F381160

General Info

Members Datasets Scaffolds Average Seq Length
276 137 552 151

Family's Representative Sequence

Representative Sequence 3300025916|Ga0207663_10316284|Ga0207663_103162843
Length 153
Sequence MFDELSDLYQQVILDHCKKPRNFHELANPSLFAQGHNPLCGDQLKLYLAMDGDVIKDISFTGSGCAISKASTSMMTAAMKGKTVEEAEKLFDNFHALVSGDDNDVDKNALGSLKVFEGVKEFPARVKCAILAWHTLHAALEGQEEMVSTEGDE

Samples

Sample ID Description Type Environment
1 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
9 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
23 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
32 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
47 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
48 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
49 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
50 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
51 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
52 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
55 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
56 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
57 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
58 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
59 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
65 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
66 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
67 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
68 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
69 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
70 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
71 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
72 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
73 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
74 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
75 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
76 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
77 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
78 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
79 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
80 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
81 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
90 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
97 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
98 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
99 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
136 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
137 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.09
Nodule 0
Rhizoplane 0.36
Rhizosphere 98.19
Stem 0
Stem Tuber 0
Unclassified 16.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207663_10316284 3300025916 Bacteria 1172
2 Ga0070690_100289389 3300005330 Unclassified 1171
3 Ga0070689_100011324 3300005340 Bacteria 6384
4 Ga0070689_100706924 3300005340 Unclassified 880
5 Ga0070713_101167498 3300005436 Unclassified 745
6 Ga0070711_100597421 3300005439 Bacteria 920
7 Ga0068867_100759232 3300005459 Bacteria 861
8 Ga0070684_101478836 3300005535 Unclassified 640
9 Ga0070697_101778307 3300005536 Unclassified 551
10 Ga0070686_100926198 3300005544 Unclassified 710
11 Ga0068855_100025135 3300005563 Bacteria 7130
12 Ga0068855_100041077 3300005563 Bacteria 5484
13 Ga0068855_100051886 3300005563 Bacteria 4831
14 Ga0068857_100216060 3300005577 Bacteria 1750
15 Ga0068856_100006093 3300005614 Bacteria 11843
16 Ga0068856_100057575 3300005614 Bacteria 3837
17 Ga0068856_100976921 3300005614 Unclassified 865
18 Ga0068859_100310424 3300005617 Bacteria 1671
19 Ga0068859_100353138 3300005617 Bacteria 1565
20 Ga0068864_100109877 3300005618 Bacteria 2455
21 Ga0068864_100941771 3300005618 Unclassified 854
22 Ga0068863_100527563 3300005841 Bacteria 1165
23 Ga0068863_100540104 3300005841 Bacteria 1150
24 Ga0068858_100427750 3300005842 Bacteria 1274
25 Ga0097621_100825480 3300006237 Bacteria 860
26 Ga0068871_100649290 3300006358 Bacteria 963
27 Ga0068871_100810979 3300006358 Unclassified 863
28 Ga0075431_101388759 3300006847 Unclassified 662
29 Ga0068865_101210989 3300006881 Unclassified 669
30 Ga0097620_100310423 3300006931 Bacteria 1671
31 Ga0097620_100353146 3300006931 Bacteria 1565
32 Ga0075435_101066197 3300007076 Bacteria 706
33 Ga0099794_10604305 3300007265 Unclassified 581
34 Ga0105240_10135395 3300009093 Bacteria 2951
35 Ga0105248_10217007 3300009177 Bacteria 2154
36 Ga0105248_11858568 3300009177 Bacteria 683
37 Ga0105239_11721365 3300010375 Bacteria 726
38 Ga0157374_10350060 3300013296 Bacteria 1468
39 Ga0157375_10000083 3300013308 Bacteria 94512
40 Ga0163163_10007925 3300014325 Bacteria 9390
41 Ga0157380_10137199 3300014326 Bacteria 2096
42 Ga0157376_10504161 3300014969 Bacteria 1190
43 Ga0207680_10155385 3300025903 Bacteria 1529
44 Ga0207695_10105840 3300025913 Bacteria 2800
45 Ga0207693_10706821 3300025915 Bacteria 780
46 Ga0207694_10113947 3300025924 Bacteria 2153
47 Ga0207700_11367020 3300025928 Unclassified 630
48 Ga0207686_10060949 3300025934 Bacteria 2390
49 Ga0207670_10013018 3300025936 Bacteria 4891
50 Ga0207670_11173019 3300025936 Unclassified 650
51 Ga0207667_10065683 3300025949 Bacteria 3783
52 Ga0207667_10110315 3300025949 Bacteria 2838
53 Ga0207667_10115290 3300025949 Bacteria 2769
54 Ga0207703_10339765 3300026035 Bacteria 1380
55 Ga0207703_10357571 3300026035 Bacteria 1346
56 Ga0207702_10000407 3300026078 Bacteria 49121
57 Ga0207702_10322624 3300026078 Bacteria 1471
58 Ga0207641_10306878 3300026088 Bacteria 1501
59 Ga0207676_10029727 3300026095 Bacteria 4094
60 Ga0207676_11135891 3300026095 Bacteria 773
61 Ga0207674_10697318 3300026116 Bacteria 980
62 Ga0268264_11484080 3300028381 Unclassified 689
63 Ga0265337_1000035 3300028556 Bacteria 58448
64 Ga0265337_1001080 3300028556 Bacteria 14061
65 Ga0265337_1003143 3300028556 Bacteria 7273
66 Ga0265337_1004765 3300028556 Bacteria 5556
67 Ga0265337_1016109 3300028556 Bacteria 2426
68 Ga0265337_1055236 3300028556 Bacteria 1110
69 Ga0265337_1065940 3300028556 Bacteria 998
70 Ga0265337_1091921 3300028556 Bacteria 827
71 Ga0265326_10006108 3300028558 Bacteria 3761
72 Ga0265326_10135434 3300028558 Unclassified 702
73 Ga0265326_10245433 3300028558 Unclassified 517
74 Ga0265319_1000004 3300028563 Bacteria 305085
75 Ga0265319_1021137 3300028563 Bacteria 2395
76 Ga0265319_1063128 3300028563 Unclassified 1198
77 Ga0265319_1175996 3300028563 Unclassified 659
78 Ga0265334_10004225 3300028573 Bacteria 6407
79 Ga0265334_10105276 3300028573 Unclassified 1018
80 Ga0265334_10184147 3300028573 Bacteria 729
81 Ga0265323_10000147 3300028653 Bacteria 41074
82 Ga0265323_10017225 3300028653 Bacteria 2808
83 Ga0265323_10039415 3300028653 Bacteria 1723
84 Ga0265323_10045488 3300028653 Bacteria 1577
85 Ga0265322_10007218 3300028654 Bacteria 3252
86 Ga0265322_10128014 3300028654 Bacteria 724
87 Ga0265336_10000858 3300028666 Bacteria 15798
88 Ga0265336_10005386 3300028666 Bacteria 4725
89 Ga0265336_10005809 3300028666 Bacteria 4513
90 Ga0265336_10011344 3300028666 Bacteria 3034
91 Ga0265336_10073438 3300028666 Bacteria 1022
92 Ga0265336_10209865 3300028666 Unclassified 578
93 Ga0265338_10000208 3300028800 Bacteria 109817
94 Ga0265338_10000670 3300028800 Bacteria 59227
95 Ga0265338_10001089 3300028800 Bacteria 45131
96 Ga0265338_10002163 3300028800 Bacteria 30175
97 Ga0265338_10004881 3300028800 Bacteria 17863
98 Ga0265338_10004907 3300028800 Bacteria 17796
99 Ga0265338_10005173 3300028800 Bacteria 17135
100 Ga0265338_10010723 3300028800 Bacteria 10698
101 Ga0265338_10012715 3300028800 Bacteria 9575
102 Ga0265338_10014150 3300028800 Bacteria 8918
103 Ga0265338_10016055 3300028800 Bacteria 8175
104 Ga0265338_10036462 3300028800 Bacteria 4705
105 Ga0265338_10075626 3300028800 Bacteria 2857
106 Ga0265338_10085122 3300028800 Bacteria 2636
107 Ga0265338_10105614 3300028800 Bacteria 2282
108 Ga0265338_10124997 3300028800 Bacteria 2042
109 Ga0265338_10235607 3300028800 Bacteria 1359
110 Ga0265338_10263284 3300028800 Unclassified 1266
111 Ga0265338_10316918 3300028800 Bacteria 1130
112 Ga0265338_10332918 3300028800 Unclassified 1096
113 Ga0265338_10524188 3300028800 Unclassified 832
114 Ga0265338_10931280 3300028800 Bacteria 590
115 Ga0265324_10000146 3300029957 Bacteria 54469
116 Ga0265324_10008600 3300029957 Bacteria 4046
117 Ga0265324_10015364 3300029957 Bacteria 2817
118 Ga0265324_10015917 3300029957 Bacteria 2759
119 Ga0265324_10017308 3300029957 Bacteria 2622
120 Ga0265324_10042039 3300029957 Bacteria 1581
121 Ga0265324_10127613 3300029957 Bacteria 863
122 Ga0265324_10128240 3300029957 Bacteria 861
123 Ga0265324_10321101 3300029957 Unclassified 527
124 Ga0265320_10000755 3300031240 Bacteria 24856
125 Ga0265320_10002426 3300031240 Bacteria 12990
126 Ga0265320_10003522 3300031240 Bacteria 10485
127 Ga0265320_10007377 3300031240 Bacteria 6829
128 Ga0265320_10018357 3300031240 Bacteria 3854
129 Ga0265320_10053414 3300031240 Bacteria 1953
130 Ga0265325_10005452 3300031241 Bacteria 7850
131 Ga0265325_10018347 3300031241 Bacteria 3878
132 Ga0265325_10021714 3300031241 Bacteria 3521
133 Ga0265340_10032811 3300031247 Bacteria 2590
134 Ga0265340_10088227 3300031247 Bacteria 1453
135 Ga0265339_10020001 3300031249 Bacteria 3918
136 Ga0265331_10026875 3300031250 Bacteria 2890
137 Ga0265327_10001384 3300031251 Bacteria 30970
138 Ga0265327_10014366 3300031251 Bacteria 5186
139 Ga0265327_10344448 3300031251 Unclassified 651
140 Ga0265316_10007782 3300031344 Bacteria 10035
141 Ga0265316_10008504 3300031344 Bacteria 9520
142 Ga0265316_10062343 3300031344 Bacteria 2894
143 Ga0265316_10112663 3300031344 Bacteria 2059
144 Ga0265316_10121331 3300031344 Bacteria 1974
145 Ga0265316_10270799 3300031344 Bacteria 1243
146 Ga0265316_10437096 3300031344 Bacteria 939
147 Ga0265316_10446146 3300031344 Bacteria 928
148 Ga0265316_10502922 3300031344 Bacteria 865
149 Ga0265316_10856612 3300031344 Unclassified 636
150 Ga0265316_11294259 3300031344 Unclassified 503
151 Ga0265313_10000385 3300031595 Bacteria 47503
152 Ga0265313_10006619 3300031595 Bacteria 8137
153 Ga0265314_10163648 3300031711 Bacteria 1351
154 Ga0265342_10045740 3300031712 Bacteria 2633
155 Ga0265342_10069438 3300031712 Bacteria 2057
156 Ga0373930_0000104 3300034816 Bacteria 8788
157 Ga0373950_0006666 3300034818 Bacteria 1769
158 Ga0373928_0000049 3300035084 Bacteria 20746
159 Ga0373929_0000104 3300035085 Bacteria 13886
160 Ga0373934_0105286 3300035086 Bacteria 1142
161 Ga0373934_0149543 3300035086 Bacteria 956
162 Ga0373944_0000983 3300035089 Bacteria 7064
163 Ga0373949_0000998 3300035090 Bacteria 8749
164 Ga0373951_0001538 3300035091 Bacteria 6036
165 Ga0373951_0054997 3300035091 Unclassified 986
166 Ga0373932_0000001 3300035112 Bacteria 1459067
167 Ga0373939_0392296 3300035114 Bacteria 573
168 Ga0373941_0499960 3300035115 Unclassified 517
169 Ga0373945_0034327 3300035116 Bacteria 1807
170 Ga0373953_0250803 3300035117 Bacteria 769
171 Ga0373954_0009437 3300035118 Bacteria 4292
172 Ga0373954_0071891 3300035118 Bacteria 1645
173 Ga0373956_0440166 3300035119 Unclassified 622
174 Ga0373946_0027669 3300035171 Unclassified 2245
175 Ga0373962_0000005 3300035242 Bacteria 63923
176 Ga0373931_0000008 3300035691 Bacteria 362269
177 Ga0373931_0032148 3300035691 Bacteria 2714
178 Ga0373935_0006254 3300035692 Bacteria 7088
179 Ga0373935_0069843 3300035692 Bacteria 2263
180 Ga0373927_0007134 3300035695 Bacteria 7584
181 Ga0373927_0011057 3300035695 Bacteria 6013
182 Ga0373927_0028084 3300035695 Bacteria 3671
183 Ga0373933_0024106 3300035724 Bacteria 3483
184 Ga0373947_0054754 3300035725 Bacteria 2408
185 Ga0373937_0003612 3300036401 Bacteria 13049
186 Ga0373937_0471427 3300036401 Unclassified 1192
187 Ga0373937_1487196 3300036401 Unclassified 625
188 Ga0373925_0000192 3300037068 Bacteria 66343
189 Ga0373925_0005272 3300037068 Bacteria 9652
190 Ga0373925_0029287 3300037068 Bacteria 4039
191 Ga0373925_0222603 3300037068 Bacteria 1507
192 Ga0373925_0244418 3300037068 Bacteria 1438
193 Ga0373925_1193901 3300037068 Unclassified 625
194 Ga0451800_1078787 3300041459 Bacteria 1263
195 Ga0451835_0431766 3300041492 Unclassified 530
196 Ga0451577_1030305 3300042876 Bacteria 738
197 Ga0453684_0039656 3300044712 Bacteria 6412
198 Ga0453684_0380528 3300044712 Bacteria 1585
199 Ga0451576_0047311 3300045051 Bacteria 4523
200 Ga0451576_0086588 3300045051 Bacteria 3259
201 Ga0451576_0094787 3300045051 Unclassified 3105
202 Ga0451576_0186685 3300045051 Bacteria 2165
203 Ga0451576_0423938 3300045051 Bacteria 1396
204 Ga0451576_0991976 3300045051 Bacteria 880
205 Ga0495592_0333658 3300046454 Bacteria 977
206 Ga0495592_0848505 3300046454 Unclassified 540
207 Ga0495629_0142554 3300046459 Bacteria 1667
208 Ga0495641_0019669 3300046461 Bacteria 3447
209 Ga0495582_0093702 3300046473 Bacteria 1676
210 Ga0495639_0104543 3300046475 Bacteria 1339
211 Ga0495639_0424715 3300046475 Unclassified 673
212 Ga0495662_0150552 3300046476 Bacteria 1146
213 Ga0495664_0564874 3300046477 Bacteria 677
214 Ga0495608_0385589 3300046511 Bacteria 858
215 Ga0495618_0023021 3300046514 Bacteria 3848
216 Ga0495628_0305910 3300046516 Bacteria 1176
217 Ga0495628_0367548 3300046516 Bacteria 1055
218 Ga0495628_0846137 3300046516 Bacteria 638
219 Ga0495630_0000157 3300046517 Bacteria 52826
220 Ga0495630_0077551 3300046517 Bacteria 2505
221 Ga0495630_0132965 3300046517 Bacteria 1890
222 Ga0495630_0690809 3300046517 Unclassified 781
223 Ga0495666_0074579 3300046526 Bacteria 1609
224 Ga0495666_0203045 3300046526 Bacteria 911
225 Ga0495666_0248524 3300046526 Bacteria 810
226 Ga0495640_0097155 3300046533 Bacteria 1937
227 Ga0495640_0134667 3300046533 Bacteria 1597
228 Ga0495640_0168640 3300046533 Bacteria 1399
229 Ga0495586_0000512 3300046535 Bacteria 22881
230 Ga0495586_0002435 3300046535 Bacteria 10094
231 Ga0495586_0091124 3300046535 Bacteria 1684
232 Ga0495586_0202199 3300046535 Bacteria 1126
233 Ga0495587_0082725 3300046536 Bacteria 1860
234 Ga0495622_0003242 3300046557 Bacteria 7701
235 Ga0495667_0064687 3300046559 Bacteria 2392
236 Ga0495667_0443587 3300046559 Unclassified 816
237 Ga0495634_0002565 3300046642 Bacteria 15002
238 Ga0495634_0003587 3300046642 Bacteria 12404
239 Ga0495634_0056716 3300046642 Bacteria 2616
240 Ga0495634_0469800 3300046642 Bacteria 740
241 Ga0495635_0030559 3300046663 Bacteria 3743
242 Ga0495647_0097475 3300046681 Bacteria 1213
243 Ga0495647_0148856 3300046681 Bacteria 1002
244 Ga0495658_0096261 3300046683 Bacteria 1760
245 Ga0495613_0007644 3300046689 Bacteria 8042
246 Ga0495613_0073248 3300046689 Bacteria 2496
247 Ga0495613_0214443 3300046689 Bacteria 1353
248 Ga0495613_0885792 3300046689 Bacteria 578
249 Ga0495624_0070625 3300046690 Bacteria 2174
250 Ga0495581_0275683 3300047315 Bacteria 983
251 Ga0495674_0012956 3300047319 Bacteria 7849
252 Ga0495674_0112551 3300047319 Bacteria 2306
253 Ga0495674_0314212 3300047319 Bacteria 1278
254 Ga0495676_0033312 3300047321 Bacteria 4341
255 Ga0495680_0007781 3300047322 Bacteria 9784
256 Ga0495680_0171680 3300047322 Bacteria 1570
257 Ga0495675_0141546 3300047444 Bacteria 1491
258 Ga0495675_0417741 3300047444 Bacteria 780
259 Ga0495684_0022344 3300047471 Bacteria 4869
260 Ga0495684_0047474 3300047471 Bacteria 3284
261 Ga0501031_0000093 3300049568 Bacteria 47816
262 Ga0501033_0087901 3300049570 Bacteria 2274
263 Ga0501034_1193951 3300049571 Unclassified 640
264 Ga0501036_0073643 3300049572 Bacteria 2888
265 Ga0501038_0346666 3300049574 Bacteria 1157
266 Ga0501039_0551183 3300049575 Bacteria 905
267 Ga0501043_1265907 3300049579 Unclassified 516
268 Ga0501070_0748260 3300049586 Unclassified 770
269 Ga0501080_0047847 3300049742 Bacteria 3981
270 Ga0501035_0065734 3300049822 Bacteria 3219
271 Ga0501035_0094873 3300049822 Bacteria 2623
272 Ga0501044_0024911 3300049823 Bacteria 6345
273 nmdc:mga06r32_1220275_c1 3300050510 Unclassified 698
274 Ga0500650_0039265 3300053098 Bacteria 2181
275 Ga0500595_056042 3300053119 Unclassified 1205
276 Ga0500636_0078107 3300053177 Bacteria 1911
277 Ga0207663_10316284
278 Ga0070690_100289389
279 Ga0070689_100011324
280 Ga0070689_100706924
281 Ga0070713_101167498
282 Ga0070711_100597421
283 Ga0068867_100759232
284 Ga0070684_101478836
285 Ga0070697_101778307
286 Ga0070686_100926198
287 Ga0068855_100025135
288 Ga0068855_100041077
289 Ga0068855_100051886
290 Ga0068857_100216060
291 Ga0068856_100006093
292 Ga0068856_100057575
293 Ga0068856_100976921
294 Ga0068859_100310424
295 Ga0068859_100353138
296 Ga0068864_100109877
297 Ga0068864_100941771
298 Ga0068863_100527563
299 Ga0068863_100540104
300 Ga0068858_100427750
301 Ga0097621_100825480
302 Ga0068871_100649290
303 Ga0068871_100810979
304 Ga0075431_101388759
305 Ga0068865_101210989
306 Ga0097620_100310423
307 Ga0097620_100353146
308 Ga0075435_101066197
309 Ga0099794_10604305
310 Ga0105240_10135395
311 Ga0105248_10217007
312 Ga0105248_11858568
313 Ga0105239_11721365
314 Ga0157374_10350060
315 Ga0157375_10000083
316 Ga0163163_10007925
317 Ga0157380_10137199
318 Ga0157376_10504161
319 Ga0207680_10155385
320 Ga0207695_10105840
321 Ga0207693_10706821
322 Ga0207694_10113947
323 Ga0207700_11367020
324 Ga0207686_10060949
325 Ga0207670_10013018
326 Ga0207670_11173019
327 Ga0207667_10065683
328 Ga0207667_10110315
329 Ga0207667_10115290
330 Ga0207703_10339765
331 Ga0207703_10357571
332 Ga0207702_10000407
333 Ga0207702_10322624
334 Ga0207641_10306878
335 Ga0207676_10029727
336 Ga0207676_11135891
337 Ga0207674_10697318
338 Ga0268264_11484080
339 Ga0265337_1000035
340 Ga0265337_1001080
341 Ga0265337_1003143
342 Ga0265337_1004765
343 Ga0265337_1016109
344 Ga0265337_1055236
345 Ga0265337_1065940
346 Ga0265337_1091921
347 Ga0265326_10006108
348 Ga0265326_10135434
349 Ga0265326_10245433
350 Ga0265319_1000004
351 Ga0265319_1021137
352 Ga0265319_1063128
353 Ga0265319_1175996
354 Ga0265334_10004225
355 Ga0265334_10105276
356 Ga0265334_10184147
357 Ga0265323_10000147
358 Ga0265323_10017225
359 Ga0265323_10039415
360 Ga0265323_10045488
361 Ga0265322_10007218
362 Ga0265322_10128014
363 Ga0265336_10000858
364 Ga0265336_10005386
365 Ga0265336_10005809
366 Ga0265336_10011344
367 Ga0265336_10073438
368 Ga0265336_10209865
369 Ga0265338_10000208
370 Ga0265338_10000670
371 Ga0265338_10001089
372 Ga0265338_10002163
373 Ga0265338_10004881
374 Ga0265338_10004907
375 Ga0265338_10005173
376 Ga0265338_10010723
377 Ga0265338_10012715
378 Ga0265338_10014150
379 Ga0265338_10016055
380 Ga0265338_10036462
381 Ga0265338_10075626
382 Ga0265338_10085122
383 Ga0265338_10105614
384 Ga0265338_10124997
385 Ga0265338_10235607
386 Ga0265338_10263284
387 Ga0265338_10316918
388 Ga0265338_10332918
389 Ga0265338_10524188
390 Ga0265338_10931280
391 Ga0265324_10000146
392 Ga0265324_10008600
393 Ga0265324_10015364
394 Ga0265324_10015917
395 Ga0265324_10017308
396 Ga0265324_10042039
397 Ga0265324_10127613
398 Ga0265324_10128240
399 Ga0265324_10321101
400 Ga0265320_10000755
401 Ga0265320_10002426
402 Ga0265320_10003522
403 Ga0265320_10007377
404 Ga0265320_10018357
405 Ga0265320_10053414
406 Ga0265325_10005452
407 Ga0265325_10018347
408 Ga0265325_10021714
409 Ga0265340_10032811
410 Ga0265340_10088227
411 Ga0265339_10020001
412 Ga0265331_10026875
413 Ga0265327_10001384
414 Ga0265327_10014366
415 Ga0265327_10344448
416 Ga0265316_10007782
417 Ga0265316_10008504
418 Ga0265316_10062343
419 Ga0265316_10112663
420 Ga0265316_10121331
421 Ga0265316_10270799
422 Ga0265316_10437096
423 Ga0265316_10446146
424 Ga0265316_10502922
425 Ga0265316_10856612
426 Ga0265316_11294259
427 Ga0265313_10000385
428 Ga0265313_10006619
429 Ga0265314_10163648
430 Ga0265342_10045740
431 Ga0265342_10069438
432 Ga0373930_0000104
433 Ga0373950_0006666
434 Ga0373928_0000049
435 Ga0373929_0000104
436 Ga0373934_0105286
437 Ga0373934_0149543
438 Ga0373944_0000983
439 Ga0373949_0000998
440 Ga0373951_0001538
441 Ga0373951_0054997
442 Ga0373932_0000001
443 Ga0373939_0392296
444 Ga0373941_0499960
445 Ga0373945_0034327
446 Ga0373953_0250803
447 Ga0373954_0009437
448 Ga0373954_0071891
449 Ga0373956_0440166
450 Ga0373946_0027669
451 Ga0373962_0000005
452 Ga0373931_0000008
453 Ga0373931_0032148
454 Ga0373935_0006254
455 Ga0373935_0069843
456 Ga0373927_0007134
457 Ga0373927_0011057
458 Ga0373927_0028084
459 Ga0373933_0024106
460 Ga0373947_0054754
461 Ga0373937_0003612
462 Ga0373937_0471427
463 Ga0373937_1487196
464 Ga0373925_0000192
465 Ga0373925_0005272
466 Ga0373925_0029287
467 Ga0373925_0222603
468 Ga0373925_0244418
469 Ga0373925_1193901
470 Ga0451800_1078787
471 Ga0451835_0431766
472 Ga0451577_1030305
473 Ga0453684_0039656
474 Ga0453684_0380528
475 Ga0451576_0047311
476 Ga0451576_0086588
477 Ga0451576_0094787
478 Ga0451576_0186685
479 Ga0451576_0423938
480 Ga0451576_0991976
481 Ga0495592_0333658
482 Ga0495592_0848505
483 Ga0495629_0142554
484 Ga0495641_0019669
485 Ga0495582_0093702
486 Ga0495639_0104543
487 Ga0495639_0424715
488 Ga0495662_0150552
489 Ga0495664_0564874
490 Ga0495608_0385589
491 Ga0495618_0023021
492 Ga0495628_0305910
493 Ga0495628_0367548
494 Ga0495628_0846137
495 Ga0495630_0000157
496 Ga0495630_0077551
497 Ga0495630_0132965
498 Ga0495630_0690809
499 Ga0495666_0074579
500 Ga0495666_0203045
501 Ga0495666_0248524
502 Ga0495640_0097155
503 Ga0495640_0134667
504 Ga0495640_0168640
505 Ga0495586_0000512
506 Ga0495586_0002435
507 Ga0495586_0091124
508 Ga0495586_0202199
509 Ga0495587_0082725
510 Ga0495622_0003242
511 Ga0495667_0064687
512 Ga0495667_0443587
513 Ga0495634_0002565
514 Ga0495634_0003587
515 Ga0495634_0056716
516 Ga0495634_0469800
517 Ga0495635_0030559
518 Ga0495647_0097475
519 Ga0495647_0148856
520 Ga0495658_0096261
521 Ga0495613_0007644
522 Ga0495613_0073248
523 Ga0495613_0214443
524 Ga0495613_0885792
525 Ga0495624_0070625
526 Ga0495581_0275683
527 Ga0495674_0012956
528 Ga0495674_0112551
529 Ga0495674_0314212
530 Ga0495676_0033312
531 Ga0495680_0007781
532 Ga0495680_0171680
533 Ga0495675_0141546
534 Ga0495675_0417741
535 Ga0495684_0022344
536 Ga0495684_0047474
537 Ga0501031_0000093
538 Ga0501033_0087901
539 Ga0501034_1193951
540 Ga0501036_0073643
541 Ga0501038_0346666
542 Ga0501039_0551183
543 Ga0501043_1265907
544 Ga0501070_0748260
545 Ga0501080_0047847
546 Ga0501035_0065734
547 Ga0501035_0094873
548 Ga0501044_0024911
549 nmdc:mga06r32_1220275_c1
550 Ga0500650_0039265
551 Ga0500595_056042
552 Ga0500636_0078107

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01592

NifU_N

NifU-like N terminal domain

8

129

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jzw-assembly2.cif.gz_B crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9253 5 136
6jzw-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9236 5 136
6a6f-assembly1.cif.gz_B crystal structure of putative iron-sulfur cluster assembly scaffold protein for suf system (fisufu) from thermophilic fervidobacterium islandicum aw-1 0.922 8 137
2qq4-assembly2.cif.gz_D crystal structure of iron-sulfur cluster biosynthesis protein iscu (ttha1736) from thermus thermophilus hb8 0.9218 5 137
6jzw-assembly3.cif.gz_C crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9129 5 138
ID Description Score Start End Superfamily
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9259 5 137 3.90.1010.10
af_O53156_2_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9104 5 141 3.90.1010.10
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.894 5 137 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8923 4 136 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8739 4 136 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A0F9IV48-F1-model_v4 NIF system FeS cluster assembly NifU N-terminal domain-containing protein 0.9684 21 147 GO:0005506
GO:0016226
GO:0051536
AF-A0A0F9IV48-F1-model_v4 NIF system FeS cluster assembly NifU N-terminal domain-containing protein 0.961 21 147 GO:0005506
GO:0016226
GO:0051536
AF-A0A0P0G3W8-F1-model_v4 NifU-like protein 0.9556 5 137 GO:0005506
GO:0016226
GO:0051536
AF-T0N290-F1-model_v4 NIF system FeS cluster assembly NifU N-terminal domain-containing protein 0.9552 22 137 GO:0005506
GO:0016226
GO:0051536
AF-A0A317RBB7-F1-model_v4 Nitrogen fixation NifU-like protein 0.9533 5 136 GO:0005506
GO:0016226
GO:0051536

Map