Bacteria 754
265 nmdc:mga0sz30_42222_c2 3300050516 Bacteria 989
266 nmdc:mga0sz30_6858_c1 3300050516 Bacteria 4251
267 Ga0495655_0068932 3300053083 Bacteria 984
268 Ga0500578_0572441 3300053086 Bacteria 625
269 Ga0500644_0256992 3300053088 Unclassified 738
270 Ga0500651_0140512 3300053093 Unclassified 1456
271 Ga0500651_0359938 3300053093 Bacteria 824
272 Ga0500594_0002929 3300053118 Bacteria 3728
273 Ga0500594_0007088 3300053118 Bacteria 2531
274 Ga0500658_0002629 3300053134 Bacteria 6916
275 Ga0500568_0025639 3300053139 Bacteria 2484
276 Ga0500622_0007705 3300053156 Bacteria 6082
277 Ga0501084_0304139 3300054114 Bacteria 1347
278 Ga0530510_0247883 3300061734 Bacteria 1327

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005295 Ga0065707_10860707 Ga0065707_108607071 72
2 3300005343 Ga0070687_100572067 Ga0070687_1005720672 72
3 3300005345 Ga0070692_10424370 Ga0070692_104243702 72
4 3300005440 Ga0070705_100122018 Ga0070705_1001220184 72
5 3300005617 Ga0068859_100002322 Ga0068859_10000232222 72
6 3300005841 Ga0068863_101577315 Ga0068863_1015773152 72
7 3300009094 Ga0111539_10076924 Ga0111539_100769245 72
8 3300009553 Ga0105249_10064454 Ga0105249_100644543 72
9 3300026088 Ga0207641_12288437 Ga0207641_122884372 72
10 3300050511 nmdc:mga08y16_218904_c1 nmdc:mga08y16_218904_c1_728_946 72
11 3300050513 nmdc:mga0rr50_1423920_c1 nmdc:mga0rr50_1423920_c1_59_277 72
12 3300031711 Ga0265314_10112472 Ga0265314_101124723 73
13 3300049581 Ga0501047_0888408 Ga0501047_0888408_85_306 73
14 3300005327 Ga0070658_11718596 Ga0070658_117185962 74
15 3300005356 Ga0070674_102081957 Ga0070674_1020819571 74
16 3300005458 Ga0070681_10003116 Ga0070681_1000311611 74
17 3300005530 Ga0070679_100709212 Ga0070679_1007092122 74
18 3300005543 Ga0070672_101754567 Ga0070672_1017545672 74
19 3300005547 Ga0070693_100000328 Ga0070693_1000003288 74
20 3300006195 Ga0075366_10235422 Ga0075366_102354222 74
21 3300006353 Ga0075370_10012223 Ga0075370_100122234 74
22 3300006847 Ga0075431_100591504 Ga0075431_1005915042 74
23 3300009147 Ga0114129_11613052 Ga0114129_116130522 74
24 3300025909 Ga0207705_11308633 Ga0207705_113086332 74
25 3300025912 Ga0207707_10000036 Ga0207707_1000003694 74
26 3300025921 Ga0207652_10534188 Ga0207652_105341882 74
27 3300031507 Ga0307509_10981971 Ga0307509_109819711 74
28 3300031548 Ga0307408_100247247 Ga0307408_1002472472 74
29 3300031901 Ga0307406_10396945 Ga0307406_103969452 74
30 3300031911 Ga0307412_10046308 Ga0307412_100463083 74
31 3300032002 Ga0307416_100344977 Ga0307416_1003449772 74
32 3300032005 Ga0307411_10502015 Ga0307411_105020152 74
33 3300032126 Ga0307415_100343334 Ga0307415_1003433342 74
34 3300035119 Ga0373956_0401911 Ga0373956_0401911_256_486 74
35 3300035172 Ga0373955_0000731 Ga0373955_0000731_916_1146 74
36 3300035410 Ga0373924_0001831 Ga0373924_0001831_3928_4158 74
37 3300046675 Ga0495657_0303487 Ga0495657_0303487_490_720 74
38 3300046679 Ga0495623_0105800 Ga0495623_0105800_886_1116 74
39 3300046809 Ga0495600_0689431 Ga0495600_0689431_256_486 74
40 3300047319 Ga0495674_0260796 Ga0495674_0260796_40_270 74
41 3300049743 Ga0501081_1378669 Ga0501081_1378669_248_478 74
42 3300050493 nmdc:mga0k408_404614_c1 nmdc:mga0k408_404614_c1_385_615 74
43 3300050493 nmdc:mga0k408_404742_c1 nmdc:mga0k408_404742_c1_344_568 74
44 3300050496 nmdc:mga07m45_112230_c1 nmdc:mga07m45_112230_c1_45_269 74
45 3300050510 nmdc:mga06r32_581741_c1 nmdc:mga06r32_581741_c1_646_876 74
46 3300053088 Ga0500644_0256992 Ga0500644_0256992_94_324 74
47 3300053093 Ga0500651_0140512 Ga0500651_0140512_783_1013 74
48 3300053118 Ga0500594_0002929 Ga0500594_0002929_3312_3542 74
49 3300053156 Ga0500622_0007705 Ga0500622_0007705_2379_2609 74
50 3300005334 Ga0068869_100072884 Ga0068869_1000728844 75
51 3300005334 Ga0068869_100541246 Ga0068869_1005412461 75
52 3300005340 Ga0070689_100850078 Ga0070689_1008500781 75
53 3300005356 Ga0070674_100845062 Ga0070674_1008450622 75
54 3300005364 Ga0070673_100075977 Ga0070673_1000759775 75
55 3300005365 Ga0070688_100734963 Ga0070688_1007349632 75
56 3300005367 Ga0070667_100112213 Ga0070667_1001122132 75
57 3300005440 Ga0070705_101021464 Ga0070705_1010214642 75
58 3300005444 Ga0070694_100372019 Ga0070694_1003720192 75
59 3300005455 Ga0070663_100040669 Ga0070663_1000406695 75
60 3300005457 Ga0070662_100048909 Ga0070662_1000489094 75
61 3300005459 Ga0068867_102387896 Ga0068867_1023878961 75
62 3300005467 Ga0070706_100001321 Ga0070706_10000132123 75
63 3300005467 Ga0070706_101522111 Ga0070706_1015221111 75
64 3300005471 Ga0070698_100012106 Ga0070698_10001210610 75
65 3300005518 Ga0070699_100146456 Ga0070699_1001464562 75
66 3300005518 Ga0070699_100257637 Ga0070699_1002576374 75
67 3300005543 Ga0070672_101771224 Ga0070672_1017712242 75
68 3300005545 Ga0070695_100131709 Ga0070695_1001317093 75
69 3300005549 Ga0070704_100024240 Ga0070704_1000242405 75
70 3300005549 Ga0070704_100325535 Ga0070704_1003255353 75
71 3300005563 Ga0068855_100984806 Ga0068855_1009848061 75
72 3300005577 Ga0068857_100118510 Ga0068857_1001185101 75
73 3300005578 Ga0068854_100559210 Ga0068854_1005592103 75
74 3300005614 Ga0068856_101434855 Ga0068856_1014348552 75
75 3300005616 Ga0068852_100113927 Ga0068852_1001139272 75
76 3300005617 Ga0068859_101631825 Ga0068859_1016318252 75
77 3300005719 Ga0068861_100152102 Ga0068861_1001521024 75
78 3300005840 Ga0068870_10337103 Ga0068870_103371033 75
79 3300005842 Ga0068858_100051329 Ga0068858_1000513294 75
80 3300005842 Ga0068858_102165488 Ga0068858_1021654882 75
81 3300005843 Ga0068860_101010577 Ga0068860_1010105772 75
82 3300005843 Ga0068860_102361833 Ga0068860_1023618332 75
83 3300005844 Ga0068862_100441591 Ga0068862_1004415912 75
84 3300006038 Ga0075365_10584383 Ga0075365_105843833 75
85 3300006042 Ga0075368_10289301 Ga0075368_102893012 75
86 3300006048 Ga0075363_100011486 Ga0075363_1000114867 75
87 3300006048 Ga0075363_100349769 Ga0075363_1003497692 75
88 3300006051 Ga0075364_10322441 Ga0075364_103224413 75
89 3300006051 Ga0075364_11031752 Ga0075364_110317521 75
90 3300006177 Ga0075362_10020687 Ga0075362_100206873 75
91 3300006177 Ga0075362_10172145 Ga0075362_101721451 75
92 3300006177 Ga0075362_10305942 Ga0075362_103059422 75
93 3300006178 Ga0075367_10003340 Ga0075367_1000334010 75
94 3300006178 Ga0075367_10125882 Ga0075367_101258822 75
95 3300006178 Ga0075367_10162735 Ga0075367_101627353 75
96 3300006186 Ga0075369_10012962 Ga0075369_100129629 75
97 3300006186 Ga0075369_10068668 Ga0075369_100686683 75
98 3300006195 Ga0075366_10004870 Ga0075366_100048705 75
99 3300006195 Ga0075366_10008460 Ga0075366_100084602 75
100 3300006195 Ga0075366_10070859 Ga0075366_100708595 75
101 3300006195 Ga0075366_10101992 Ga0075366_101019923 75
102 3300006195 Ga0075366_10127633 Ga0075366_101276332 75
103 3300006195 Ga0075366_10428356 Ga0075366_104283561 75
104 3300006195 Ga0075366_10428369 Ga0075366_104283693 75
105 3300006353 Ga0075370_10002789 Ga0075370_100027899 75
106 3300006353 Ga0075370_10020391 Ga0075370_100203914 75
107 3300006353 Ga0075370_10027526 Ga0075370_100275265 75
108 3300006353 Ga0075370_10074024 Ga0075370_100740243 75
109 3300006353 Ga0075370_10901477 Ga0075370_109014772 75
110 3300006353 Ga0075370_10904767 Ga0075370_109047672 75
111 3300006931 Ga0097620_101631461 Ga0097620_1016314612 75
112 3300009093 Ga0105240_10130469 Ga0105240_101304693 75
113 3300009093 Ga0105240_10715810 Ga0105240_107158103 75
114 3300009098 Ga0105245_10247432 Ga0105245_102474324 75
115 3300009147 Ga0114129_12314902 Ga0114129_123149022 75
116 3300009148 Ga0105243_10024169 Ga0105243_100241694 75
117 3300009174 Ga0105241_11109595 Ga0105241_111095952 75
118 3300009176 Ga0105242_10541552 Ga0105242_105415523 75
119 3300009545 Ga0105237_10057642 Ga0105237_100576424 75
120 3300010375 Ga0105239_10040126 Ga0105239_100401266 75
121 3300013297 Ga0157378_10970084 Ga0157378_109700842 75
122 3300013297 Ga0157378_11648720 Ga0157378_116487202 75
123 3300013297 Ga0157378_12121008 Ga0157378_121210082 75
124 3300014325 Ga0163163_10004692 Ga0163163_1000469211 75
125 3300014497 Ga0182008_10280358 Ga0182008_102803582 75
126 3300014745 Ga0157377_11200393 Ga0157377_112003931 75
127 3300014968 Ga0157379_10233981 Ga0157379_102339815 75
128 3300025907 Ga0207645_10091588 Ga0207645_100915883 75
129 3300025908 Ga0207643_10213078 Ga0207643_102130782 75
130 3300025910 Ga0207684_10008620 Ga0207684_100086208 75
131 3300025911 Ga0207654_11370316 Ga0207654_113703162 75
132 3300025913 Ga0207695_10167703 Ga0207695_101677033 75
133 3300025914 Ga0207671_10337478 Ga0207671_103374784 75
134 3300025919 Ga0207657_10755797 Ga0207657_107557971 75
135 3300025927 Ga0207687_10401813 Ga0207687_104018133 75
136 3300025933 Ga0207706_10140717 Ga0207706_101407174 75
137 3300025934 Ga0207686_10511301 Ga0207686_105113012 75
138 3300025935 Ga0207709_10299050 Ga0207709_102990501 75
139 3300025935 Ga0207709_10625375 Ga0207709_106253751 75
140 3300025936 Ga0207670_10658958 Ga0207670_106589582 75
141 3300025937 Ga0207669_10303887 Ga0207669_103038873 75
142 3300025940 Ga0207691_11024241 Ga0207691_110242412 75
143 3300025942 Ga0207689_10055677 Ga0207689_100556775 75
144 3300025949 Ga0207667_10157990 Ga0207667_101579903 75
145 3300025949 Ga0207667_10870293 Ga0207667_108702931 75
146 3300025960 Ga0207651_10802858 Ga0207651_108028581 75
147 3300025961 Ga0207712_10907068 Ga0207712_109070682 75
148 3300025981 Ga0207640_10203493 Ga0207640_102034933 75
149 3300026023 Ga0207677_10320816 Ga0207677_103208161 75
150 3300026035 Ga0207703_10012838 Ga0207703_100128387 75
151 3300026041 Ga0207639_10143158 Ga0207639_101431583 75
152 3300026067 Ga0207678_10364652 Ga0207678_103646522 75
153 3300026089 Ga0207648_10121092 Ga0207648_101210922 75
154 3300026116 Ga0207674_10536369 Ga0207674_105363692 75
155 3300026116 Ga0207674_11042374 Ga0207674_110423742 75
156 3300026118 Ga0207675_100151147 Ga0207675_1001511475 75
157 3300026142 Ga0207698_10273153 Ga0207698_102731532 75
158 3300028379 Ga0268266_10179660 Ga0268266_101796601 75
159 3300028381 Ga0268264_10879234 Ga0268264_108792342 75
160 3300028786 Ga0307517_10101294 Ga0307517_101012945 75
161 3300028786 Ga0307517_10117953 Ga0307517_101179532 75
162 3300031456 Ga0307513_10493368 Ga0307513_104933681 75
163 3300031616 Ga0307508_10261503 Ga0307508_102615034 75
164 3300031730 Ga0307516_10022871 Ga0307516_100228712 75
165 3300031730 Ga0307516_10040491 Ga0307516_100404912 75
166 3300032002 Ga0307416_101142444 Ga0307416_1011424442 75
167 3300033180 Ga0307510_10533222 Ga0307510_105332221 75
168 3300034819 Ga0373958_0117271 Ga0373958_0117271_71_307 75
169 3300035088 Ga0373940_0227984 Ga0373940_0227984_125_361 75
170 3300045051 Ga0451576_0296205 Ga0451576_0296205_766_1002 75
171 3300046452 Ga0495617_052765 Ga0495617_052765_220_447 75
172 3300046452 Ga0495617_140636 Ga0495617_140636_84_332 75
173 3300046457 Ga0495590_0016077 Ga0495590_0016077_339_566 75
174 3300046512 Ga0495610_0088163 Ga0495610_0088163_745_972 75
175 3300046515 Ga0495620_0088133 Ga0495620_0088133_179_406 75
176 3300046518 Ga0495631_0054785 Ga0495631_0054785_415_642 75
177 3300046519 Ga0495632_0003106 Ga0495632_0003106_7845_8072 75
178 3300046522 Ga0495643_0293728 Ga0495643_0293728_178_405 75
179 3300046524 Ga0495648_0481265 Ga0495648_0481265_159_386 75
180 3300046530 Ga0495654_0222733 Ga0495654_0222733_459_686 75
181 3300046538 Ga0495609_0044876 Ga0495609_0044876_493_720 75
182 3300046539 Ga0495621_0301603 Ga0495621_0301603_208_435 75
183 3300046542 Ga0495597_0059365 Ga0495597_0059365_833_1060 75
184 3300046542 Ga0495597_0187811 Ga0495597_0187811_593_820 75
185 3300046542 Ga0495597_0340378 Ga0495597_0340378_295_522 75
186 3300046616 Ga0495668_0052296 Ga0495668_0052296_1143_1370 75
187 3300046616 Ga0495668_0529342 Ga0495668_0529342_252_479 75
188 3300046616 Ga0495668_0837383 Ga0495668_0837383_94_321 75
189 3300046648 Ga0495611_0067112 Ga0495611_0067112_1355_1603 75
190 3300046660 Ga0495625_0023869 Ga0495625_0023869_2323_2550 75
191 3300046660 Ga0495625_0126653 Ga0495625_0126653_1287_1514 75
192 3300046660 Ga0495625_0615766 Ga0495625_0615766_176_403 75
193 3300046691 Ga0495670_0382018 Ga0495670_0382018_185_433 75
194 3300046692 Ga0495671_0099721 Ga0495671_0099721_12_239 75
195 3300046692 Ga0495671_0264779 Ga0495671_0264779_356_583 75
196 3300046694 Ga0495649_0008052 Ga0495649_0008052_3912_4139 75
197 3300046810 Ga0495660_0043232 Ga0495660_0043232_776_1003 75
198 3300047323 Ga0495683_0396821 Ga0495683_0396821_103_330 75
199 3300047443 Ga0495687_001446 Ga0495687_001446_13844_14071 75
200 3300047443 Ga0495687_005402 Ga0495687_005402_2743_2970 75
201 3300047469 Ga0495673_0220478 Ga0495673_0220478_303_530 75
202 3300047472 Ga0495686_0001644 Ga0495686_0001644_10155_10397 75
203 3300048091 Ga0495626_0068743 Ga0495626_0068743_20_247 75
204 3300048091 Ga0495626_0205376 Ga0495626_0205376_550_777 75
205 3300048091 Ga0495626_0395001 Ga0495626_0395001_118_345 75
206 3300049580 Ga0501046_1202683 Ga0501046_1202683_137_364 75
207 3300049581 Ga0501047_0454330 Ga0501047_0454330_22_258 75
208 3300049581 Ga0501047_0576810 Ga0501047_0576810_35_262 75
209 3300049591 Ga0501075_0310419 Ga0501075_0310419_470_709 75
210 3300049592 Ga0501076_0874788 Ga0501076_0874788_340_579 75
211 3300049593 Ga0501077_0116942 Ga0501077_0116942_384_623 75
212 3300050489 nmdc:mga03683_155105_c1 nmdc:mga03683_155105_c1_787_1014 75
213 3300050489 nmdc:mga03683_3760_c2 nmdc:mga03683_3760_c2_1585_1812 75
214 3300050489 nmdc:mga03683_702006_c1 nmdc:mga03683_702006_c1_116_343 75
215 3300050490 nmdc:mga03n38_3563_c1 nmdc:mga03n38_3563_c1_862_1089 75
216 3300050490 nmdc:mga03n38_373345_c1 nmdc:mga03n38_373345_c1_254_481 75
217 3300050491 nmdc:mga00v17_414353_c1 nmdc:mga00v17_414353_c1_339_566 75
218 3300050491 nmdc:mga00v17_541653_c1 nmdc:mga00v17_541653_c1_236_463 75
219 3300050492 nmdc:mga0yw44_880333_c1 nmdc:mga0yw44_880333_c1_162_389 75
220 3300050493 nmdc:mga0k408_154277_c1 nmdc:mga0k408_154277_c1_1062_1289 75
221 3300050493 nmdc:mga0k408_3106_c1 nmdc:mga0k408_3106_c1_3270_3497 75
222 3300050493 nmdc:mga0k408_37920_c1 nmdc:mga0k408_37920_c1_1840_2067 75
223 3300050493 nmdc:mga0k408_52028_c1 nmdc:mga0k408_52028_c1_1760_1987 75
224 3300050493 nmdc:mga0k408_525189_c1 nmdc:mga0k408_525189_c1_201_428 75
225 3300050493 nmdc:mga0k408_671109_c1 nmdc:mga0k408_671109_c1_279_506 75
226 3300050493 nmdc:mga0k408_841766_c1 nmdc:mga0k408_841766_c1_205_432 75
227 3300050494 nmdc:mga06z11_113893_c1 nmdc:mga06z11_113893_c1_1109_1336 75
228 3300050494 nmdc:mga06z11_11937_c1 nmdc:mga06z11_11937_c1_1537_1764 75
229 3300050494 nmdc:mga06z11_405409_c1 nmdc:mga06z11_405409_c1_560_787 75
230 3300050495 nmdc:mga04h51_224454_c1 nmdc:mga04h51_224454_c1_30_257 75
231 3300050496 nmdc:mga07m45_1462_c1 nmdc:mga07m45_1462_c1_666_893 75
232 3300050496 nmdc:mga07m45_184368_c2 nmdc:mga07m45_184368_c2_69_296 75
233 3300050496 nmdc:mga07m45_218816_c1 nmdc:mga07m45_218816_c1_403_630 75
234 3300050496 nmdc:mga07m45_286691_c1 nmdc:mga07m45_286691_c1_686_913 75
235 3300050496 nmdc:mga07m45_31227_c1 nmdc:mga07m45_31227_c1_275_502 75
236 3300050513 nmdc:mga0rr50_900286_c1 nmdc:mga0rr50_900286_c1_136_372 75
237 3300050516 nmdc:mga0sz30_42222_c2 nmdc:mga0sz30_42222_c2_216_443 75
238 3300050516 nmdc:mga0sz30_6858_c1 nmdc:mga0sz30_6858_c1_1694_1921 75
239 3300053083 Ga0495655_0068932 Ga0495655_0068932_399_626 75
240 3300053086 Ga0500578_0572441 Ga0500578_0572441_67_294 75
241 3300053093 Ga0500651_0359938 Ga0500651_0359938_203_430 75
242 3300053134 Ga0500658_0002629 Ga0500658_0002629_2630_2857 75
243 3300053139 Ga0500568_0025639 Ga0500568_0025639_1927_2175 75
244 3300061734 Ga0530510_0247883 Ga0530510_0247883_416_655 75
245 3300031903 Ga0307407_10853389 Ga0307407_108533892 76
246 3300032002 Ga0307416_101524919 Ga0307416_1015249191 76
247 3300032005 Ga0307411_10448083 Ga0307411_104480832 76
248 3300041494 Ga0451837_1331984 Ga0451837_1331984_227_460 76
249 3300049514 Ga0501291_001298 Ga0501291_001298_1206_1442 76
250 3300049522 Ga0501299_027937 Ga0501299_027937_54_290 76
251 3300049523 Ga0501300_005280 Ga0501300_005280_1547_1783 76
252 3300049660 Ga0501216_078455 Ga0501216_078455_203_439 76
253 3300049765 Ga0501268_072343 Ga0501268_072343_381_617 76
254 3300049775 Ga0501279_083042 Ga0501279_083042_22_258 76
255 3300049779 Ga0501283_020851 Ga0501283_020851_107_343 76
256 3300049851 Ga0501212_055515 Ga0501212_055515_328_564 76
257 3300005354 Ga0070675_101786376 Ga0070675_1017863761 77
258 3300005719 Ga0068861_100285037 Ga0068861_1002850372 77
259 3300005844 Ga0068862_100486982 Ga0068862_1004869823 77
260 3300013104 Ga0157370_10469499 Ga0157370_104694991 77
261 3300013307 Ga0157372_10129039 Ga0157372_101290392 77
262 3300025913 Ga0207695_11331021 Ga0207695_113310211 77
263 3300025961 Ga0207712_10549401 Ga0207712_105494012 77
264 3300026118 Ga0207675_100422495 Ga0207675_1004224952 77
265 3300028380 Ga0268265_10223492 Ga0268265_102234922 77
266 3300049581 Ga0501047_1007559 Ga0501047_1007559_97_342 77
267 3300049586 Ga0501070_0245288 Ga0501070_0245288_77_322 77
268 3300049742 Ga0501080_0071488 Ga0501080_0071488_2210_2455 77
269 3300049744 Ga0501083_0022168 Ga0501083_0022168_522_767 77
270 3300054114 Ga0501084_0304139 Ga0501084_0304139_888_1133 77
271 3300044712 Ga0453684_0018326 Ga0453684_0018326_9086_9328 78
272 3300025919 Ga0207657_10537726 Ga0207657_105377263 83
273 3300026142 Ga0207698_10256038 Ga0207698_102560381 83
274 3300046454 Ga0495592_0010622 Ga0495592_0010622_5905_6162 83
275 3300053118 Ga0500594_0007088 Ga0500594_0007088_2170_2427 83
276 3300003316 rootH1_10058930 rootH1_100589302 89
277 3300003322 rootL2_10044705 rootL2_100447058 89

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02594

DUF167

Uncharacterised ACR, YggU family COG1872

1

73

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n91-assembly1.cif.gz_A solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. 0.8003 3 74
1yh5-assembly1.cif.gz_A solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. 0.7878 3 72
4r8g-assembly1.cif.gz_E crystal structure of myosin-1c tail in complex with calmodulin 0.7814 6 32
6u6r-assembly1.cif.gz_B solution nmr structure of the delta30-ngmine protein from neisseria gonorrheae 0.6992 39 73
8p5d-assembly1.cif.gz_SY0 spraguea lophii ribosome in the closed conformation by cryo sub tomogram averaging 0.692 40 74
ID Description Score Start End Superfamily
af_I1NJE4_134_231_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.9286 3 72 3.30.1200.10
af_P52060_1_96_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.8993 3 74 3.30.1200.10
af_Q09EE9_24_127_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.892 3 76 3.30.1200.10
af_Q8IKR0_45_147_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.8848 3 73 3.30.1200.10
af_Q54UW1_9_121_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.8821 3 78 3.30.1200.10
ID Description Score Start End GO Terms
AF-A0A7V7WVW9-F1-model_v4 UPF0235 protein F9K36_12090 0.9647 3 73 GO:0005737
AF-A0A1M7GYU5-F1-model_v4 UPF0235 protein SAMN05428972_2876 0.9635 3 72 GO:0005737
AF-A0A515DF96-F1-model_v4 UPF0235 protein EUB48_18565 0.9619 3 72 GO:0005737
AF-A0A2W4QYB8-F1-model_v4 UPF0235 protein DIU56_14480 0.9614 1 73 GO:0005737
AF-A0A7X1E328-F1-model_v4 UPF0235 protein H5P30_01825 0.9602 1 74 GO:0005737

Feature Viewer

pLDDT pTM Quality
80.05 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map