F381528
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 277 | 191 | 278 | 76 |
Family's Representative Sequence
| Representative Sequence | 3300003316|rootH1_10058930|rootH1_100589302 |
| Length | 89 |
| Sequence | MPVIQVKVKPNARQSLLEPAGDGTWLAQLKSPPIDGKANTELIALIARHFGCAKSAVTIRSGASGRTKLVHVAAAETQEPPRPVRERTK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 41 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 42 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 43 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 44 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 45 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 46 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 47 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 48 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 66 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 103 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 104 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 105 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 106 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 107 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 109 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 110 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 111 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 112 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 113 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 114 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 115 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 116 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 117 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 118 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 119 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 120 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 121 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 122 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 123 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 124 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 154 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 155 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 156 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 163 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 167 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 168 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 169 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 170 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 171 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 172 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 173 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 174 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 175 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 176 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 177 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 178 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 182 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 184 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 185 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 186 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 187 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 188 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 189 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 190 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.19 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 71.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10058930 | 3300003316 | Bacteria | 1521 |
| 2 | rootH1_10058930 | 3300003323 | Bacteria | 5501 |
| 3 | rootL2_10044705 | 3300003322 | Bacteria | 3459 |
| 4 | Ga0065707_10860707 | 3300005295 | Unclassified | 579 |
| 5 | Ga0070658_11718596 | 3300005327 | Unclassified | 543 |
| 6 | Ga0068869_100072884 | 3300005334 | Bacteria | 2545 |
| 7 | Ga0068869_100541246 | 3300005334 | Unclassified | 977 |
| 8 | Ga0070689_100850078 | 3300005340 | Bacteria | 805 |
| 9 | Ga0070687_100572067 | 3300005343 | Bacteria | 772 |
| 10 | Ga0070692_10424370 | 3300005345 | Bacteria | 845 |
| 11 | Ga0070675_101786376 | 3300005354 | Bacteria | 567 |
| 12 | Ga0070674_100845062 | 3300005356 | Bacteria | 794 |
| 13 | Ga0070674_102081957 | 3300005356 | Bacteria | 517 |
| 14 | Ga0070673_100075977 | 3300005364 | Bacteria | 2711 |
| 15 | Ga0070688_100734963 | 3300005365 | Bacteria | 767 |
| 16 | Ga0070667_100112213 | 3300005367 | Bacteria | 2365 |
| 17 | Ga0070705_100122018 | 3300005440 | Bacteria | 1684 |
| 18 | Ga0070705_101021464 | 3300005440 | Bacteria | 672 |
| 19 | Ga0070694_100372019 | 3300005444 | Bacteria | 1112 |
| 20 | Ga0070663_100040669 | 3300005455 | Bacteria | 3257 |
| 21 | Ga0070662_100048909 | 3300005457 | Bacteria | 3048 |
| 22 | Ga0070681_10003116 | 3300005458 | Bacteria | 15401 |
| 23 | Ga0068867_102387896 | 3300005459 | Bacteria | 503 |
| 24 | Ga0070706_100001321 | 3300005467 | Bacteria | 26375 |
| 25 | Ga0070706_101522111 | 3300005467 | Bacteria | 611 |
| 26 | Ga0070698_100012106 | 3300005471 | Bacteria | 9144 |
| 27 | Ga0070699_100146456 | 3300005518 | Bacteria | 2087 |
| 28 | Ga0070699_100257637 | 3300005518 | Bacteria | 1560 |
| 29 | Ga0070679_100709212 | 3300005530 | Bacteria | 949 |
| 30 | Ga0070672_101754567 | 3300005543 | Bacteria | 558 |
| 31 | Ga0070672_101771224 | 3300005543 | Bacteria | 555 |
| 32 | Ga0070695_100131709 | 3300005545 | Bacteria | 1724 |
| 33 | Ga0070693_100000328 | 3300005547 | Bacteria | 21805 |
| 34 | Ga0070704_100024240 | 3300005549 | Bacteria | 3979 |
| 35 | Ga0070704_100325535 | 3300005549 | Bacteria | 1289 |
| 36 | Ga0068855_100984806 | 3300005563 | Unclassified | 887 |
| 37 | Ga0068857_100118510 | 3300005577 | Bacteria | 2382 |
| 38 | Ga0068854_100559210 | 3300005578 | Bacteria | 971 |
| 39 | Ga0068856_101434855 | 3300005614 | Bacteria | 704 |
| 40 | Ga0068852_100113927 | 3300005616 | Bacteria | 2463 |
| 41 | Ga0068859_100002322 | 3300005617 | Bacteria | 19325 |
| 42 | Ga0068859_101631825 | 3300005617 | Bacteria | 712 |
| 43 | Ga0068861_100152102 | 3300005719 | Bacteria | 1900 |
| 44 | Ga0068861_100285037 | 3300005719 | Bacteria | 1424 |
| 45 | Ga0068870_10337103 | 3300005840 | Bacteria | 963 |
| 46 | Ga0068863_101577315 | 3300005841 | Bacteria | 665 |
| 47 | Ga0068858_100051329 | 3300005842 | Bacteria | 3815 |
| 48 | Ga0068858_102165488 | 3300005842 | Bacteria | 550 |
| 49 | Ga0068860_101010577 | 3300005843 | Bacteria | 850 |
| 50 | Ga0068860_102361833 | 3300005843 | Bacteria | 552 |
| 51 | Ga0068862_100441591 | 3300005844 | Bacteria | 1225 |
| 52 | Ga0068862_100486982 | 3300005844 | Bacteria | 1168 |
| 53 | Ga0075365_10584383 | 3300006038 | Unclassified | 790 |
| 54 | Ga0075368_10289301 | 3300006042 | Bacteria | 705 |
| 55 | Ga0075363_100011486 | 3300006048 | Bacteria | 4242 |
| 56 | Ga0075363_100349769 | 3300006048 | Bacteria | 863 |
| 57 | Ga0075364_10322441 | 3300006051 | Unclassified | 1052 |
| 58 | Ga0075364_11031752 | 3300006051 | Bacteria | 559 |
| 59 | Ga0075362_10020687 | 3300006177 | Bacteria | 2752 |
| 60 | Ga0075362_10172145 | 3300006177 | Bacteria | 1047 |
| 61 | Ga0075362_10305942 | 3300006177 | Bacteria | 789 |
| 62 | Ga0075367_10003340 | 3300006178 | Bacteria | 7625 |
| 63 | Ga0075367_10125882 | 3300006178 | Bacteria | 1581 |
| 64 | Ga0075367_10162735 | 3300006178 | Bacteria | 1388 |
| 65 | Ga0075369_10012962 | 3300006186 | Bacteria | 3299 |
| 66 | Ga0075369_10068668 | 3300006186 | Unclassified | 1558 |
| 67 | Ga0075366_10004870 | 3300006195 | Bacteria | 7242 |
| 68 | Ga0075366_10008460 | 3300006195 | Bacteria | 5723 |
| 69 | Ga0075366_10070859 | 3300006195 | Bacteria | 2077 |
| 70 | Ga0075366_10101992 | 3300006195 | Bacteria | 1722 |
| 71 | Ga0075366_10127633 | 3300006195 | Bacteria | 1534 |
| 72 | Ga0075366_10235422 | 3300006195 | Bacteria | 1116 |
| 73 | Ga0075366_10428356 | 3300006195 | Unclassified | 815 |
| 74 | Ga0075366_10428369 | 3300006195 | Unclassified | 815 |
| 75 | Ga0075370_10002789 | 3300006353 | Bacteria | 8190 |
| 76 | Ga0075370_10012223 | 3300006353 | Bacteria | 4531 |
| 77 | Ga0075370_10020391 | 3300006353 | Bacteria | 3622 |
| 78 | Ga0075370_10027526 | 3300006353 | Bacteria | 3155 |
| 79 | Ga0075370_10074024 | 3300006353 | Bacteria | 1952 |
| 80 | Ga0075370_10901477 | 3300006353 | Bacteria | 540 |
| 81 | Ga0075370_10904767 | 3300006353 | Bacteria | 539 |
| 82 | Ga0075431_100591504 | 3300006847 | Bacteria | 1094 |
| 83 | Ga0097620_101631461 | 3300006931 | Bacteria | 712 |
| 84 | Ga0105240_10130469 | 3300009093 | Bacteria | 3015 |
| 85 | Ga0105240_10715810 | 3300009093 | Bacteria | 1091 |
| 86 | Ga0111539_10076924 | 3300009094 | Bacteria | 3929 |
| 87 | Ga0105245_10247432 | 3300009098 | Bacteria | 1731 |
| 88 | Ga0114129_11613052 | 3300009147 | Bacteria | 794 |
| 89 | Ga0114129_12314902 | 3300009147 | Bacteria | 645 |
| 90 | Ga0105243_10024169 | 3300009148 | Bacteria | 4634 |
| 91 | Ga0105241_11109595 | 3300009174 | Bacteria | 745 |
| 92 | Ga0105242_10541552 | 3300009176 | Bacteria | 1114 |
| 93 | Ga0105237_10057642 | 3300009545 | Bacteria | 3887 |
| 94 | Ga0105249_10064454 | 3300009553 | Bacteria | 3369 |
| 95 | Ga0105239_10040126 | 3300010375 | Bacteria | 5129 |
| 96 | Ga0157370_10469499 | 3300013104 | Bacteria | 1156 |
| 97 | Ga0157378_10970084 | 3300013297 | Bacteria | 883 |
| 98 | Ga0157378_11648720 | 3300013297 | Bacteria | 688 |
| 99 | Ga0157378_12121008 | 3300013297 | Bacteria | 613 |
| 100 | Ga0157372_10129039 | 3300013307 | Unclassified | 2908 |
| 101 | Ga0163163_10004692 | 3300014325 | Bacteria | 11702 |
| 102 | Ga0182008_10280358 | 3300014497 | Bacteria | 867 |
| 103 | Ga0157377_11200393 | 3300014745 | Bacteria | 587 |
| 104 | Ga0157379_10233981 | 3300014968 | Bacteria | 1666 |
| 105 | Ga0207645_10091588 | 3300025907 | Bacteria | 1955 |
| 106 | Ga0207643_10213078 | 3300025908 | Bacteria | 1180 |
| 107 | Ga0207705_11308633 | 3300025909 | Unclassified | 553 |
| 108 | Ga0207684_10008620 | 3300025910 | Bacteria | 9060 |
| 109 | Ga0207654_11370316 | 3300025911 | Bacteria | 516 |
| 110 | Ga0207707_10000036 | 3300025912 | Bacteria | 146159 |
| 111 | Ga0207695_10167703 | 3300025913 | Bacteria | 2123 |
| 112 | Ga0207695_11331021 | 3300025913 | Unclassified | 599 |
| 113 | Ga0207671_10337478 | 3300025914 | Unclassified | 1194 |
| 114 | Ga0207657_10537726 | 3300025919 | Bacteria | 914 |
| 115 | Ga0207657_10755797 | 3300025919 | Unclassified | 753 |
| 116 | Ga0207652_10534188 | 3300025921 | Bacteria | 1055 |
| 117 | Ga0207687_10401813 | 3300025927 | Unclassified | 1127 |
| 118 | Ga0207706_10140717 | 3300025933 | Bacteria | 2123 |
| 119 | Ga0207686_10511301 | 3300025934 | Bacteria | 933 |
| 120 | Ga0207709_10299050 | 3300025935 | Bacteria | 1196 |
| 121 | Ga0207709_10625375 | 3300025935 | Unclassified | 855 |
| 122 | Ga0207670_10658958 | 3300025936 | Bacteria | 864 |
| 123 | Ga0207669_10303887 | 3300025937 | Bacteria | 1214 |
| 124 | Ga0207691_11024241 | 3300025940 | Bacteria | 688 |
| 125 | Ga0207689_10055677 | 3300025942 | Bacteria | 3255 |
| 126 | Ga0207667_10157990 | 3300025949 | Bacteria | 2333 |
| 127 | Ga0207667_10870293 | 3300025949 | Unclassified | 894 |
| 128 | Ga0207651_10802858 | 3300025960 | Unclassified | 834 |
| 129 | Ga0207712_10549401 | 3300025961 | Bacteria | 993 |
| 130 | Ga0207712_10907068 | 3300025961 | Unclassified | 779 |
| 131 | Ga0207640_10203493 | 3300025981 | Bacteria | 1502 |
| 132 | Ga0207677_10320816 | 3300026023 | Bacteria | 1287 |
| 133 | Ga0207703_10012838 | 3300026035 | Bacteria | 6532 |
| 134 | Ga0207639_10143158 | 3300026041 | Bacteria | 1994 |
| 135 | Ga0207678_10364652 | 3300026067 | Unclassified | 1247 |
| 136 | Ga0207641_12288437 | 3300026088 | Bacteria | 540 |
| 137 | Ga0207648_10121092 | 3300026089 | Bacteria | 2301 |
| 138 | Ga0207674_10536369 | 3300026116 | Bacteria | 1130 |
| 139 | Ga0207674_11042374 | 3300026116 | Bacteria | 787 |
| 140 | Ga0207675_100151147 | 3300026118 | Bacteria | 2210 |
| 141 | Ga0207675_100422495 | 3300026118 | Bacteria | 1317 |
| 142 | Ga0207698_10256038 | 3300026142 | Bacteria | 1605 |
| 143 | Ga0207698_10273153 | 3300026142 | Unclassified | 1559 |
| 144 | Ga0268266_10179660 | 3300028379 | Bacteria | 1926 |
| 145 | Ga0268265_10223492 | 3300028380 | Bacteria | 1649 |
| 146 | Ga0268264_10879234 | 3300028381 | Bacteria | 898 |
| 147 | Ga0307517_10101294 | 3300028786 | Bacteria | 2268 |
| 148 | Ga0307517_10117953 | 3300028786 | Bacteria | 1978 |
| 149 | Ga0307513_10493368 | 3300031456 | Bacteria | 943 |
| 150 | Ga0307509_10981971 | 3300031507 | Unclassified | 511 |
| 151 | Ga0307408_100247247 | 3300031548 | Bacteria | 1469 |
| 152 | Ga0307508_10261503 | 3300031616 | Bacteria | 1325 |
| 153 | Ga0265314_10112472 | 3300031711 | Bacteria | 1728 |
| 154 | Ga0307516_10022871 | 3300031730 | Bacteria | 6415 |
| 155 | Ga0307516_10040491 | 3300031730 | Bacteria | 4638 |
| 156 | Ga0307406_10396945 | 3300031901 | Bacteria | 1092 |
| 157 | Ga0307407_10853389 | 3300031903 | Bacteria | 696 |
| 158 | Ga0307412_10046308 | 3300031911 | Bacteria | 2849 |
| 159 | Ga0307416_100344977 | 3300032002 | Bacteria | 1504 |
| 160 | Ga0307416_101142444 | 3300032002 | Bacteria | 884 |
| 161 | Ga0307416_101524919 | 3300032002 | Bacteria | 774 |
| 162 | Ga0307411_10448083 | 3300032005 | Bacteria | 1079 |
| 163 | Ga0307411_10502015 | 3300032005 | Unclassified | 1026 |
| 164 | Ga0307415_100343334 | 3300032126 | Bacteria | 1254 |
| 165 | Ga0307510_10533222 | 3300033180 | Unclassified | 619 |
| 166 | Ga0373958_0117271 | 3300034819 | Bacteria | 640 |
| 167 | Ga0373940_0227984 | 3300035088 | Bacteria | 621 |
| 168 | Ga0373956_0401911 | 3300035119 | Unclassified | 653 |
| 169 | Ga0373955_0000731 | 3300035172 | Bacteria | 14077 |
| 170 | Ga0373924_0001831 | 3300035410 | Bacteria | 7030 |
| 171 | Ga0451837_1331984 | 3300041494 | Unclassified | 514 |
| 172 | Ga0453684_0018326 | 3300044712 | Bacteria | 10759 |
| 173 | Ga0451576_0296205 | 3300045051 | Bacteria | 1691 |
| 174 | Ga0495617_052765 | 3300046452 | Bacteria | 1351 |
| 175 | Ga0495617_140636 | 3300046452 | Bacteria | 771 |
| 176 | Ga0495592_0010622 | 3300046454 | Bacteria | 6943 |
| 177 | Ga0495590_0016077 | 3300046457 | Bacteria | 2706 |
| 178 | Ga0495610_0088163 | 3300046512 | Bacteria | 1411 |
| 179 | Ga0495620_0088133 | 3300046515 | Bacteria | 1248 |
| 180 | Ga0495631_0054785 | 3300046518 | Bacteria | 1738 |
| 181 | Ga0495632_0003106 | 3300046519 | Bacteria | 12035 |
| 182 | Ga0495643_0293728 | 3300046522 | Bacteria | 743 |
| 183 | Ga0495648_0481265 | 3300046524 | Bacteria | 536 |
| 184 | Ga0495654_0222733 | 3300046530 | Bacteria | 797 |
| 185 | Ga0495609_0044876 | 3300046538 | Bacteria | 1982 |
| 186 | Ga0495621_0301603 | 3300046539 | Bacteria | 664 |
| 187 | Ga0495597_0059365 | 3300046542 | Bacteria | 1670 |
| 188 | Ga0495597_0187811 | 3300046542 | Bacteria | 832 |
| 189 | Ga0495597_0340378 | 3300046542 | Bacteria | 577 |
| 190 | Ga0495668_0052296 | 3300046616 | Bacteria | 2260 |
| 191 | Ga0495668_0529342 | 3300046616 | Bacteria | 650 |
| 192 | Ga0495668_0837383 | 3300046616 | Unclassified | 510 |
| 193 | Ga0495611_0067112 | 3300046648 | Bacteria | 1637 |
| 194 | Ga0495625_0023869 | 3300046660 | Bacteria | 4665 |
| 195 | Ga0495625_0126653 | 3300046660 | Bacteria | 1733 |
| 196 | Ga0495625_0615766 | 3300046660 | Bacteria | 650 |
| 197 | Ga0495657_0303487 | 3300046675 | Bacteria | 952 |
| 198 | Ga0495623_0105800 | 3300046679 | Bacteria | 1710 |
| 199 | Ga0495670_0382018 | 3300046691 | Bacteria | 760 |
| 200 | Ga0495671_0099721 | 3300046692 | Bacteria | 1420 |
| 201 | Ga0495671_0264779 | 3300046692 | Bacteria | 829 |
| 202 | Ga0495649_0008052 | 3300046694 | Bacteria | 6366 |
| 203 | Ga0495600_0689431 | 3300046809 | Unclassified | 615 |
| 204 | Ga0495660_0043232 | 3300046810 | Bacteria | 2486 |
| 205 | Ga0495674_0260796 | 3300047319 | Bacteria | 1424 |
| 206 | Ga0495683_0396821 | 3300047323 | Bacteria | 574 |
| 207 | Ga0495687_001446 | 3300047443 | Bacteria | 21795 |
| 208 | Ga0495687_005402 | 3300047443 | Bacteria | 8157 |
| 209 | Ga0495673_0220478 | 3300047469 | Bacteria | 702 |
| 210 | Ga0495686_0001644 | 3300047472 | Bacteria | 23312 |
| 211 | Ga0495626_0068743 | 3300048091 | Bacteria | 1597 |
| 212 | Ga0495626_0205376 | 3300048091 | Bacteria | 806 |
| 213 | Ga0495626_0395001 | 3300048091 | Bacteria | 535 |
| 214 | Ga0501291_001298 | 3300049514 | Bacteria | 2887 |
| 215 | Ga0501299_027937 | 3300049522 | Bacteria | 1073 |
| 216 | Ga0501300_005280 | 3300049523 | Bacteria | 1909 |
| 217 | Ga0501046_1202683 | 3300049580 | Unclassified | 521 |
| 218 | Ga0501047_0454330 | 3300049581 | Bacteria | 1110 |
| 219 | Ga0501047_0576810 | 3300049581 | Bacteria | 948 |
| 220 | Ga0501047_0888408 | 3300049581 | Bacteria | 705 |
| 221 | Ga0501047_1007559 | 3300049581 | Bacteria | 646 |
| 222 | Ga0501070_0245288 | 3300049586 | Bacteria | 1466 |
| 223 | Ga0501075_0310419 | 3300049591 | Bacteria | 1202 |
| 224 | Ga0501076_0874788 | 3300049592 | Unclassified | 741 |
| 225 | Ga0501077_0116942 | 3300049593 | Bacteria | 1690 |
| 226 | Ga0501216_078455 | 3300049660 | Bacteria | 695 |
| 227 | Ga0501080_0071488 | 3300049742 | Bacteria | 3227 |
| 228 | Ga0501081_1378669 | 3300049743 | Bacteria | 535 |
| 229 | Ga0501083_0022168 | 3300049744 | Bacteria | 4408 |
| 230 | Ga0501268_072343 | 3300049765 | Bacteria | 700 |
| 231 | Ga0501279_083042 | 3300049775 | Bacteria | 555 |
| 232 | Ga0501283_020851 | 3300049779 | Bacteria | 1047 |
| 233 | Ga0501212_055515 | 3300049851 | Bacteria | 677 |
| 234 | nmdc:mga03683_155105_c1 | 3300050489 | Unclassified | 1035 |
| 235 | nmdc:mga03683_3760_c2 | 3300050489 | Bacteria | 2804 |
| 236 | nmdc:mga03683_702006_c1 | 3300050489 | Bacteria | 501 |
| 237 | nmdc:mga03n38_3563_c1 | 3300050490 | Bacteria | 5026 |
| 238 | nmdc:mga03n38_373345_c1 | 3300050490 | Bacteria | 780 |
| 239 | nmdc:mga00v17_414353_c1 | 3300050491 | Bacteria | 875 |
| 240 | nmdc:mga00v17_541653_c1 | 3300050491 | Bacteria | 753 |
| 241 | nmdc:mga0yw44_880333_c1 | 3300050492 | Bacteria | 607 |
| 242 | nmdc:mga0k408_154277_c1 | 3300050493 | Bacteria | 1368 |
| 243 | nmdc:mga0k408_3106_c1 | 3300050493 | Bacteria | 8801 |
| 244 | nmdc:mga0k408_37920_c1 | 3300050493 | Bacteria | 2767 |
| 245 | nmdc:mga0k408_404614_c1 | 3300050493 | Bacteria | 812 |
| 246 | nmdc:mga0k408_404742_c1 | 3300050493 | Unclassified | 812 |
| 247 | nmdc:mga0k408_52028_c1 | 3300050493 | Bacteria | 2373 |
| 248 | nmdc:mga0k408_525189_c1 | 3300050493 | Bacteria | 701 |
| 249 | nmdc:mga0k408_671109_c1 | 3300050493 | Bacteria | 609 |
| 250 | nmdc:mga0k408_841766_c1 | 3300050493 | Bacteria | 534 |
| 251 | nmdc:mga06z11_113893_c1 | 3300050494 | Bacteria | 1501 |
| 252 | nmdc:mga06z11_11937_c1 | 3300050494 | Bacteria | 2903 |
| 253 | nmdc:mga06z11_405409_c1 | 3300050494 | Bacteria | 821 |
| 254 | nmdc:mga04h51_224454_c1 | 3300050495 | Bacteria | 745 |
| 255 | nmdc:mga07m45_112230_c1 | 3300050496 | Unclassified | 1571 |
| 256 | nmdc:mga07m45_1462_c1 | 3300050496 | Bacteria | 10840 |
| 257 | nmdc:mga07m45_184368_c2 | 3300050496 | Bacteria | 589 |
| 258 | nmdc:mga07m45_218816_c1 | 3300050496 | Bacteria | 1108 |
| 259 | nmdc:mga07m45_286691_c1 | 3300050496 | Bacteria | 958 |
| 260 | nmdc:mga07m45_31227_c1 | 3300050496 | Bacteria | 2952 |
| 261 | nmdc:mga06r32_581741_c1 | 3300050510 | Bacteria | 1092 |
| 262 | nmdc:mga08y16_218904_c1 | 3300050511 | Bacteria | 1971 |
| 263 | nmdc:mga0rr50_1423920_c1 | 3300050513 | Bacteria | 586 |
| 264 | nmdc:mga0rr50_900286_c1 | 3300050513 | Bacteria | 754 |
| 265 | nmdc:mga0sz30_42222_c2 | 3300050516 | Bacteria | 989 |
| 266 | nmdc:mga0sz30_6858_c1 | 3300050516 | Bacteria | 4251 |
| 267 | Ga0495655_0068932 | 3300053083 | Bacteria | 984 |
| 268 | Ga0500578_0572441 | 3300053086 | Bacteria | 625 |
| 269 | Ga0500644_0256992 | 3300053088 | Unclassified | 738 |
| 270 | Ga0500651_0140512 | 3300053093 | Unclassified | 1456 |
| 271 | Ga0500651_0359938 | 3300053093 | Bacteria | 824 |
| 272 | Ga0500594_0002929 | 3300053118 | Bacteria | 3728 |
| 273 | Ga0500594_0007088 | 3300053118 | Bacteria | 2531 |
| 274 | Ga0500658_0002629 | 3300053134 | Bacteria | 6916 |
| 275 | Ga0500568_0025639 | 3300053139 | Bacteria | 2484 |
| 276 | Ga0500622_0007705 | 3300053156 | Bacteria | 6082 |
| 277 | Ga0501084_0304139 | 3300054114 | Bacteria | 1347 |
| 278 | Ga0530510_0247883 | 3300061734 | Bacteria | 1327 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005295 | Ga0065707_10860707 | Ga0065707_108607071 | 72 |
| 2 | 3300005343 | Ga0070687_100572067 | Ga0070687_1005720672 | 72 |
| 3 | 3300005345 | Ga0070692_10424370 | Ga0070692_104243702 | 72 |
| 4 | 3300005440 | Ga0070705_100122018 | Ga0070705_1001220184 | 72 |
| 5 | 3300005617 | Ga0068859_100002322 | Ga0068859_10000232222 | 72 |
| 6 | 3300005841 | Ga0068863_101577315 | Ga0068863_1015773152 | 72 |
| 7 | 3300009094 | Ga0111539_10076924 | Ga0111539_100769245 | 72 |
| 8 | 3300009553 | Ga0105249_10064454 | Ga0105249_100644543 | 72 |
| 9 | 3300026088 | Ga0207641_12288437 | Ga0207641_122884372 | 72 |
| 10 | 3300050511 | nmdc:mga08y16_218904_c1 | nmdc:mga08y16_218904_c1_728_946 | 72 |
| 11 | 3300050513 | nmdc:mga0rr50_1423920_c1 | nmdc:mga0rr50_1423920_c1_59_277 | 72 |
| 12 | 3300031711 | Ga0265314_10112472 | Ga0265314_101124723 | 73 |
| 13 | 3300049581 | Ga0501047_0888408 | Ga0501047_0888408_85_306 | 73 |
| 14 | 3300005327 | Ga0070658_11718596 | Ga0070658_117185962 | 74 |
| 15 | 3300005356 | Ga0070674_102081957 | Ga0070674_1020819571 | 74 |
| 16 | 3300005458 | Ga0070681_10003116 | Ga0070681_1000311611 | 74 |
| 17 | 3300005530 | Ga0070679_100709212 | Ga0070679_1007092122 | 74 |
| 18 | 3300005543 | Ga0070672_101754567 | Ga0070672_1017545672 | 74 |
| 19 | 3300005547 | Ga0070693_100000328 | Ga0070693_1000003288 | 74 |
| 20 | 3300006195 | Ga0075366_10235422 | Ga0075366_102354222 | 74 |
| 21 | 3300006353 | Ga0075370_10012223 | Ga0075370_100122234 | 74 |
| 22 | 3300006847 | Ga0075431_100591504 | Ga0075431_1005915042 | 74 |
| 23 | 3300009147 | Ga0114129_11613052 | Ga0114129_116130522 | 74 |
| 24 | 3300025909 | Ga0207705_11308633 | Ga0207705_113086332 | 74 |
| 25 | 3300025912 | Ga0207707_10000036 | Ga0207707_1000003694 | 74 |
| 26 | 3300025921 | Ga0207652_10534188 | Ga0207652_105341882 | 74 |
| 27 | 3300031507 | Ga0307509_10981971 | Ga0307509_109819711 | 74 |
| 28 | 3300031548 | Ga0307408_100247247 | Ga0307408_1002472472 | 74 |
| 29 | 3300031901 | Ga0307406_10396945 | Ga0307406_103969452 | 74 |
| 30 | 3300031911 | Ga0307412_10046308 | Ga0307412_100463083 | 74 |
| 31 | 3300032002 | Ga0307416_100344977 | Ga0307416_1003449772 | 74 |
| 32 | 3300032005 | Ga0307411_10502015 | Ga0307411_105020152 | 74 |
| 33 | 3300032126 | Ga0307415_100343334 | Ga0307415_1003433342 | 74 |
| 34 | 3300035119 | Ga0373956_0401911 | Ga0373956_0401911_256_486 | 74 |
| 35 | 3300035172 | Ga0373955_0000731 | Ga0373955_0000731_916_1146 | 74 |
| 36 | 3300035410 | Ga0373924_0001831 | Ga0373924_0001831_3928_4158 | 74 |
| 37 | 3300046675 | Ga0495657_0303487 | Ga0495657_0303487_490_720 | 74 |
| 38 | 3300046679 | Ga0495623_0105800 | Ga0495623_0105800_886_1116 | 74 |
| 39 | 3300046809 | Ga0495600_0689431 | Ga0495600_0689431_256_486 | 74 |
| 40 | 3300047319 | Ga0495674_0260796 | Ga0495674_0260796_40_270 | 74 |
| 41 | 3300049743 | Ga0501081_1378669 | Ga0501081_1378669_248_478 | 74 |
| 42 | 3300050493 | nmdc:mga0k408_404614_c1 | nmdc:mga0k408_404614_c1_385_615 | 74 |
| 43 | 3300050493 | nmdc:mga0k408_404742_c1 | nmdc:mga0k408_404742_c1_344_568 | 74 |
| 44 | 3300050496 | nmdc:mga07m45_112230_c1 | nmdc:mga07m45_112230_c1_45_269 | 74 |
| 45 | 3300050510 | nmdc:mga06r32_581741_c1 | nmdc:mga06r32_581741_c1_646_876 | 74 |
| 46 | 3300053088 | Ga0500644_0256992 | Ga0500644_0256992_94_324 | 74 |
| 47 | 3300053093 | Ga0500651_0140512 | Ga0500651_0140512_783_1013 | 74 |
| 48 | 3300053118 | Ga0500594_0002929 | Ga0500594_0002929_3312_3542 | 74 |
| 49 | 3300053156 | Ga0500622_0007705 | Ga0500622_0007705_2379_2609 | 74 |
| 50 | 3300005334 | Ga0068869_100072884 | Ga0068869_1000728844 | 75 |
| 51 | 3300005334 | Ga0068869_100541246 | Ga0068869_1005412461 | 75 |
| 52 | 3300005340 | Ga0070689_100850078 | Ga0070689_1008500781 | 75 |
| 53 | 3300005356 | Ga0070674_100845062 | Ga0070674_1008450622 | 75 |
| 54 | 3300005364 | Ga0070673_100075977 | Ga0070673_1000759775 | 75 |
| 55 | 3300005365 | Ga0070688_100734963 | Ga0070688_1007349632 | 75 |
| 56 | 3300005367 | Ga0070667_100112213 | Ga0070667_1001122132 | 75 |
| 57 | 3300005440 | Ga0070705_101021464 | Ga0070705_1010214642 | 75 |
| 58 | 3300005444 | Ga0070694_100372019 | Ga0070694_1003720192 | 75 |
| 59 | 3300005455 | Ga0070663_100040669 | Ga0070663_1000406695 | 75 |
| 60 | 3300005457 | Ga0070662_100048909 | Ga0070662_1000489094 | 75 |
| 61 | 3300005459 | Ga0068867_102387896 | Ga0068867_1023878961 | 75 |
| 62 | 3300005467 | Ga0070706_100001321 | Ga0070706_10000132123 | 75 |
| 63 | 3300005467 | Ga0070706_101522111 | Ga0070706_1015221111 | 75 |
| 64 | 3300005471 | Ga0070698_100012106 | Ga0070698_10001210610 | 75 |
| 65 | 3300005518 | Ga0070699_100146456 | Ga0070699_1001464562 | 75 |
| 66 | 3300005518 | Ga0070699_100257637 | Ga0070699_1002576374 | 75 |
| 67 | 3300005543 | Ga0070672_101771224 | Ga0070672_1017712242 | 75 |
| 68 | 3300005545 | Ga0070695_100131709 | Ga0070695_1001317093 | 75 |
| 69 | 3300005549 | Ga0070704_100024240 | Ga0070704_1000242405 | 75 |
| 70 | 3300005549 | Ga0070704_100325535 | Ga0070704_1003255353 | 75 |
| 71 | 3300005563 | Ga0068855_100984806 | Ga0068855_1009848061 | 75 |
| 72 | 3300005577 | Ga0068857_100118510 | Ga0068857_1001185101 | 75 |
| 73 | 3300005578 | Ga0068854_100559210 | Ga0068854_1005592103 | 75 |
| 74 | 3300005614 | Ga0068856_101434855 | Ga0068856_1014348552 | 75 |
| 75 | 3300005616 | Ga0068852_100113927 | Ga0068852_1001139272 | 75 |
| 76 | 3300005617 | Ga0068859_101631825 | Ga0068859_1016318252 | 75 |
| 77 | 3300005719 | Ga0068861_100152102 | Ga0068861_1001521024 | 75 |
| 78 | 3300005840 | Ga0068870_10337103 | Ga0068870_103371033 | 75 |
| 79 | 3300005842 | Ga0068858_100051329 | Ga0068858_1000513294 | 75 |
| 80 | 3300005842 | Ga0068858_102165488 | Ga0068858_1021654882 | 75 |
| 81 | 3300005843 | Ga0068860_101010577 | Ga0068860_1010105772 | 75 |
| 82 | 3300005843 | Ga0068860_102361833 | Ga0068860_1023618332 | 75 |
| 83 | 3300005844 | Ga0068862_100441591 | Ga0068862_1004415912 | 75 |
| 84 | 3300006038 | Ga0075365_10584383 | Ga0075365_105843833 | 75 |
| 85 | 3300006042 | Ga0075368_10289301 | Ga0075368_102893012 | 75 |
| 86 | 3300006048 | Ga0075363_100011486 | Ga0075363_1000114867 | 75 |
| 87 | 3300006048 | Ga0075363_100349769 | Ga0075363_1003497692 | 75 |
| 88 | 3300006051 | Ga0075364_10322441 | Ga0075364_103224413 | 75 |
| 89 | 3300006051 | Ga0075364_11031752 | Ga0075364_110317521 | 75 |
| 90 | 3300006177 | Ga0075362_10020687 | Ga0075362_100206873 | 75 |
| 91 | 3300006177 | Ga0075362_10172145 | Ga0075362_101721451 | 75 |
| 92 | 3300006177 | Ga0075362_10305942 | Ga0075362_103059422 | 75 |
| 93 | 3300006178 | Ga0075367_10003340 | Ga0075367_1000334010 | 75 |
| 94 | 3300006178 | Ga0075367_10125882 | Ga0075367_101258822 | 75 |
| 95 | 3300006178 | Ga0075367_10162735 | Ga0075367_101627353 | 75 |
| 96 | 3300006186 | Ga0075369_10012962 | Ga0075369_100129629 | 75 |
| 97 | 3300006186 | Ga0075369_10068668 | Ga0075369_100686683 | 75 |
| 98 | 3300006195 | Ga0075366_10004870 | Ga0075366_100048705 | 75 |
| 99 | 3300006195 | Ga0075366_10008460 | Ga0075366_100084602 | 75 |
| 100 | 3300006195 | Ga0075366_10070859 | Ga0075366_100708595 | 75 |
| 101 | 3300006195 | Ga0075366_10101992 | Ga0075366_101019923 | 75 |
| 102 | 3300006195 | Ga0075366_10127633 | Ga0075366_101276332 | 75 |
| 103 | 3300006195 | Ga0075366_10428356 | Ga0075366_104283561 | 75 |
| 104 | 3300006195 | Ga0075366_10428369 | Ga0075366_104283693 | 75 |
| 105 | 3300006353 | Ga0075370_10002789 | Ga0075370_100027899 | 75 |
| 106 | 3300006353 | Ga0075370_10020391 | Ga0075370_100203914 | 75 |
| 107 | 3300006353 | Ga0075370_10027526 | Ga0075370_100275265 | 75 |
| 108 | 3300006353 | Ga0075370_10074024 | Ga0075370_100740243 | 75 |
| 109 | 3300006353 | Ga0075370_10901477 | Ga0075370_109014772 | 75 |
| 110 | 3300006353 | Ga0075370_10904767 | Ga0075370_109047672 | 75 |
| 111 | 3300006931 | Ga0097620_101631461 | Ga0097620_1016314612 | 75 |
| 112 | 3300009093 | Ga0105240_10130469 | Ga0105240_101304693 | 75 |
| 113 | 3300009093 | Ga0105240_10715810 | Ga0105240_107158103 | 75 |
| 114 | 3300009098 | Ga0105245_10247432 | Ga0105245_102474324 | 75 |
| 115 | 3300009147 | Ga0114129_12314902 | Ga0114129_123149022 | 75 |
| 116 | 3300009148 | Ga0105243_10024169 | Ga0105243_100241694 | 75 |
| 117 | 3300009174 | Ga0105241_11109595 | Ga0105241_111095952 | 75 |
| 118 | 3300009176 | Ga0105242_10541552 | Ga0105242_105415523 | 75 |
| 119 | 3300009545 | Ga0105237_10057642 | Ga0105237_100576424 | 75 |
| 120 | 3300010375 | Ga0105239_10040126 | Ga0105239_100401266 | 75 |
| 121 | 3300013297 | Ga0157378_10970084 | Ga0157378_109700842 | 75 |
| 122 | 3300013297 | Ga0157378_11648720 | Ga0157378_116487202 | 75 |
| 123 | 3300013297 | Ga0157378_12121008 | Ga0157378_121210082 | 75 |
| 124 | 3300014325 | Ga0163163_10004692 | Ga0163163_1000469211 | 75 |
| 125 | 3300014497 | Ga0182008_10280358 | Ga0182008_102803582 | 75 |
| 126 | 3300014745 | Ga0157377_11200393 | Ga0157377_112003931 | 75 |
| 127 | 3300014968 | Ga0157379_10233981 | Ga0157379_102339815 | 75 |
| 128 | 3300025907 | Ga0207645_10091588 | Ga0207645_100915883 | 75 |
| 129 | 3300025908 | Ga0207643_10213078 | Ga0207643_102130782 | 75 |
| 130 | 3300025910 | Ga0207684_10008620 | Ga0207684_100086208 | 75 |
| 131 | 3300025911 | Ga0207654_11370316 | Ga0207654_113703162 | 75 |
| 132 | 3300025913 | Ga0207695_10167703 | Ga0207695_101677033 | 75 |
| 133 | 3300025914 | Ga0207671_10337478 | Ga0207671_103374784 | 75 |
| 134 | 3300025919 | Ga0207657_10755797 | Ga0207657_107557971 | 75 |
| 135 | 3300025927 | Ga0207687_10401813 | Ga0207687_104018133 | 75 |
| 136 | 3300025933 | Ga0207706_10140717 | Ga0207706_101407174 | 75 |
| 137 | 3300025934 | Ga0207686_10511301 | Ga0207686_105113012 | 75 |
| 138 | 3300025935 | Ga0207709_10299050 | Ga0207709_102990501 | 75 |
| 139 | 3300025935 | Ga0207709_10625375 | Ga0207709_106253751 | 75 |
| 140 | 3300025936 | Ga0207670_10658958 | Ga0207670_106589582 | 75 |
| 141 | 3300025937 | Ga0207669_10303887 | Ga0207669_103038873 | 75 |
| 142 | 3300025940 | Ga0207691_11024241 | Ga0207691_110242412 | 75 |
| 143 | 3300025942 | Ga0207689_10055677 | Ga0207689_100556775 | 75 |
| 144 | 3300025949 | Ga0207667_10157990 | Ga0207667_101579903 | 75 |
| 145 | 3300025949 | Ga0207667_10870293 | Ga0207667_108702931 | 75 |
| 146 | 3300025960 | Ga0207651_10802858 | Ga0207651_108028581 | 75 |
| 147 | 3300025961 | Ga0207712_10907068 | Ga0207712_109070682 | 75 |
| 148 | 3300025981 | Ga0207640_10203493 | Ga0207640_102034933 | 75 |
| 149 | 3300026023 | Ga0207677_10320816 | Ga0207677_103208161 | 75 |
| 150 | 3300026035 | Ga0207703_10012838 | Ga0207703_100128387 | 75 |
| 151 | 3300026041 | Ga0207639_10143158 | Ga0207639_101431583 | 75 |
| 152 | 3300026067 | Ga0207678_10364652 | Ga0207678_103646522 | 75 |
| 153 | 3300026089 | Ga0207648_10121092 | Ga0207648_101210922 | 75 |
| 154 | 3300026116 | Ga0207674_10536369 | Ga0207674_105363692 | 75 |
| 155 | 3300026116 | Ga0207674_11042374 | Ga0207674_110423742 | 75 |
| 156 | 3300026118 | Ga0207675_100151147 | Ga0207675_1001511475 | 75 |
| 157 | 3300026142 | Ga0207698_10273153 | Ga0207698_102731532 | 75 |
| 158 | 3300028379 | Ga0268266_10179660 | Ga0268266_101796601 | 75 |
| 159 | 3300028381 | Ga0268264_10879234 | Ga0268264_108792342 | 75 |
| 160 | 3300028786 | Ga0307517_10101294 | Ga0307517_101012945 | 75 |
| 161 | 3300028786 | Ga0307517_10117953 | Ga0307517_101179532 | 75 |
| 162 | 3300031456 | Ga0307513_10493368 | Ga0307513_104933681 | 75 |
| 163 | 3300031616 | Ga0307508_10261503 | Ga0307508_102615034 | 75 |
| 164 | 3300031730 | Ga0307516_10022871 | Ga0307516_100228712 | 75 |
| 165 | 3300031730 | Ga0307516_10040491 | Ga0307516_100404912 | 75 |
| 166 | 3300032002 | Ga0307416_101142444 | Ga0307416_1011424442 | 75 |
| 167 | 3300033180 | Ga0307510_10533222 | Ga0307510_105332221 | 75 |
| 168 | 3300034819 | Ga0373958_0117271 | Ga0373958_0117271_71_307 | 75 |
| 169 | 3300035088 | Ga0373940_0227984 | Ga0373940_0227984_125_361 | 75 |
| 170 | 3300045051 | Ga0451576_0296205 | Ga0451576_0296205_766_1002 | 75 |
| 171 | 3300046452 | Ga0495617_052765 | Ga0495617_052765_220_447 | 75 |
| 172 | 3300046452 | Ga0495617_140636 | Ga0495617_140636_84_332 | 75 |
| 173 | 3300046457 | Ga0495590_0016077 | Ga0495590_0016077_339_566 | 75 |
| 174 | 3300046512 | Ga0495610_0088163 | Ga0495610_0088163_745_972 | 75 |
| 175 | 3300046515 | Ga0495620_0088133 | Ga0495620_0088133_179_406 | 75 |
| 176 | 3300046518 | Ga0495631_0054785 | Ga0495631_0054785_415_642 | 75 |
| 177 | 3300046519 | Ga0495632_0003106 | Ga0495632_0003106_7845_8072 | 75 |
| 178 | 3300046522 | Ga0495643_0293728 | Ga0495643_0293728_178_405 | 75 |
| 179 | 3300046524 | Ga0495648_0481265 | Ga0495648_0481265_159_386 | 75 |
| 180 | 3300046530 | Ga0495654_0222733 | Ga0495654_0222733_459_686 | 75 |
| 181 | 3300046538 | Ga0495609_0044876 | Ga0495609_0044876_493_720 | 75 |
| 182 | 3300046539 | Ga0495621_0301603 | Ga0495621_0301603_208_435 | 75 |
| 183 | 3300046542 | Ga0495597_0059365 | Ga0495597_0059365_833_1060 | 75 |
| 184 | 3300046542 | Ga0495597_0187811 | Ga0495597_0187811_593_820 | 75 |
| 185 | 3300046542 | Ga0495597_0340378 | Ga0495597_0340378_295_522 | 75 |
| 186 | 3300046616 | Ga0495668_0052296 | Ga0495668_0052296_1143_1370 | 75 |
| 187 | 3300046616 | Ga0495668_0529342 | Ga0495668_0529342_252_479 | 75 |
| 188 | 3300046616 | Ga0495668_0837383 | Ga0495668_0837383_94_321 | 75 |
| 189 | 3300046648 | Ga0495611_0067112 | Ga0495611_0067112_1355_1603 | 75 |
| 190 | 3300046660 | Ga0495625_0023869 | Ga0495625_0023869_2323_2550 | 75 |
| 191 | 3300046660 | Ga0495625_0126653 | Ga0495625_0126653_1287_1514 | 75 |
| 192 | 3300046660 | Ga0495625_0615766 | Ga0495625_0615766_176_403 | 75 |
| 193 | 3300046691 | Ga0495670_0382018 | Ga0495670_0382018_185_433 | 75 |
| 194 | 3300046692 | Ga0495671_0099721 | Ga0495671_0099721_12_239 | 75 |
| 195 | 3300046692 | Ga0495671_0264779 | Ga0495671_0264779_356_583 | 75 |
| 196 | 3300046694 | Ga0495649_0008052 | Ga0495649_0008052_3912_4139 | 75 |
| 197 | 3300046810 | Ga0495660_0043232 | Ga0495660_0043232_776_1003 | 75 |
| 198 | 3300047323 | Ga0495683_0396821 | Ga0495683_0396821_103_330 | 75 |
| 199 | 3300047443 | Ga0495687_001446 | Ga0495687_001446_13844_14071 | 75 |
| 200 | 3300047443 | Ga0495687_005402 | Ga0495687_005402_2743_2970 | 75 |
| 201 | 3300047469 | Ga0495673_0220478 | Ga0495673_0220478_303_530 | 75 |
| 202 | 3300047472 | Ga0495686_0001644 | Ga0495686_0001644_10155_10397 | 75 |
| 203 | 3300048091 | Ga0495626_0068743 | Ga0495626_0068743_20_247 | 75 |
| 204 | 3300048091 | Ga0495626_0205376 | Ga0495626_0205376_550_777 | 75 |
| 205 | 3300048091 | Ga0495626_0395001 | Ga0495626_0395001_118_345 | 75 |
| 206 | 3300049580 | Ga0501046_1202683 | Ga0501046_1202683_137_364 | 75 |
| 207 | 3300049581 | Ga0501047_0454330 | Ga0501047_0454330_22_258 | 75 |
| 208 | 3300049581 | Ga0501047_0576810 | Ga0501047_0576810_35_262 | 75 |
| 209 | 3300049591 | Ga0501075_0310419 | Ga0501075_0310419_470_709 | 75 |
| 210 | 3300049592 | Ga0501076_0874788 | Ga0501076_0874788_340_579 | 75 |
| 211 | 3300049593 | Ga0501077_0116942 | Ga0501077_0116942_384_623 | 75 |
| 212 | 3300050489 | nmdc:mga03683_155105_c1 | nmdc:mga03683_155105_c1_787_1014 | 75 |
| 213 | 3300050489 | nmdc:mga03683_3760_c2 | nmdc:mga03683_3760_c2_1585_1812 | 75 |
| 214 | 3300050489 | nmdc:mga03683_702006_c1 | nmdc:mga03683_702006_c1_116_343 | 75 |
| 215 | 3300050490 | nmdc:mga03n38_3563_c1 | nmdc:mga03n38_3563_c1_862_1089 | 75 |
| 216 | 3300050490 | nmdc:mga03n38_373345_c1 | nmdc:mga03n38_373345_c1_254_481 | 75 |
| 217 | 3300050491 | nmdc:mga00v17_414353_c1 | nmdc:mga00v17_414353_c1_339_566 | 75 |
| 218 | 3300050491 | nmdc:mga00v17_541653_c1 | nmdc:mga00v17_541653_c1_236_463 | 75 |
| 219 | 3300050492 | nmdc:mga0yw44_880333_c1 | nmdc:mga0yw44_880333_c1_162_389 | 75 |
| 220 | 3300050493 | nmdc:mga0k408_154277_c1 | nmdc:mga0k408_154277_c1_1062_1289 | 75 |
| 221 | 3300050493 | nmdc:mga0k408_3106_c1 | nmdc:mga0k408_3106_c1_3270_3497 | 75 |
| 222 | 3300050493 | nmdc:mga0k408_37920_c1 | nmdc:mga0k408_37920_c1_1840_2067 | 75 |
| 223 | 3300050493 | nmdc:mga0k408_52028_c1 | nmdc:mga0k408_52028_c1_1760_1987 | 75 |
| 224 | 3300050493 | nmdc:mga0k408_525189_c1 | nmdc:mga0k408_525189_c1_201_428 | 75 |
| 225 | 3300050493 | nmdc:mga0k408_671109_c1 | nmdc:mga0k408_671109_c1_279_506 | 75 |
| 226 | 3300050493 | nmdc:mga0k408_841766_c1 | nmdc:mga0k408_841766_c1_205_432 | 75 |
| 227 | 3300050494 | nmdc:mga06z11_113893_c1 | nmdc:mga06z11_113893_c1_1109_1336 | 75 |
| 228 | 3300050494 | nmdc:mga06z11_11937_c1 | nmdc:mga06z11_11937_c1_1537_1764 | 75 |
| 229 | 3300050494 | nmdc:mga06z11_405409_c1 | nmdc:mga06z11_405409_c1_560_787 | 75 |
| 230 | 3300050495 | nmdc:mga04h51_224454_c1 | nmdc:mga04h51_224454_c1_30_257 | 75 |
| 231 | 3300050496 | nmdc:mga07m45_1462_c1 | nmdc:mga07m45_1462_c1_666_893 | 75 |
| 232 | 3300050496 | nmdc:mga07m45_184368_c2 | nmdc:mga07m45_184368_c2_69_296 | 75 |
| 233 | 3300050496 | nmdc:mga07m45_218816_c1 | nmdc:mga07m45_218816_c1_403_630 | 75 |
| 234 | 3300050496 | nmdc:mga07m45_286691_c1 | nmdc:mga07m45_286691_c1_686_913 | 75 |
| 235 | 3300050496 | nmdc:mga07m45_31227_c1 | nmdc:mga07m45_31227_c1_275_502 | 75 |
| 236 | 3300050513 | nmdc:mga0rr50_900286_c1 | nmdc:mga0rr50_900286_c1_136_372 | 75 |
| 237 | 3300050516 | nmdc:mga0sz30_42222_c2 | nmdc:mga0sz30_42222_c2_216_443 | 75 |
| 238 | 3300050516 | nmdc:mga0sz30_6858_c1 | nmdc:mga0sz30_6858_c1_1694_1921 | 75 |
| 239 | 3300053083 | Ga0495655_0068932 | Ga0495655_0068932_399_626 | 75 |
| 240 | 3300053086 | Ga0500578_0572441 | Ga0500578_0572441_67_294 | 75 |
| 241 | 3300053093 | Ga0500651_0359938 | Ga0500651_0359938_203_430 | 75 |
| 242 | 3300053134 | Ga0500658_0002629 | Ga0500658_0002629_2630_2857 | 75 |
| 243 | 3300053139 | Ga0500568_0025639 | Ga0500568_0025639_1927_2175 | 75 |
| 244 | 3300061734 | Ga0530510_0247883 | Ga0530510_0247883_416_655 | 75 |
| 245 | 3300031903 | Ga0307407_10853389 | Ga0307407_108533892 | 76 |
| 246 | 3300032002 | Ga0307416_101524919 | Ga0307416_1015249191 | 76 |
| 247 | 3300032005 | Ga0307411_10448083 | Ga0307411_104480832 | 76 |
| 248 | 3300041494 | Ga0451837_1331984 | Ga0451837_1331984_227_460 | 76 |
| 249 | 3300049514 | Ga0501291_001298 | Ga0501291_001298_1206_1442 | 76 |
| 250 | 3300049522 | Ga0501299_027937 | Ga0501299_027937_54_290 | 76 |
| 251 | 3300049523 | Ga0501300_005280 | Ga0501300_005280_1547_1783 | 76 |
| 252 | 3300049660 | Ga0501216_078455 | Ga0501216_078455_203_439 | 76 |
| 253 | 3300049765 | Ga0501268_072343 | Ga0501268_072343_381_617 | 76 |
| 254 | 3300049775 | Ga0501279_083042 | Ga0501279_083042_22_258 | 76 |
| 255 | 3300049779 | Ga0501283_020851 | Ga0501283_020851_107_343 | 76 |
| 256 | 3300049851 | Ga0501212_055515 | Ga0501212_055515_328_564 | 76 |
| 257 | 3300005354 | Ga0070675_101786376 | Ga0070675_1017863761 | 77 |
| 258 | 3300005719 | Ga0068861_100285037 | Ga0068861_1002850372 | 77 |
| 259 | 3300005844 | Ga0068862_100486982 | Ga0068862_1004869823 | 77 |
| 260 | 3300013104 | Ga0157370_10469499 | Ga0157370_104694991 | 77 |
| 261 | 3300013307 | Ga0157372_10129039 | Ga0157372_101290392 | 77 |
| 262 | 3300025913 | Ga0207695_11331021 | Ga0207695_113310211 | 77 |
| 263 | 3300025961 | Ga0207712_10549401 | Ga0207712_105494012 | 77 |
| 264 | 3300026118 | Ga0207675_100422495 | Ga0207675_1004224952 | 77 |
| 265 | 3300028380 | Ga0268265_10223492 | Ga0268265_102234922 | 77 |
| 266 | 3300049581 | Ga0501047_1007559 | Ga0501047_1007559_97_342 | 77 |
| 267 | 3300049586 | Ga0501070_0245288 | Ga0501070_0245288_77_322 | 77 |
| 268 | 3300049742 | Ga0501080_0071488 | Ga0501080_0071488_2210_2455 | 77 |
| 269 | 3300049744 | Ga0501083_0022168 | Ga0501083_0022168_522_767 | 77 |
| 270 | 3300054114 | Ga0501084_0304139 | Ga0501084_0304139_888_1133 | 77 |
| 271 | 3300044712 | Ga0453684_0018326 | Ga0453684_0018326_9086_9328 | 78 |
| 272 | 3300025919 | Ga0207657_10537726 | Ga0207657_105377263 | 83 |
| 273 | 3300026142 | Ga0207698_10256038 | Ga0207698_102560381 | 83 |
| 274 | 3300046454 | Ga0495592_0010622 | Ga0495592_0010622_5905_6162 | 83 |
| 275 | 3300053118 | Ga0500594_0007088 | Ga0500594_0007088_2170_2427 | 83 |
| 276 | 3300003316 | rootH1_10058930 | rootH1_100589302 | 89 |
| 277 | 3300003322 | rootL2_10044705 | rootL2_100447058 | 89 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1n91-assembly1.cif.gz_A | solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. | 0.8003 | 3 | 74 |
| 1yh5-assembly1.cif.gz_A | solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. | 0.7878 | 3 | 72 |
| 4r8g-assembly1.cif.gz_E | crystal structure of myosin-1c tail in complex with calmodulin | 0.7814 | 6 | 32 |
| 6u6r-assembly1.cif.gz_B | solution nmr structure of the delta30-ngmine protein from neisseria gonorrheae | 0.6992 | 39 | 73 |
| 8p5d-assembly1.cif.gz_SY0 | spraguea lophii ribosome in the closed conformation by cryo sub tomogram averaging | 0.692 | 40 | 74 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1NJE4_134_231_3.30.1200.10 | Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like | 0.9286 | 3 | 72 | 3.30.1200.10 |
| af_P52060_1_96_3.30.1200.10 | Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like | 0.8993 | 3 | 74 | 3.30.1200.10 |
| af_Q09EE9_24_127_3.30.1200.10 | Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like | 0.892 | 3 | 76 | 3.30.1200.10 |
| af_Q8IKR0_45_147_3.30.1200.10 | Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like | 0.8848 | 3 | 73 | 3.30.1200.10 |
| af_Q54UW1_9_121_3.30.1200.10 | Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like | 0.8821 | 3 | 78 | 3.30.1200.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V7WVW9-F1-model_v4 | UPF0235 protein F9K36_12090 | 0.9647 | 3 | 73 |
GO:0005737
|
| AF-A0A1M7GYU5-F1-model_v4 | UPF0235 protein SAMN05428972_2876 | 0.9635 | 3 | 72 |
GO:0005737
|
| AF-A0A515DF96-F1-model_v4 | UPF0235 protein EUB48_18565 | 0.9619 | 3 | 72 |
GO:0005737
|
| AF-A0A2W4QYB8-F1-model_v4 | UPF0235 protein DIU56_14480 | 0.9614 | 1 | 73 |
GO:0005737
|
| AF-A0A7X1E328-F1-model_v4 | UPF0235 protein H5P30_01825 | 0.9602 | 1 | 74 |
GO:0005737
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar