F381299

General Info

Members Datasets Scaffolds Average Seq Length
276 140 275 314

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0060752|Ga0466963_0060752_1493_2506
Length 337
Sequence MDEPILDCLIVGGGPAGLTAAIYLARFHLDIMVVDAAKSRASWIPCTRNVSGFTDGIEGSELLKRMREQACKYGAKIETEFVTRLERDSETGLFTATWGSGEASARTVLIATGVTNRRPPMDEDLHDDALSRGLVRYCPICDGYEVTDKRVGVIGSDHHGVAEALFIRTYTADVTLIAPDKALRLGPEDQQKLRDAGIGCVDGPAQAVAITGECIVVDTAEGHHTFDSIYPALGSDTHTQLAEMVGADLSNDSCIKVDRHQRTSVPGLYAAGDVVIGLDQISHSMGEGGVAATTIRNDLCAEEPRWREPVRNAEPGSASILETSGANEKVDPETRSG

Samples

Sample ID Description Type Environment
1 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
111 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
112 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
122 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
123 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
137 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
138 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
139 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
140 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.45
Nodule 0
Rhizoplane 3.99
Rhizosphere 94.2
Stem 0
Stem Tuber 0.36
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1005991 3300001976 Bacteria 1588
2 JGI24740J21852_10000621 3300001979 Bacteria 15327
3 Ga0070658_10017088 3300005327 Bacteria 5806
4 Ga0070658_10017240 3300005327 Bacteria 5779
5 Ga0070658_10067829 3300005327 Bacteria 2915
6 Ga0070658_10092061 3300005327 Bacteria 2499
7 Ga0070676_10101643 3300005328 Bacteria 1777
8 Ga0070683_100037662 3300005329 Bacteria 4427
9 Ga0070683_100225685 3300005329 Bacteria 1780
10 Ga0070670_100000994 3300005331 Bacteria 22292
11 Ga0070670_100049902 3300005331 Bacteria 3598
12 Ga0070670_100157151 3300005331 Bacteria 1970
13 Ga0070670_100162261 3300005331 Bacteria 1937
14 Ga0070677_10000238 3300005333 Bacteria 19104
15 Ga0070677_10014810 3300005333 Bacteria 2752
16 Ga0070677_10053869 3300005333 Bacteria 1637
17 Ga0070666_10021079 3300005335 Bacteria 4221
18 Ga0070680_100028836 3300005336 Bacteria 4454
19 Ga0068868_100000011 3300005338 Bacteria 117273
20 Ga0070660_100041322 3300005339 Bacteria 3514
21 Ga0070660_100084025 3300005339 Bacteria 2502
22 Ga0070660_100337732 3300005339 Bacteria 1239
23 Ga0070660_100363800 3300005339 Bacteria 1192
24 Ga0070661_100013912 3300005344 Bacteria 5655
25 Ga0070661_100068731 3300005344 Bacteria 2603
26 Ga0070661_100173812 3300005344 Bacteria 1637
27 Ga0070692_10007846 3300005345 Bacteria 4730
28 Ga0070692_10048452 3300005345 Bacteria 2201
29 Ga0070668_100014936 3300005347 Bacteria 5806
30 Ga0070668_100038266 3300005347 Bacteria 3666
31 Ga0070669_100092947 3300005353 Bacteria 2265
32 Ga0070675_100000558 3300005354 Bacteria 25638
33 Ga0070675_100002071 3300005354 Bacteria 14862
34 Ga0070671_100000735 3300005355 Bacteria 23442
35 Ga0070671_100002920 3300005355 Bacteria 13291
36 Ga0070671_100038332 3300005355 Bacteria 3978
37 Ga0070674_100023051 3300005356 Bacteria 4023
38 Ga0070659_100000376 3300005366 Bacteria 33719
39 Ga0070659_100073427 3300005366 Bacteria 2723
40 Ga0070659_100078653 3300005366 Bacteria 2631
41 Ga0070659_100115424 3300005366 Bacteria 2170
42 Ga0070659_100120336 3300005366 Bacteria 2126
43 Ga0070667_100144096 3300005367 Bacteria 2088
44 Ga0070667_100192736 3300005367 Bacteria 1806
45 Ga0070663_100000915 3300005455 Bacteria 16017
46 Ga0070678_100012936 3300005456 Bacteria 5211
47 Ga0070678_100190943 3300005456 Bacteria 1684
48 Ga0070662_100023237 3300005457 Bacteria 4257
49 Ga0070662_100042132 3300005457 Bacteria 3260
50 Ga0070662_100043436 3300005457 Bacteria 3216
51 Ga0070662_100055402 3300005457 Bacteria 2876
52 Ga0070681_10107574 3300005458 Bacteria 2729
53 Ga0070685_10259307 3300005466 Bacteria 1155
54 Ga0070679_100003261 3300005530 Bacteria 14838
55 Ga0070679_100095265 3300005530 Bacteria 2964
56 Ga0070679_100347626 3300005530 Bacteria 1431
57 Ga0070684_100112231 3300005535 Bacteria 2445
58 Ga0068853_100199376 3300005539 Bacteria 1821
59 Ga0068853_100463873 3300005539 Bacteria 1192
60 Ga0070672_100012664 3300005543 Bacteria 5934
61 Ga0070672_100095908 3300005543 Bacteria 2399
62 Ga0070686_100001769 3300005544 Bacteria 12073
63 Ga0070696_100118544 3300005546 Bacteria 1913
64 Ga0070665_100015884 3300005548 Bacteria 7555
65 Ga0070665_100113726 3300005548 Bacteria 2709
66 Ga0068855_100039779 3300005563 Bacteria 5581
67 Ga0070664_100001417 3300005564 Bacteria 19129
68 Ga0070664_100002920 3300005564 Bacteria 13834
69 Ga0070664_100012124 3300005564 Bacteria 7001
70 Ga0070664_100081658 3300005564 Bacteria 2786
71 Ga0070664_100219526 3300005564 Bacteria 1700
72 Ga0068857_100027971 3300005577 Bacteria 4972
73 Ga0068857_100070855 3300005577 Bacteria 3105
74 Ga0068856_100071290 3300005614 Bacteria 3439
75 Ga0068856_100087781 3300005614 Bacteria 3092
76 Ga0068852_100004854 3300005616 Bacteria 9549
77 Ga0068852_100043695 3300005616 Bacteria 3801
78 Ga0068864_100034808 3300005618 Bacteria 4285
79 Ga0068851_10061240 3300005834 Bacteria 1929
80 Ga0068863_100017811 3300005841 Bacteria 6799
81 Ga0068858_100141610 3300005842 Bacteria 2258
82 Ga0097621_100034689 3300006237 Bacteria 4026
83 Ga0068871_100031104 3300006358 Bacteria 4206
84 Ga0075434_100185416 3300006871 Bacteria 2101
85 Ga0097620_100092001 3300006931 Bacteria 3084
86 Ga0105240_10335552 3300009093 Bacteria 1719
87 Ga0105248_10003798 3300009177 Bacteria 16740
88 Ga0157373_10041491 3300013100 Bacteria 3292
89 Ga0157373_10064510 3300013100 Bacteria 2592
90 Ga0157371_10087554 3300013102 Bacteria 2205
91 Ga0157371_10130073 3300013102 Bacteria 1791
92 Ga0157370_10059726 3300013104 Bacteria 3623
93 Ga0157370_10116518 3300013104 Bacteria 2495
94 Ga0157370_10259804 3300013104 Bacteria 1605
95 Ga0157369_10269854 3300013105 Bacteria 1773
96 Ga0157378_10029591 3300013297 Bacteria 4836
97 Ga0157372_10695871 3300013307 Bacteria 1183
98 Ga0157375_10287190 3300013308 Bacteria 1808
99 Ga0157380_10076071 3300014326 Bacteria 2730
100 Ga0157380_10302091 3300014326 Bacteria 1475
101 Ga0182008_10048455 3300014497 Bacteria 2110
102 Ga0157379_10017407 3300014968 Bacteria 6330
103 Ga0207682_10000339 3300025893 Bacteria 21362
104 Ga0207682_10005729 3300025893 Bacteria 5039
105 Ga0207682_10030141 3300025893 Bacteria 2172
106 Ga0207680_10018446 3300025903 Bacteria 3709
107 Ga0207647_10025673 3300025904 Bacteria 3866
108 Ga0207645_10159278 3300025907 Bacteria 1476
109 Ga0207705_10000679 3300025909 Bacteria 28173
110 Ga0207705_10003397 3300025909 Bacteria 12105
111 Ga0207705_10015561 3300025909 Bacteria 5459
112 Ga0207705_10076505 3300025909 Bacteria 2433
113 Ga0207660_10019496 3300025917 Bacteria 4535
114 Ga0207660_10103168 3300025917 Bacteria 2133
115 Ga0207657_10071390 3300025919 Bacteria 2940
116 Ga0207657_10075685 3300025919 Bacteria 2840
117 Ga0207657_10082054 3300025919 Bacteria 2707
118 Ga0207649_10132814 3300025920 Bacteria 1693
119 Ga0207649_10158944 3300025920 Bacteria 1564
120 Ga0207652_10000662 3300025921 Bacteria 33794
121 Ga0207652_10125424 3300025921 Bacteria 2287
122 Ga0207681_10020896 3300025923 Bacteria 4155
123 Ga0207681_10022847 3300025923 Bacteria 3993
124 Ga0207650_10003194 3300025925 Bacteria 11302
125 Ga0207650_10113576 3300025925 Bacteria 2100
126 Ga0207659_10009005 3300025926 Bacteria 6224
127 Ga0207687_10222722 3300025927 Bacteria 1486
128 Ga0207664_10101672 3300025929 Bacteria 2376
129 Ga0207644_10007602 3300025931 Bacteria 7065
130 Ga0207690_10000001 3300025932 Bacteria 807539
131 Ga0207690_10000002 3300025932 Bacteria 807473
132 Ga0207690_10000003 3300025932 Bacteria 783011
133 Ga0207690_10000004 3300025932 Bacteria 746138
134 Ga0207690_10125444 3300025932 Bacteria 1871
135 Ga0207690_10193829 3300025932 Bacteria 1538
136 Ga0207706_10062282 3300025933 Bacteria 3285
137 Ga0207706_10073278 3300025933 Bacteria 3011
138 Ga0207706_10113568 3300025933 Bacteria 2382
139 Ga0207706_10134419 3300025933 Bacteria 2176
140 Ga0207669_10032326 3300025937 Bacteria 2937
141 Ga0207691_10032671 3300025940 Bacteria 4851
142 Ga0207691_10062153 3300025940 Bacteria 3390
143 Ga0207691_10070138 3300025940 Bacteria 3165
144 Ga0207711_10027073 3300025941 Bacteria 4814
145 Ga0207661_10101094 3300025944 Bacteria 2421
146 Ga0207667_10013429 3300025949 Bacteria 9371
147 Ga0207668_10027131 3300025972 Bacteria 3729
148 Ga0207668_10142300 3300025972 Bacteria 1846
149 Ga0207668_10270543 3300025972 Bacteria 1389
150 Ga0207658_10113574 3300025986 Bacteria 2146
151 Ga0207677_10000217 3300026023 Bacteria 45841
152 Ga0207678_10001365 3300026067 Bacteria 22501
153 Ga0207678_10088490 3300026067 Bacteria 2646
154 Ga0207702_10058511 3300026078 Bacteria 3280
155 Ga0207702_10064030 3300026078 Bacteria 3146
156 Ga0207641_10126239 3300026088 Bacteria 2291
157 Ga0207641_10168932 3300026088 Bacteria 1994
158 Ga0207674_10005768 3300026116 Bacteria 14688
159 Ga0207674_10449990 3300026116 Bacteria 1245
160 Ga0207683_10025409 3300026121 Bacteria 5110
161 Ga0207683_10197339 3300026121 Bacteria 1829
162 Ga0207683_10327867 3300026121 Bacteria 1403
163 Ga0207698_10060884 3300026142 Bacteria 2938
164 Ga0268266_10011844 3300028379 Bacteria 7557
165 Ga0268266_10203012 3300028379 Bacteria 1815
166 Ga0268264_10008487 3300028381 Bacteria 8542
167 Ga0268264_10297561 3300028381 Bacteria 1518
168 Ga0307405_10116262 3300031731 Bacteria 1821
169 Ga0307413_10096176 3300031824 Bacteria 1943
170 Ga0307413_10207833 3300031824 Bacteria 1419
171 Ga0307410_10007933 3300031852 Bacteria 5852
172 Ga0307410_10010904 3300031852 Bacteria 5173
173 Ga0307406_10100520 3300031901 Bacteria 1969
174 Ga0307407_10128313 3300031903 Bacteria 1618
175 Ga0307409_100018008 3300031995 Bacteria 4730
176 Ga0307409_100026727 3300031995 Bacteria 4076
177 Ga0307409_100031373 3300031995 Bacteria 3834
178 Ga0307409_100108587 3300031995 Bacteria 2321
179 Ga0307409_100743893 3300031995 Bacteria 984
180 Ga0307416_100057630 3300032002 Bacteria 3144
181 Ga0307416_100071279 3300032002 Bacteria 2886
182 Ga0307416_100106917 3300032002 Bacteria 2454
183 Ga0307414_10123309 3300032004 Bacteria 1997
184 Ga0307414_10147620 3300032004 Bacteria 1850
185 Ga0307414_10245923 3300032004 Bacteria 1484
186 Ga0307411_10009303 3300032005 Bacteria 5157
187 Ga0307415_100097220 3300032126 Bacteria 2148
188 Ga0373946_0062035 3300035171 Bacteria 1593
189 Ga0373947_0018893 3300035725 Bacteria 3971
190 Ga0373925_0010937 3300037068 Bacteria 6588
191 Ga0395899_0002427 3300037312 Bacteria 15158
192 Ga0395899_0002483 3300037312 Bacteria 14966
193 Ga0395899_0050365 3300037312 Bacteria 3092
194 Ga0395899_0058216 3300037312 Bacteria 2850
195 Ga0395899_0095167 3300037312 Bacteria 2155
196 Ga0395899_0100282 3300037312 Bacteria 2091
197 Ga0395899_0132792 3300037312 Bacteria 1776
198 Ga0395900_0010961 3300037418 Bacteria 9268
199 Ga0395900_0028661 3300037418 Bacteria 5706
200 Ga0395900_0037643 3300037418 Bacteria 4987
201 Ga0395900_0057692 3300037418 Bacteria 3997
202 Ga0395900_0129558 3300037418 Bacteria 2586
203 Ga0395900_0130973 3300037418 Bacteria 2570
204 Ga0395900_0143076 3300037418 Bacteria 2448
205 Ga0395900_0194480 3300037418 Bacteria 2055
206 Ga0395900_0472798 3300037418 Bacteria 1207
207 Ga0395898_0010300 3300037466 Bacteria 9783
208 Ga0395898_0069504 3300037466 Bacteria 3407
209 Ga0395898_0115776 3300037466 Bacteria 2568
210 Ga0395898_0176555 3300037466 Bacteria 2042
211 Ga0395898_0194727 3300037466 Bacteria 1937
212 Ga0395898_0200704 3300037466 Bacteria 1904
213 Ga0395905_0003506 3300037471 Bacteria 16738
214 Ga0395905_0005719 3300037471 Bacteria 12641
215 Ga0395905_0024002 3300037471 Bacteria 5757
216 Ga0395905_0070657 3300037471 Bacteria 3272
217 Ga0395905_0105092 3300037471 Bacteria 2651
218 Ga0395905_0171618 3300037471 Bacteria 2037
219 Ga0395905_0225050 3300037471 Bacteria 1755
220 Ga0395905_0232002 3300037471 Bacteria 1726
221 Ga0395905_0238885 3300037471 Bacteria 1698
222 Ga0395905_0250591 3300037471 Bacteria 1654
223 Ga0395905_0425342 3300037471 Bacteria 1224
224 Ga0395905_0559796 3300037471 Bacteria 1044
225 Ga0395901_0025713 3300038443 Bacteria 6043
226 Ga0395901_0029313 3300038443 Bacteria 5665
227 Ga0395901_0037792 3300038443 Bacteria 4993
228 Ga0395901_0064478 3300038443 Bacteria 3814
229 Ga0395901_0135110 3300038443 Bacteria 2592
230 Ga0395901_0140263 3300038443 Bacteria 2540
231 Ga0395901_0680549 3300038443 Bacteria 1028
232 Ga0439432_043355 3300042006 Bacteria 1420
233 Ga0439458_0041311 3300042157 Bacteria 1120
234 Ga0439464_0001497 3300042439 Bacteria 5519
235 Ga0466961_0018395 3300044693 Bacteria 4494
236 Ga0466963_0006732 3300044694 Bacteria 6827
237 Ga0466963_0060752 3300044694 Bacteria 2524
238 Ga0466963_0080874 3300044694 Bacteria 2200
239 Ga0466963_0081770 3300044694 Bacteria 2188
240 Ga0466971_0003413 3300044719 Bacteria 6790
241 Ga0466971_0075928 3300044719 Bacteria 1528
242 Ga0466970_0165807 3300044765 Bacteria 1223
243 Ga0466957_0022632 3300044842 Bacteria 3709
244 Ga0466957_0047233 3300044842 Bacteria 2615
245 Ga0466959_0044902 3300045049 Bacteria 3255
246 Ga0466958_0034045 3300045836 Bacteria 3037
247 Ga0466967_0131569 3300045976 Bacteria 2323
248 Ga0466967_0151737 3300045976 Bacteria 2166
249 Ga0466967_0178188 3300045976 Bacteria 2003
250 Ga0466967_0260705 3300045976 Bacteria 1658
251 Ga0466967_0277590 3300045976 Bacteria 1607
252 Ga0495621_0003803 3300046539 Bacteria 4189
253 Ga0495669_0000565 3300046684 Bacteria 16363
254 Ga0495669_0003488 3300046684 Bacteria 6485
255 Ga0495669_0005546 3300046684 Bacteria 5264
256 Ga0495670_0006082 3300046691 Bacteria 5919
257 Ga0496100_0096383 3300048903 Bacteria 2030
258 Ga0496103_0046256 3300048906 Bacteria 2686
259 Ga0496106_0165742 3300048909 Bacteria 1749
260 Ga0496107_0054971 3300048910 Bacteria 2874
261 Ga0496107_0344787 3300048910 Bacteria 1108
262 Ga0496108_0307978 3300048911 Bacteria 1380
263 Ga0496109_0014017 3300048912 Bacteria 6968
264 Ga0496110_0004463 3300048913 Bacteria 10852
265 Ga0496110_0016722 3300048913 Bacteria 6127
266 Ga0496111_0004698 3300048914 Bacteria 8659
267 Ga0496113_0014119 3300048916 Bacteria 5437
268 Ga0501067_0029365 3300049583 Bacteria 3047
269 Ga0501068_0120630 3300049584 Bacteria 1635
270 nmdc:mga0n895_59366_c1 3300050512 Bacteria 3773
271 Ga0500568_0003001 3300053139 Bacteria 9652
272 Ga0500604_0000112 3300053151 Bacteria 24965
273 Ga0500616_0000261 3300053153 Bacteria 80995
274 Ga0500587_000386 3300053739 Bacteria 5071
275 Ga0466962_0052145 3300061719 Bacteria 1955

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035171 Ga0373946_0062035 Ga0373946_0062035_725_1555 265
2 3300038443 Ga0395901_0680549 Ga0395901_0680549_131_967 275
3 3300005466 Ga0070685_10259307 Ga0070685_102593071 276
4 3300005539 Ga0068853_100463873 Ga0068853_1004638732 296
5 3300046684 Ga0495669_0003488 Ga0495669_0003488_1247_2203 297
6 iso_pu_bacteria 2885427238 2885428359 302
7 3300005327 Ga0070658_10092061 Ga0070658_100920612 304
8 3300005329 Ga0070683_100225685 Ga0070683_1002256853 304
9 3300005331 Ga0070670_100000994 Ga0070670_1000009947 304
10 3300005333 Ga0070677_10053869 Ga0070677_100538692 304
11 3300005335 Ga0070666_10021079 Ga0070666_100210792 304
12 3300005344 Ga0070661_100013912 Ga0070661_1000139126 304
13 3300005354 Ga0070675_100000558 Ga0070675_10000055811 304
14 3300005355 Ga0070671_100000735 Ga0070671_10000073527 304
15 3300005366 Ga0070659_100115424 Ga0070659_1001154243 304
16 3300005457 Ga0070662_100043436 Ga0070662_1000434364 304
17 3300005564 Ga0070664_100001417 Ga0070664_10000141714 304
18 3300005618 Ga0068864_100034808 Ga0068864_1000348084 304
19 3300009177 Ga0105248_10003798 Ga0105248_100037983 304
20 3300013100 Ga0157373_10041491 Ga0157373_100414912 304
21 3300013308 Ga0157375_10287190 Ga0157375_102871902 304
22 3300014326 Ga0157380_10302091 Ga0157380_103020912 304
23 3300025903 Ga0207680_10018446 Ga0207680_100184464 304
24 3300025923 Ga0207681_10020896 Ga0207681_100208964 304
25 3300025925 Ga0207650_10003194 Ga0207650_100031947 304
26 3300025931 Ga0207644_10007602 Ga0207644_100076024 304
27 3300025932 Ga0207690_10125444 Ga0207690_101254442 304
28 3300025933 Ga0207706_10062282 Ga0207706_100622822 304
29 3300025940 Ga0207691_10032671 Ga0207691_100326712 304
30 3300025941 Ga0207711_10027073 Ga0207711_100270734 304
31 3300025972 Ga0207668_10270543 Ga0207668_102705432 304
32 3300025986 Ga0207658_10113574 Ga0207658_101135743 304
33 3300026121 Ga0207683_10327867 Ga0207683_103278672 304
34 3300028379 Ga0268266_10203012 Ga0268266_102030122 304
35 3300031731 Ga0307405_10116262 Ga0307405_101162622 304
36 3300031824 Ga0307413_10096176 Ga0307413_100961762 304
37 3300031852 Ga0307410_10010904 Ga0307410_100109042 304
38 3300031901 Ga0307406_10100520 Ga0307406_101005202 304
39 3300031903 Ga0307407_10128313 Ga0307407_101283131 304
40 3300032002 Ga0307416_100057630 Ga0307416_1000576302 304
41 3300032004 Ga0307414_10245923 Ga0307414_102459231 304
42 3300032126 Ga0307415_100097220 Ga0307415_1000972202 304
43 3300037312 Ga0395899_0058216 Ga0395899_0058216_1167_2081 304
44 3300037418 Ga0395900_0129558 Ga0395900_0129558_888_1802 304
45 3300037418 Ga0395900_0130973 Ga0395900_0130973_782_1696 304
46 3300037466 Ga0395898_0194727 Ga0395898_0194727_444_1358 304
47 3300037471 Ga0395905_0250591 Ga0395905_0250591_626_1540 304
48 3300038443 Ga0395901_0140263 Ga0395901_0140263_921_1835 304
49 3300046684 Ga0495669_0005546 Ga0495669_0005546_3671_4585 304
50 3300048911 Ga0496108_0307978 Ga0496108_0307978_114_1028 304
51 3300048913 Ga0496110_0004463 Ga0496110_0004463_5799_6713 304
52 3300048914 Ga0496111_0004698 Ga0496111_0004698_4831_5745 304
53 3300005333 Ga0070677_10000238 Ga0070677_1000023812 305
54 3300005338 Ga0068868_100000011 Ga0068868_10000001123 305
55 3300005366 Ga0070659_100000376 Ga0070659_10000037622 305
56 3300005544 Ga0070686_100001769 Ga0070686_1000017694 305
57 3300006871 Ga0075434_100185416 Ga0075434_1001854163 305
58 3300025893 Ga0207682_10000339 Ga0207682_100003399 305
59 3300025927 Ga0207687_10222722 Ga0207687_102227221 305
60 3300025932 Ga0207690_10000001 Ga0207690_10000001596 305
61 3300025932 Ga0207690_10000002 Ga0207690_10000002596 305
62 3300025932 Ga0207690_10000003 Ga0207690_10000003596 305
63 3300025932 Ga0207690_10000004 Ga0207690_10000004596 305
64 3300026023 Ga0207677_10000217 Ga0207677_1000021723 305
65 3300031995 Ga0307409_100018008 Ga0307409_1000180084 305
66 3300032002 Ga0307416_100106917 Ga0307416_1001069172 305
67 3300050512 nmdc:mga0n895_59366_c1 nmdc:mga0n895_59366_c1_2492_3412 305
68 3300053139 Ga0500568_0003001 Ga0500568_0003001_1973_2893 305
69 3300053151 Ga0500604_0000112 Ga0500604_0000112_12791_13711 305
70 3300053153 Ga0500616_0000261 Ga0500616_0000261_14073_14993 305
71 3300053739 Ga0500587_000386 Ga0500587_000386_3683_4603 305
72 3300005328 Ga0070676_10101643 Ga0070676_101016432 306
73 3300005331 Ga0070670_100049902 Ga0070670_1000499024 306
74 3300005333 Ga0070677_10014810 Ga0070677_100148101 306
75 3300005347 Ga0070668_100014936 Ga0070668_1000149362 306
76 3300005353 Ga0070669_100092947 Ga0070669_1000929472 306
77 3300005354 Ga0070675_100002071 Ga0070675_10000207111 306
78 3300005356 Ga0070674_100023051 Ga0070674_1000230512 306
79 3300005456 Ga0070678_100190943 Ga0070678_1001909432 306
80 3300005457 Ga0070662_100023237 Ga0070662_1000232374 306
81 3300005543 Ga0070672_100095908 Ga0070672_1000959082 306
82 3300005564 Ga0070664_100219526 Ga0070664_1002195262 306
83 3300006931 Ga0097620_100092001 Ga0097620_1000920014 306
84 3300009093 Ga0105240_10335552 Ga0105240_103355522 306
85 3300013102 Ga0157371_10130073 Ga0157371_101300732 306
86 3300013104 Ga0157370_10116518 Ga0157370_101165184 306
87 3300014326 Ga0157380_10076071 Ga0157380_100760712 306
88 3300025893 Ga0207682_10005729 Ga0207682_100057295 306
89 3300025907 Ga0207645_10159278 Ga0207645_101592782 306
90 3300025919 Ga0207657_10082054 Ga0207657_100820542 306
91 3300025923 Ga0207681_10022847 Ga0207681_100228474 306
92 3300025926 Ga0207659_10009005 Ga0207659_100090058 306
93 3300025933 Ga0207706_10073278 Ga0207706_100732783 306
94 3300025937 Ga0207669_10032326 Ga0207669_100323263 306
95 3300025940 Ga0207691_10070138 Ga0207691_100701384 306
96 3300025972 Ga0207668_10142300 Ga0207668_101423002 306
97 3300026088 Ga0207641_10168932 Ga0207641_101689322 306
98 3300026121 Ga0207683_10197339 Ga0207683_101973392 306
99 3300031995 Ga0307409_100026727 Ga0307409_1000267272 306
100 3300031995 Ga0307409_100031373 Ga0307409_1000313732 306
101 3300031995 Ga0307409_100108587 Ga0307409_1001085872 306
102 3300031995 Ga0307409_100743893 Ga0307409_1007438931 306
103 3300032002 Ga0307416_100071279 Ga0307416_1000712794 306
104 3300032004 Ga0307414_10123309 Ga0307414_101233093 306
105 3300032004 Ga0307414_10147620 Ga0307414_101476202 306
106 3300037312 Ga0395899_0100282 Ga0395899_0100282_961_1920 306
107 3300037312 Ga0395899_0132792 Ga0395899_0132792_695_1654 306
108 3300037418 Ga0395900_0037643 Ga0395900_0037643_3419_4378 306
109 3300037418 Ga0395900_0194480 Ga0395900_0194480_123_1082 306
110 3300037466 Ga0395898_0069504 Ga0395898_0069504_1495_2454 306
111 3300037466 Ga0395898_0115776 Ga0395898_0115776_202_1155 306
112 3300037466 Ga0395898_0200704 Ga0395898_0200704_722_1651 306
113 3300037471 Ga0395905_0425342 Ga0395905_0425342_203_1132 306
114 3300037471 Ga0395905_0559796 Ga0395905_0559796_21_950 306
115 3300038443 Ga0395901_0135110 Ga0395901_0135110_791_1753 306
116 3300042006 Ga0439432_043355 Ga0439432_043355_420_1340 306
117 3300045976 Ga0466967_0131569 Ga0466967_0131569_693_1652 306
118 3300001976 JGI24752J21851_1005991 JGI24752J21851_10059912 307
119 3300001979 JGI24740J21852_10000621 JGI24740J21852_1000062114 307
120 3300005327 Ga0070658_10017088 Ga0070658_100170883 307
121 3300005327 Ga0070658_10017240 Ga0070658_100172405 307
122 3300005327 Ga0070658_10067829 Ga0070658_100678293 307
123 3300005329 Ga0070683_100037662 Ga0070683_1000376623 307
124 3300005331 Ga0070670_100157151 Ga0070670_1001571513 307
125 3300005331 Ga0070670_100162261 Ga0070670_1001622612 307
126 3300005336 Ga0070680_100028836 Ga0070680_1000288363 307
127 3300005339 Ga0070660_100041322 Ga0070660_1000413224 307
128 3300005339 Ga0070660_100084025 Ga0070660_1000840253 307
129 3300005339 Ga0070660_100337732 Ga0070660_1003377321 307
130 3300005339 Ga0070660_100363800 Ga0070660_1003638001 307
131 3300005344 Ga0070661_100068731 Ga0070661_1000687313 307
132 3300005344 Ga0070661_100173812 Ga0070661_1001738122 307
133 3300005345 Ga0070692_10007846 Ga0070692_100078465 307
134 3300005345 Ga0070692_10048452 Ga0070692_100484522 307
135 3300005347 Ga0070668_100038266 Ga0070668_1000382662 307
136 3300005355 Ga0070671_100002920 Ga0070671_10000292014 307
137 3300005355 Ga0070671_100038332 Ga0070671_1000383322 307
138 3300005366 Ga0070659_100073427 Ga0070659_1000734273 307
139 3300005366 Ga0070659_100078653 Ga0070659_1000786533 307
140 3300005366 Ga0070659_100120336 Ga0070659_1001203361 307
141 3300005367 Ga0070667_100144096 Ga0070667_1001440961 307
142 3300005367 Ga0070667_100192736 Ga0070667_1001927362 307
143 3300005455 Ga0070663_100000915 Ga0070663_1000009153 307
144 3300005456 Ga0070678_100012936 Ga0070678_1000129365 307
145 3300005457 Ga0070662_100042132 Ga0070662_1000421324 307
146 3300005457 Ga0070662_100055402 Ga0070662_1000554022 307
147 3300005458 Ga0070681_10107574 Ga0070681_101075742 307
148 3300005530 Ga0070679_100003261 Ga0070679_10000326114 307
149 3300005530 Ga0070679_100095265 Ga0070679_1000952651 307
150 3300005530 Ga0070679_100347626 Ga0070679_1003476261 307
151 3300005535 Ga0070684_100112231 Ga0070684_1001122313 307
152 3300005539 Ga0068853_100199376 Ga0068853_1001993762 307
153 3300005543 Ga0070672_100012664 Ga0070672_1000126643 307
154 3300005546 Ga0070696_100118544 Ga0070696_1001185442 307
155 3300005548 Ga0070665_100015884 Ga0070665_1000158847 307
156 3300005548 Ga0070665_100113726 Ga0070665_1001137264 307
157 3300005563 Ga0068855_100039779 Ga0068855_1000397793 307
158 3300005564 Ga0070664_100002920 Ga0070664_10000292014 307
159 3300005564 Ga0070664_100012124 Ga0070664_1000121246 307
160 3300005564 Ga0070664_100081658 Ga0070664_1000816583 307
161 3300005577 Ga0068857_100027971 Ga0068857_1000279715 307
162 3300005577 Ga0068857_100070855 Ga0068857_1000708553 307
163 3300005614 Ga0068856_100071290 Ga0068856_1000712902 307
164 3300005614 Ga0068856_100087781 Ga0068856_1000877813 307
165 3300005616 Ga0068852_100004854 Ga0068852_1000048542 307
166 3300005616 Ga0068852_100043695 Ga0068852_1000436954 307
167 3300005834 Ga0068851_10061240 Ga0068851_100612402 307
168 3300005841 Ga0068863_100017811 Ga0068863_1000178115 307
169 3300005842 Ga0068858_100141610 Ga0068858_1001416102 307
170 3300006237 Ga0097621_100034689 Ga0097621_1000346894 307
171 3300006358 Ga0068871_100031104 Ga0068871_1000311044 307
172 3300013100 Ga0157373_10064510 Ga0157373_100645103 307
173 3300013102 Ga0157371_10087554 Ga0157371_100875542 307
174 3300013104 Ga0157370_10059726 Ga0157370_100597263 307
175 3300013104 Ga0157370_10259804 Ga0157370_102598043 307
176 3300013105 Ga0157369_10269854 Ga0157369_102698542 307
177 3300013297 Ga0157378_10029591 Ga0157378_100295914 307
178 3300013307 Ga0157372_10695871 Ga0157372_106958711 307
179 3300014497 Ga0182008_10048455 Ga0182008_100484552 307
180 3300014968 Ga0157379_10017407 Ga0157379_100174074 307
181 3300025893 Ga0207682_10030141 Ga0207682_100301412 307
182 3300025904 Ga0207647_10025673 Ga0207647_100256733 307
183 3300025909 Ga0207705_10000679 Ga0207705_1000067922 307
184 3300025909 Ga0207705_10003397 Ga0207705_1000339713 307
185 3300025909 Ga0207705_10015561 Ga0207705_100155614 307
186 3300025909 Ga0207705_10076505 Ga0207705_100765053 307
187 3300025917 Ga0207660_10019496 Ga0207660_100194964 307
188 3300025917 Ga0207660_10103168 Ga0207660_101031682 307
189 3300025919 Ga0207657_10071390 Ga0207657_100713903 307
190 3300025919 Ga0207657_10075685 Ga0207657_100756853 307
191 3300025920 Ga0207649_10132814 Ga0207649_101328142 307
192 3300025920 Ga0207649_10158944 Ga0207649_101589442 307
193 3300025921 Ga0207652_10000662 Ga0207652_100006623 307
194 3300025921 Ga0207652_10125424 Ga0207652_101254243 307
195 3300025925 Ga0207650_10113576 Ga0207650_101135762 307
196 3300025929 Ga0207664_10101672 Ga0207664_101016722 307
197 3300025932 Ga0207690_10193829 Ga0207690_101938292 307
198 3300025933 Ga0207706_10113568 Ga0207706_101135683 307
199 3300025933 Ga0207706_10134419 Ga0207706_101344192 307
200 3300025940 Ga0207691_10062153 Ga0207691_100621533 307
201 3300025944 Ga0207661_10101094 Ga0207661_101010942 307
202 3300025949 Ga0207667_10013429 Ga0207667_100134295 307
203 3300025972 Ga0207668_10027131 Ga0207668_100271313 307
204 3300026067 Ga0207678_10001365 Ga0207678_100013655 307
205 3300026067 Ga0207678_10088490 Ga0207678_100884902 307
206 3300026078 Ga0207702_10058511 Ga0207702_100585114 307
207 3300026078 Ga0207702_10064030 Ga0207702_100640305 307
208 3300026088 Ga0207641_10126239 Ga0207641_101262392 307
209 3300026116 Ga0207674_10005768 Ga0207674_100057682 307
210 3300026116 Ga0207674_10449990 Ga0207674_104499901 307
211 3300026121 Ga0207683_10025409 Ga0207683_100254093 307
212 3300026142 Ga0207698_10060884 Ga0207698_100608842 307
213 3300028379 Ga0268266_10011844 Ga0268266_100118447 307
214 3300028381 Ga0268264_10008487 Ga0268264_100084876 307
215 3300028381 Ga0268264_10297561 Ga0268264_102975612 307
216 3300031824 Ga0307413_10207833 Ga0307413_102078331 307
217 3300031852 Ga0307410_10007933 Ga0307410_100079333 307
218 3300032005 Ga0307411_10009303 Ga0307411_100093035 307
219 3300035725 Ga0373947_0018893 Ga0373947_0018893_1306_2262 307
220 3300037068 Ga0373925_0010937 Ga0373925_0010937_1646_2602 307
221 3300037312 Ga0395899_0002427 Ga0395899_0002427_13158_14108 307
222 3300037312 Ga0395899_0002483 Ga0395899_0002483_153_1127 307
223 3300037312 Ga0395899_0050365 Ga0395899_0050365_62_985 307
224 3300037312 Ga0395899_0095167 Ga0395899_0095167_954_1916 307
225 3300037418 Ga0395900_0010961 Ga0395900_0010961_2993_3967 307
226 3300037418 Ga0395900_0028661 Ga0395900_0028661_741_1703 307
227 3300037418 Ga0395900_0057692 Ga0395900_0057692_2494_3417 307
228 3300037418 Ga0395900_0143076 Ga0395900_0143076_971_1933 307
229 3300037418 Ga0395900_0472798 Ga0395900_0472798_41_1003 307
230 3300037466 Ga0395898_0010300 Ga0395898_0010300_5460_6434 307
231 3300037466 Ga0395898_0176555 Ga0395898_0176555_236_1159 307
232 3300037471 Ga0395905_0003506 Ga0395905_0003506_2993_3967 307
233 3300037471 Ga0395905_0005719 Ga0395905_0005719_9248_10210 307
234 3300037471 Ga0395905_0024002 Ga0395905_0024002_988_1950 307
235 3300037471 Ga0395905_0070657 Ga0395905_0070657_912_1871 307
236 3300037471 Ga0395905_0105092 Ga0395905_0105092_1266_2189 307
237 3300037471 Ga0395905_0171618 Ga0395905_0171618_1045_1968 307
238 3300037471 Ga0395905_0225050 Ga0395905_0225050_24_986 307
239 3300037471 Ga0395905_0232002 Ga0395905_0232002_303_1265 307
240 3300037471 Ga0395905_0238885 Ga0395905_0238885_185_1147 307
241 3300038443 Ga0395901_0025713 Ga0395901_0025713_2335_3309 307
242 3300038443 Ga0395901_0029313 Ga0395901_0029313_1466_2389 307
243 3300038443 Ga0395901_0037792 Ga0395901_0037792_3476_4399 307
244 3300038443 Ga0395901_0064478 Ga0395901_0064478_728_1690 307
245 3300042157 Ga0439458_0041311 Ga0439458_0041311_122_1045 307
246 3300042439 Ga0439464_0001497 Ga0439464_0001497_680_1681 307
247 3300044693 Ga0466961_0018395 Ga0466961_0018395_2878_3840 307
248 3300044694 Ga0466963_0006732 Ga0466963_0006732_5258_6220 307
249 3300044694 Ga0466963_0060752 Ga0466963_0060752_1493_2506 307
250 3300044694 Ga0466963_0080874 Ga0466963_0080874_205_1146 307
251 3300044694 Ga0466963_0081770 Ga0466963_0081770_622_1584 307
252 3300044719 Ga0466971_0003413 Ga0466971_0003413_4943_5905 307
253 3300044719 Ga0466971_0075928 Ga0466971_0075928_139_1101 307
254 3300044765 Ga0466970_0165807 Ga0466970_0165807_29_991 307
255 3300044842 Ga0466957_0022632 Ga0466957_0022632_684_1646 307
256 3300044842 Ga0466957_0047233 Ga0466957_0047233_569_1582 307
257 3300045049 Ga0466959_0044902 Ga0466959_0044902_1984_2946 307
258 3300045836 Ga0466958_0034045 Ga0466958_0034045_682_1644 307
259 3300045976 Ga0466967_0151737 Ga0466967_0151737_475_1437 307
260 3300045976 Ga0466967_0178188 Ga0466967_0178188_380_1342 307
261 3300045976 Ga0466967_0260705 Ga0466967_0260705_571_1533 307
262 3300045976 Ga0466967_0277590 Ga0466967_0277590_68_1027 307
263 3300046539 Ga0495621_0003803 Ga0495621_0003803_186_1148 307
264 3300046684 Ga0495669_0000565 Ga0495669_0000565_10823_11779 307
265 3300046691 Ga0495670_0006082 Ga0495670_0006082_2670_3632 307
266 3300048903 Ga0496100_0096383 Ga0496100_0096383_899_1822 307
267 3300048906 Ga0496103_0046256 Ga0496103_0046256_1041_1964 307
268 3300048909 Ga0496106_0165742 Ga0496106_0165742_92_1015 307
269 3300048910 Ga0496107_0054971 Ga0496107_0054971_1513_2436 307
270 3300048910 Ga0496107_0344787 Ga0496107_0344787_99_1061 307
271 3300048912 Ga0496109_0014017 Ga0496109_0014017_48_971 307
272 3300048913 Ga0496110_0016722 Ga0496110_0016722_2200_3123 307
273 3300048916 Ga0496113_0014119 Ga0496113_0014119_1974_2897 307
274 3300049583 Ga0501067_0029365 Ga0501067_0029365_903_1859 307
275 3300049584 Ga0501068_0120630 Ga0501068_0120630_375_1337 307
276 3300061719 Ga0466962_0052145 Ga0466962_0052145_630_1592 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

10

57

0.91

PF01134

GIDA

Glucose inhibited division protein A

7

70

0.89

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

6

288

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mih-assembly2.cif.gz_E pyranose 2-oxidase from phanerochaete chrysosporium, recombinant h158a mutant 0.8987 3 39
4mif-assembly1.cif.gz_D pyranose 2-oxidase from phanerochaete chrysosporium, wild type from natural source 0.8876 6 39
4mih-assembly2.cif.gz_H pyranose 2-oxidase from phanerochaete chrysosporium, recombinant h158a mutant 0.8654 1 39
1vg0-assembly1.cif.gz_A the crystal structures of the rep-1 protein in complex with monoprenylated rab7 protein 0.8485 1 36
1vg9-assembly3.cif.gz_E the crystal structures of the rep-1 protein in complex with c-terminally truncated rab7 protein 0.8413 1 36
ID Description Score Start End Superfamily
af_O60112_6_422_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9602 6 36 3.30.300.30
af_Q5ADQ8_44_340_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9456 6 36 3.50.50.60
af_Q8LLD4_13_381_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9271 4 36 3.50.50.60
af_Q2G041_6_109_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9023 7 108 3.50.50.60
af_Q58931_2_109_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8924 5 113 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A0F9DBM0-F1-model_v4 FAD/NAD(P)-binding domain-containing protein 0.969 5 108 GO:0016491
AF-A0A520BXH2-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9492 1 108 GO:0016491
AF-W4V5G6-F1-model_v4 Thioredoxin reductase 0.9473 5 108 GO:0016491
AF-A0A0F9DBM0-F1-model_v4 FAD/NAD(P)-binding domain-containing protein 0.9419 5 108 GO:0016491
AF-W4V5G6-F1-model_v4 Thioredoxin reductase 0.9296 5 108 GO:0016491

Feature Viewer

pLDDT pTM Quality
85.95 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map