F381095

General Info

Members Datasets Scaffolds Average Seq Length
276 164 276 68

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_13027445|Ga0105238_130274452
Length 84
Sequence VKIDGPIQGRDVENVMSFCDHCEGQRFDRAQVLRILRATRKKLQKPGTRCSVDQSLAMAIEAVRALEIPHLERLEDLGDDQVVH

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
111 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
114 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
115 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
116 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
117 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
118 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
119 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
120 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
121 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
122 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
123 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
148 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
149 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.17
Rhizosphere 97.46
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10727355 3300005290 Bacteria 537
2 Ga0065715_10397867 3300005293 Bacteria 885
3 Ga0065715_10994194 3300005293 Unclassified 547
4 Ga0065707_10540745 3300005295 Bacteria 728
5 Ga0070690_100900303 3300005330 Unclassified 692
6 Ga0070670_100383100 3300005331 Bacteria 1239
7 Ga0070677_10017932 3300005333 Unclassified 2543
8 Ga0070677_10900324 3300005333 Unclassified 511
9 Ga0068869_100042614 3300005334 Unclassified 3255
10 Ga0070660_101570460 3300005339 Unclassified 560
11 Ga0070689_101320776 3300005340 Bacteria 650
12 Ga0070687_100998668 3300005343 Unclassified 606
13 Ga0070669_100075306 3300005353 Bacteria 2503
14 Ga0070669_101226308 3300005353 Bacteria 648
15 Ga0070675_100128874 3300005354 Bacteria 2154
16 Ga0070675_102035802 3300005354 Unclassified 529
17 Ga0070671_101151900 3300005355 Unclassified 682
18 Ga0070674_100144641 3300005356 Bacteria 1788
19 Ga0070673_100207434 3300005364 Bacteria 1690
20 Ga0070673_101398504 3300005364 Unclassified 658
21 Ga0070673_101921985 3300005364 Unclassified 561
22 Ga0070688_100020133 3300005365 Bacteria 3874
23 Ga0070667_101859513 3300005367 Unclassified 567
24 Ga0070667_102252947 3300005367 Bacteria 513
25 Ga0070709_10676022 3300005434 Unclassified 801
26 Ga0070709_10851372 3300005434 Unclassified 718
27 Ga0070700_101352234 3300005441 Unclassified 600
28 Ga0070708_100032855 3300005445 Bacteria 4503
29 Ga0070678_100022927 3300005456 Bacteria 4150
30 Ga0070685_10081427 3300005466 Bacteria 1941
31 Ga0070685_10748699 3300005466 Unclassified 716
32 Ga0070706_100728927 3300005467 Unclassified 919
33 Ga0070706_101621564 3300005467 Bacteria 590
34 Ga0070698_100848506 3300005471 Unclassified 858
35 Ga0070699_100544445 3300005518 Unclassified 1056
36 Ga0070684_100627105 3300005535 Bacteria 1000
37 Ga0068853_101497777 3300005539 Unclassified 653
38 Ga0070672_100714530 3300005543 Unclassified 878
39 Ga0070665_100497058 3300005548 Bacteria 1231
40 Ga0070665_102159450 3300005548 Unclassified 561
41 Ga0070664_102259195 3300005564 Unclassified 516
42 Ga0068852_101054726 3300005616 Bacteria 832
43 Ga0068859_100234908 3300005617 Bacteria 1922
44 Ga0068859_100833535 3300005617 Unclassified 1009
45 Ga0068864_100933697 3300005618 Unclassified 858
46 Ga0068864_101660864 3300005618 Unclassified 643
47 Ga0068861_101654074 3300005719 Bacteria 632
48 Ga0068851_10812706 3300005834 Unclassified 581
49 Ga0068870_10436352 3300005840 Unclassified 860
50 Ga0068863_100552333 3300005841 Bacteria 1137
51 Ga0068863_100721108 3300005841 Unclassified 992
52 Ga0068858_100003770 3300005842 Bacteria 14981
53 Ga0068858_102336667 3300005842 Bacteria 528
54 Ga0068860_101902166 3300005843 Bacteria 617
55 Ga0068860_102581723 3300005843 Unclassified 527
56 Ga0081455_10184140 3300005937 Bacteria 1579
57 Ga0097621_101969824 3300006237 Unclassified 558
58 Ga0075428_100000101 3300006844 Bacteria 71694
59 Ga0075428_100067336 3300006844 Unclassified 3920
60 Ga0075428_100273430 3300006844 Bacteria 1818
61 Ga0075428_100490393 3300006844 Bacteria 1315
62 Ga0075428_101684169 3300006844 Unclassified 662
63 Ga0075428_102063805 3300006844 Unclassified 590
64 Ga0075430_100017978 3300006846 Bacteria 6018
65 Ga0075430_100540444 3300006846 Unclassified 961
66 Ga0075430_100714630 3300006846 Bacteria 826
67 Ga0075433_10025445 3300006852 Bacteria 5003
68 Ga0075433_10084389 3300006852 Bacteria 2804
69 Ga0075433_10430851 3300006852 Bacteria 1163
70 Ga0075434_100007547 3300006871 Bacteria 10075
71 Ga0075434_100013426 3300006871 Bacteria 7794
72 Ga0075434_100200383 3300006871 Bacteria 2016
73 Ga0075434_100287641 3300006871 Bacteria 1664
74 Ga0075434_100562956 3300006871 Bacteria 1159
75 Ga0075429_100030788 3300006880 Bacteria 4663
76 Ga0075429_100537223 3300006880 Bacteria 1025
77 Ga0075429_100544180 3300006880 Bacteria 1017
78 Ga0097620_100234906 3300006931 Bacteria 1922
79 Ga0097620_100833480 3300006931 Unclassified 1009
80 Ga0075435_100064251 3300007076 Bacteria 2982
81 Ga0075435_100124622 3300007076 Bacteria 2152
82 Ga0075435_100162283 3300007076 Unclassified 1883
83 Ga0075435_100682404 3300007076 Bacteria 892
84 Ga0111539_10000315 3300009094 Bacteria 58955
85 Ga0111539_10225607 3300009094 Bacteria 2182
86 Ga0111539_10375500 3300009094 Unclassified 1655
87 Ga0111539_10401215 3300009094 Bacteria 1597
88 Ga0111539_10605921 3300009094 Unclassified 1275
89 Ga0111539_13452953 3300009094 Bacteria 508
90 Ga0105245_11881524 3300009098 Bacteria 651
91 Ga0105247_10013464 3300009101 Bacteria 4906
92 Ga0105247_10107411 3300009101 Unclassified 1792
93 Ga0114129_10133625 3300009147 Bacteria 3406
94 Ga0114129_10274661 3300009147 Bacteria 2254
95 Ga0114129_10279456 3300009147 Bacteria 2231
96 Ga0114129_10407327 3300009147 Bacteria 1791
97 Ga0114129_10543883 3300009147 Bacteria 1511
98 Ga0114129_10688968 3300009147 Bacteria 1315
99 Ga0114129_12550245 3300009147 Bacteria 611
100 Ga0114129_13473828 3300009147 Bacteria 504
101 Ga0105242_10360878 3300009176 Bacteria 1345
102 Ga0105242_10915162 3300009176 Unclassified 878
103 Ga0105248_10034617 3300009177 Bacteria 5650
104 Ga0105248_10315147 3300009177 Bacteria 1762
105 Ga0105248_10371786 3300009177 Bacteria 1609
106 Ga0105248_13106735 3300009177 Bacteria 528
107 Ga0105238_13027445 3300009551 Bacteria 505
108 Ga0105249_10263585 3300009553 Unclassified 1713
109 Ga0157319_1033745 3300012497 Bacteria 566
110 Ga0157374_12712366 3300013296 Bacteria 523
111 Ga0157378_10790072 3300013297 Unclassified 974
112 Ga0163163_12254389 3300014325 Bacteria 604
113 Ga0157380_11313165 3300014326 Unclassified 771
114 Ga0157377_11559572 3300014745 Bacteria 527
115 Ga0157379_10125158 3300014968 Bacteria 2313
116 Ga0157379_12360406 3300014968 Unclassified 530
117 Ga0157376_10152836 3300014969 Bacteria 2083
118 Ga0157376_12546921 3300014969 Bacteria 551
119 Ga0206356_11537359 3300020070 Bacteria 763
120 Ga0207656_10645729 3300025321 Unclassified 541
121 Ga0207682_10047238 3300025893 Unclassified 1772
122 Ga0207642_10402240 3300025899 Unclassified 820
123 Ga0207710_10005992 3300025900 Bacteria 5211
124 Ga0207710_10669843 3300025900 Unclassified 544
125 Ga0207699_10730084 3300025906 Unclassified 726
126 Ga0207645_10631410 3300025907 Unclassified 728
127 Ga0207643_10371896 3300025908 Unclassified 900
128 Ga0207684_11012335 3300025910 Bacteria 695
129 Ga0207662_10907479 3300025918 Unclassified 624
130 Ga0207657_11139524 3300025919 Unclassified 595
131 Ga0207681_10024583 3300025923 Bacteria 3868
132 Ga0207650_11105353 3300025925 Unclassified 675
133 Ga0207659_10403093 3300025926 Bacteria 1144
134 Ga0207687_11505978 3300025927 Bacteria 578
135 Ga0207644_10193402 3300025931 Bacteria 1601
136 Ga0207644_10404297 3300025931 Bacteria 1117
137 Ga0207706_10751740 3300025933 Bacteria 831
138 Ga0207669_10169826 3300025937 Bacteria 1551
139 Ga0207669_10304846 3300025937 Bacteria 1212
140 Ga0207669_11365192 3300025937 Unclassified 603
141 Ga0207711_10427304 3300025941 Bacteria 1232
142 Ga0207711_11642477 3300025941 Bacteria 586
143 Ga0207689_10184476 3300025942 Bacteria 1721
144 Ga0207651_10401354 3300025960 Unclassified 1166
145 Ga0207651_10985847 3300025960 Bacteria 753
146 Ga0207712_10830358 3300025961 Bacteria 814
147 Ga0207712_11031661 3300025961 Bacteria 730
148 Ga0207703_11300484 3300026035 Bacteria 699
149 Ga0207703_11889318 3300026035 Bacteria 573
150 Ga0207708_10525320 3300026075 Bacteria 995
151 Ga0207708_11889021 3300026075 Unclassified 523
152 Ga0207641_11602777 3300026088 Bacteria 653
153 Ga0207676_11162081 3300026095 Unclassified 764
154 Ga0207675_102116490 3300026118 Bacteria 579
155 Ga0207683_10008282 3300026121 Bacteria 8894
156 Ga0207683_11587245 3300026121 Bacteria 603
157 Ga0207698_12333994 3300026142 Unclassified 547
158 Ga0209971_1149229 3300027682 Unclassified 576
159 Ga0207428_10000051 3300027907 Bacteria 176522
160 Ga0207428_10080019 3300027907 Bacteria 2554
161 Ga0207428_11031340 3300027907 Bacteria 577
162 Ga0268266_11739430 3300028379 Unclassified 598
163 Ga0268264_12138200 3300028381 Unclassified 568
164 Ga0307408_100040501 3300031548 Bacteria 3299
165 Ga0307408_100058530 3300031548 Bacteria 2802
166 Ga0307408_100390425 3300031548 Bacteria 1192
167 Ga0307405_10003163 3300031731 Bacteria 7489
168 Ga0307405_10763929 3300031731 Unclassified 806
169 Ga0307405_11637652 3300031731 Unclassified 569
170 Ga0307413_10308155 3300031824 Bacteria 1204
171 Ga0307413_10312675 3300031824 Bacteria 1196
172 Ga0307410_10029124 3300031852 Bacteria 3512
173 Ga0307410_10594654 3300031852 Unclassified 922
174 Ga0307406_10263898 3300031901 Bacteria 1304
175 Ga0307407_10001791 3300031903 Bacteria 8038
176 Ga0307407_11708571 3300031903 Unclassified 501
177 Ga0307412_10002620 3300031911 Bacteria 9990
178 Ga0307409_100071100 3300031995 Bacteria 2765
179 Ga0307409_100132760 3300031995 Bacteria 2131
180 Ga0307409_101410737 3300031995 Bacteria 723
181 Ga0307416_100001377 3300032002 Bacteria 13141
182 Ga0307416_100049182 3300032002 Bacteria 3351
183 Ga0307416_102753178 3300032002 Unclassified 588
184 Ga0307414_10011906 3300032004 Bacteria 5125
185 Ga0307414_10421099 3300032004 Bacteria 1165
186 Ga0307411_10052030 3300032005 Bacteria 2676
187 Ga0307411_10084929 3300032005 Unclassified 2191
188 Ga0307415_100024739 3300032126 Bacteria 3756
189 Ga0307415_100369604 3300032126 Bacteria 1214
190 Ga0307415_101426695 3300032126 Unclassified 660
191 Ga0373940_0138344 3300035088 Bacteria 768
192 Ga0373932_0276983 3300035112 Bacteria 619
193 Ga0436365_0465977 3300039437 Unclassified 893
194 Ga0439453_0127632 3300041408 Bacteria 588
195 Ga0451807_0566257 3300041486 Unclassified 602
196 Ga0450914_005787 3300042118 Bacteria 1061
197 Ga0450920_036086 3300042122 Bacteria 980
198 Ga0450923_074836 3300042125 Bacteria 755
199 Ga0450896_078254 3300042133 Bacteria 554
200 Ga0450906_052952 3300042145 Unclassified 718
201 Ga0439434_0281660 3300042435 Bacteria 572
202 Ga0439444_0142718 3300042437 Unclassified 574
203 Ga0450916_075413 3300042530 Bacteria 568
204 Ga0439440_0111888 3300042993 Unclassified 752
205 Ga0451576_0390992 3300045051 Bacteria 1458
206 Ga0466967_0648017 3300045976 Unclassified 1044
207 Ga0495582_0838266 3300046473 Unclassified 532
208 Ga0495630_0256899 3300046517 Bacteria 1335
209 Ga0495634_0332915 3300046642 Bacteria 912
210 Ga0495635_0120140 3300046663 Bacteria 1793
211 Ga0495658_0241333 3300046683 Bacteria 1135
212 Ga0495658_0572930 3300046683 Unclassified 723
213 Ga0496107_1214679 3300048910 Unclassified 542
214 Ga0496109_1673071 3300048912 Unclassified 570
215 Ga0496110_1566737 3300048913 Unclassified 569
216 Ga0496114_0471502 3300048917 Bacteria 1111
217 Ga0496114_0666185 3300048917 Unclassified 914
218 Ga0501031_0739349 3300049568 Unclassified 631
219 Ga0501033_0192912 3300049570 Unclassified 1457
220 Ga0501036_0047724 3300049572 Bacteria 3626
221 Ga0501040_0126240 3300049576 Unclassified 1797
222 Ga0501041_0060324 3300049577 Unclassified 2322
223 Ga0501042_0216859 3300049578 Unclassified 1380
224 Ga0501043_0996196 3300049579 Unclassified 597
225 Ga0501048_0967622 3300049582 Unclassified 612
226 Ga0501048_1060075 3300049582 Unclassified 583
227 Ga0501072_0184135 3300049588 Bacteria 1666
228 Ga0501072_1530116 3300049588 Bacteria 515
229 Ga0501074_0060514 3300049590 Unclassified 2729
230 Ga0501074_0802715 3300049590 Bacteria 663
231 Ga0501074_1090869 3300049590 Unclassified 561
232 Ga0501075_0447445 3300049591 Unclassified 985
233 Ga0501075_0799591 3300049591 Unclassified 718
234 Ga0501076_0601812 3300049592 Bacteria 907
235 Ga0501076_1146318 3300049592 Unclassified 640
236 Ga0501076_1705655 3300049592 Unclassified 517
237 Ga0501214_033674 3300049659 Bacteria 715
238 Ga0501238_068923 3300049671 Unclassified 548
239 Ga0501248_057257 3300049678 Unclassified 513
240 Ga0501081_0111441 3300049743 Unclassified 1942
241 Ga0501081_0641820 3300049743 Unclassified 796
242 Ga0501081_0757343 3300049743 Unclassified 730
243 Ga0501083_0151742 3300049744 Bacteria 1517
244 Ga0501268_178108 3300049765 Bacteria 505
245 Ga0501045_0047906 3300049824 Unclassified 3114
246 Ga0501045_0236810 3300049824 Bacteria 1359
247 nmdc:mga05p37_1720545_c1 3300050507 Bacteria 610
248 nmdc:mga05p37_349106_c1 3300050507 Bacteria 1742
249 nmdc:mga05p37_445277_c1 3300050507 Unclassified 1501
250 nmdc:mga05p37_53798_c1 3300050507 Bacteria 4951
251 nmdc:mga05p37_557348_c1 3300050507 Bacteria 1303
252 nmdc:mga05p37_973426_c1 3300050507 Bacteria 905
253 nmdc:mga09592_157736_c1 3300050508 Bacteria 1959
254 nmdc:mga09592_1629294_c1 3300050508 Unclassified 522
255 nmdc:mga09592_464701_c1 3300050508 Bacteria 1091
256 nmdc:mga09592_592399_c1 3300050508 Unclassified 950
257 nmdc:mga0qj67_499336_c1 3300050509 Bacteria 978
258 nmdc:mga0qj67_6361_c1 3300050509 Bacteria 8676
259 nmdc:mga0qj67_907701_c1 3300050509 Unclassified 694
260 nmdc:mga06r32_418559_c1 3300050510 Bacteria 1321
261 nmdc:mga06r32_64976_c1 3300050510 Bacteria 3519
262 nmdc:mga08y16_1723932_c1 3300050511 Bacteria 581
263 nmdc:mga08y16_25_c1 3300050511 Bacteria 235789
264 nmdc:mga08y16_43129_c1 3300050511 Bacteria 4726
265 nmdc:mga08y16_524689_c1 3300050511 Bacteria 591
266 nmdc:mga08y16_620492_c1 3300050511 Bacteria 1088
267 nmdc:mga08y16_951069_c1 3300050511 Bacteria 842
268 nmdc:mga0n895_163677_c1 3300050512 Bacteria 2256
269 nmdc:mga0n895_3618_c1 3300050512 Bacteria 12494
270 nmdc:mga0rr50_112987_c1 3300050513 Bacteria 2152
271 nmdc:mga0a205_125843_c1 3300050515 Bacteria 2462
272 nmdc:mga0a205_139888_c1 3300050515 Bacteria 2321
273 nmdc:mga0a205_842_c2 3300050515 Bacteria 15810
274 Ga0495601_1061083 3300053077 Unclassified 508
275 Ga0501082_0221850 3300060353 Bacteria 1645
276 Ga0530510_0084337 3300061734 Bacteria 2314

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_101570460 Ga0070660_1015704601 56
2 3300005354 Ga0070675_102035802 Ga0070675_1020358021 56
3 3300005355 Ga0070671_101151900 Ga0070671_1011519002 56
4 3300005364 Ga0070673_101398504 Ga0070673_1013985042 56
5 3300005535 Ga0070684_100627105 Ga0070684_1006271053 56
6 3300005539 Ga0068853_101497777 Ga0068853_1014977772 56
7 3300005543 Ga0070672_100714530 Ga0070672_1007145302 56
8 3300005616 Ga0068852_101054726 Ga0068852_1010547261 56
9 3300005834 Ga0068851_10812706 Ga0068851_108127061 56
10 3300025321 Ga0207656_10645729 Ga0207656_106457291 56
11 3300025919 Ga0207657_11139524 Ga0207657_111395241 56
12 3300025931 Ga0207644_10193402 Ga0207644_101934024 56
13 3300026142 Ga0207698_12333994 Ga0207698_123339942 56
14 3300048910 Ga0496107_1214679 Ga0496107_1214679_269_472 56
15 3300048912 Ga0496109_1673071 Ga0496109_1673071_131_334 56
16 3300005618 Ga0068864_100933697 Ga0068864_1009336972 58
17 3300005841 Ga0068863_100721108 Ga0068863_1007211083 58
18 3300009177 Ga0105248_10315147 Ga0105248_103151472 58
19 3300025907 Ga0207645_10631410 Ga0207645_106314102 58
20 3300026118 Ga0207675_102116490 Ga0207675_1021164901 63
21 3300009177 Ga0105248_13106735 Ga0105248_131067352 66
22 3300005293 Ga0065715_10994194 Ga0065715_109941942 67
23 3300005331 Ga0070670_100383100 Ga0070670_1003831002 67
24 3300005333 Ga0070677_10017932 Ga0070677_100179323 67
25 3300005343 Ga0070687_100998668 Ga0070687_1009986681 67
26 3300005353 Ga0070669_100075306 Ga0070669_1000753061 67
27 3300005354 Ga0070675_100128874 Ga0070675_1001288743 67
28 3300005356 Ga0070674_100144641 Ga0070674_1001446412 67
29 3300005364 Ga0070673_100207434 Ga0070673_1002074342 67
30 3300005367 Ga0070667_101859513 Ga0070667_1018595131 67
31 3300005441 Ga0070700_101352234 Ga0070700_1013522342 67
32 3300005445 Ga0070708_100032855 Ga0070708_1000328555 67
33 3300005456 Ga0070678_100022927 Ga0070678_1000229274 67
34 3300005466 Ga0070685_10748699 Ga0070685_107486992 67
35 3300005467 Ga0070706_100728927 Ga0070706_1007289271 67
36 3300005471 Ga0070698_100848506 Ga0070698_1008485061 67
37 3300005548 Ga0070665_102159450 Ga0070665_1021594502 67
38 3300005617 Ga0068859_100833535 Ga0068859_1008335352 67
39 3300005840 Ga0068870_10436352 Ga0068870_104363522 67
40 3300006931 Ga0097620_100833480 Ga0097620_1008334802 67
41 3300009176 Ga0105242_10915162 Ga0105242_109151621 67
42 3300009553 Ga0105249_10263585 Ga0105249_102635852 67
43 3300014968 Ga0157379_12360406 Ga0157379_123604061 67
44 3300025893 Ga0207682_10047238 Ga0207682_100472382 67
45 3300025899 Ga0207642_10402240 Ga0207642_104022402 67
46 3300025908 Ga0207643_10371896 Ga0207643_103718962 67
47 3300025918 Ga0207662_10907479 Ga0207662_109074792 67
48 3300025923 Ga0207681_10024583 Ga0207681_100245835 67
49 3300025926 Ga0207659_10403093 Ga0207659_104030932 67
50 3300025937 Ga0207669_10304846 Ga0207669_103048462 67
51 3300025960 Ga0207651_10401354 Ga0207651_104013541 67
52 3300026075 Ga0207708_11889021 Ga0207708_118890211 67
53 3300026121 Ga0207683_10008282 Ga0207683_100082824 67
54 3300028379 Ga0268266_11739430 Ga0268266_117394301 67
55 3300046473 Ga0495582_0838266 Ga0495582_0838266_319_522 67
56 3300046683 Ga0495658_0572930 Ga0495658_0572930_407_610 67
57 3300049678 Ga0501248_057257 Ga0501248_057257_211_414 67
58 3300005434 Ga0070709_10676022 Ga0070709_106760222 68
59 3300005937 Ga0081455_10184140 Ga0081455_101841402 68
60 3300006880 Ga0075429_100537223 Ga0075429_1005372232 68
61 3300009147 Ga0114129_10274661 Ga0114129_102746611 68
62 3300031731 Ga0307405_11637652 Ga0307405_116376522 68
63 3300032002 Ga0307416_102753178 Ga0307416_1027531782 68
64 3300042118 Ga0450914_005787 Ga0450914_005787_527_736 68
65 3300045976 Ga0466967_0648017 Ga0466967_0648017_174_380 68
66 3300050507 nmdc:mga05p37_445277_c1 nmdc:mga05p37_445277_c1_1177_1383 68
67 3300050508 nmdc:mga09592_1629294_c1 nmdc:mga09592_1629294_c1_176_382 68
68 3300050511 nmdc:mga08y16_951069_c1 nmdc:mga08y16_951069_c1_582_791 68
69 3300005290 Ga0065712_10727355 Ga0065712_107273552 69
70 3300005293 Ga0065715_10397867 Ga0065715_103978672 69
71 3300005295 Ga0065707_10540745 Ga0065707_105407451 69
72 3300005330 Ga0070690_100900303 Ga0070690_1009003031 69
73 3300005333 Ga0070677_10900324 Ga0070677_109003241 69
74 3300005334 Ga0068869_100042614 Ga0068869_1000426143 69
75 3300005340 Ga0070689_101320776 Ga0070689_1013207762 69
76 3300005353 Ga0070669_101226308 Ga0070669_1012263081 69
77 3300005364 Ga0070673_101921985 Ga0070673_1019219851 69
78 3300005365 Ga0070688_100020133 Ga0070688_1000201332 69
79 3300005367 Ga0070667_102252947 Ga0070667_1022529471 69
80 3300005434 Ga0070709_10851372 Ga0070709_108513722 69
81 3300005466 Ga0070685_10081427 Ga0070685_100814271 69
82 3300005467 Ga0070706_101621564 Ga0070706_1016215641 69
83 3300005518 Ga0070699_100544445 Ga0070699_1005444451 69
84 3300005548 Ga0070665_100497058 Ga0070665_1004970582 69
85 3300005564 Ga0070664_102259195 Ga0070664_1022591951 69
86 3300005617 Ga0068859_100234908 Ga0068859_1002349082 69
87 3300005618 Ga0068864_101660864 Ga0068864_1016608642 69
88 3300005719 Ga0068861_101654074 Ga0068861_1016540742 69
89 3300005841 Ga0068863_100552333 Ga0068863_1005523332 69
90 3300005842 Ga0068858_100003770 Ga0068858_1000037707 69
91 3300005842 Ga0068858_102336667 Ga0068858_1023366671 69
92 3300005843 Ga0068860_101902166 Ga0068860_1019021661 69
93 3300005843 Ga0068860_102581723 Ga0068860_1025817231 69
94 3300006237 Ga0097621_101969824 Ga0097621_1019698241 69
95 3300006844 Ga0075428_100000101 Ga0075428_10000010157 69
96 3300006844 Ga0075428_100067336 Ga0075428_1000673362 69
97 3300006844 Ga0075428_100273430 Ga0075428_1002734302 69
98 3300006844 Ga0075428_100490393 Ga0075428_1004903932 69
99 3300006844 Ga0075428_101684169 Ga0075428_1016841692 69
100 3300006844 Ga0075428_102063805 Ga0075428_1020638051 69
101 3300006846 Ga0075430_100017978 Ga0075430_1000179781 69
102 3300006846 Ga0075430_100540444 Ga0075430_1005404442 69
103 3300006846 Ga0075430_100714630 Ga0075430_1007146301 69
104 3300006852 Ga0075433_10025445 Ga0075433_100254453 69
105 3300006852 Ga0075433_10084389 Ga0075433_100843893 69
106 3300006852 Ga0075433_10430851 Ga0075433_104308512 69
107 3300006871 Ga0075434_100007547 Ga0075434_1000075473 69
108 3300006871 Ga0075434_100013426 Ga0075434_1000134262 69
109 3300006871 Ga0075434_100200383 Ga0075434_1002003833 69
110 3300006871 Ga0075434_100287641 Ga0075434_1002876412 69
111 3300006871 Ga0075434_100562956 Ga0075434_1005629562 69
112 3300006880 Ga0075429_100030788 Ga0075429_1000307883 69
113 3300006880 Ga0075429_100544180 Ga0075429_1005441802 69
114 3300006931 Ga0097620_100234906 Ga0097620_1002349062 69
115 3300007076 Ga0075435_100064251 Ga0075435_1000642514 69
116 3300007076 Ga0075435_100124622 Ga0075435_1001246223 69
117 3300007076 Ga0075435_100162283 Ga0075435_1001622831 69
118 3300007076 Ga0075435_100682404 Ga0075435_1006824041 69
119 3300009094 Ga0111539_10000315 Ga0111539_1000031513 69
120 3300009094 Ga0111539_10225607 Ga0111539_102256072 69
121 3300009094 Ga0111539_10375500 Ga0111539_103755002 69
122 3300009094 Ga0111539_10401215 Ga0111539_104012151 69
123 3300009094 Ga0111539_10605921 Ga0111539_106059212 69
124 3300009094 Ga0111539_13452953 Ga0111539_134529532 69
125 3300009098 Ga0105245_11881524 Ga0105245_118815241 69
126 3300009101 Ga0105247_10013464 Ga0105247_100134643 69
127 3300009101 Ga0105247_10107411 Ga0105247_101074112 69
128 3300009147 Ga0114129_10133625 Ga0114129_101336252 69
129 3300009147 Ga0114129_10279456 Ga0114129_102794562 69
130 3300009147 Ga0114129_10407327 Ga0114129_104073272 69
131 3300009147 Ga0114129_10543883 Ga0114129_105438832 69
132 3300009147 Ga0114129_10688968 Ga0114129_106889682 69
133 3300009147 Ga0114129_12550245 Ga0114129_125502452 69
134 3300009147 Ga0114129_13473828 Ga0114129_134738281 69
135 3300009176 Ga0105242_10360878 Ga0105242_103608782 69
136 3300009177 Ga0105248_10034617 Ga0105248_100346175 69
137 3300009177 Ga0105248_10371786 Ga0105248_103717861 69
138 3300009551 Ga0105238_13027445 Ga0105238_130274452 69
139 3300012497 Ga0157319_1033745 Ga0157319_10337452 69
140 3300013296 Ga0157374_12712366 Ga0157374_127123661 69
141 3300013297 Ga0157378_10790072 Ga0157378_107900722 69
142 3300014325 Ga0163163_12254389 Ga0163163_122543892 69
143 3300014326 Ga0157380_11313165 Ga0157380_113131652 69
144 3300014745 Ga0157377_11559572 Ga0157377_115595722 69
145 3300014968 Ga0157379_10125158 Ga0157379_101251582 69
146 3300014969 Ga0157376_10152836 Ga0157376_101528361 69
147 3300014969 Ga0157376_12546921 Ga0157376_125469211 69
148 3300020070 Ga0206356_11537359 Ga0206356_115373592 69
149 3300025900 Ga0207710_10005992 Ga0207710_100059922 69
150 3300025900 Ga0207710_10669843 Ga0207710_106698432 69
151 3300025906 Ga0207699_10730084 Ga0207699_107300842 69
152 3300025910 Ga0207684_11012335 Ga0207684_110123352 69
153 3300025925 Ga0207650_11105353 Ga0207650_111053531 69
154 3300025927 Ga0207687_11505978 Ga0207687_115059781 69
155 3300025931 Ga0207644_10404297 Ga0207644_104042972 69
156 3300025933 Ga0207706_10751740 Ga0207706_107517402 69
157 3300025937 Ga0207669_10169826 Ga0207669_101698262 69
158 3300025937 Ga0207669_11365192 Ga0207669_113651922 69
159 3300025941 Ga0207711_10427304 Ga0207711_104273042 69
160 3300025941 Ga0207711_11642477 Ga0207711_116424772 69
161 3300025942 Ga0207689_10184476 Ga0207689_101844762 69
162 3300025960 Ga0207651_10985847 Ga0207651_109858472 69
163 3300025961 Ga0207712_10830358 Ga0207712_108303581 69
164 3300025961 Ga0207712_11031661 Ga0207712_110316612 69
165 3300026035 Ga0207703_11300484 Ga0207703_113004842 69
166 3300026035 Ga0207703_11889318 Ga0207703_118893182 69
167 3300026075 Ga0207708_10525320 Ga0207708_105253202 69
168 3300026088 Ga0207641_11602777 Ga0207641_116027771 69
169 3300026095 Ga0207676_11162081 Ga0207676_111620812 69
170 3300026121 Ga0207683_11587245 Ga0207683_115872451 69
171 3300027682 Ga0209971_1149229 Ga0209971_11492292 69
172 3300027907 Ga0207428_10000051 Ga0207428_1000005140 69
173 3300027907 Ga0207428_10080019 Ga0207428_100800192 69
174 3300027907 Ga0207428_11031340 Ga0207428_110313402 69
175 3300028381 Ga0268264_12138200 Ga0268264_121382001 69
176 3300031548 Ga0307408_100040501 Ga0307408_1000405014 69
177 3300031548 Ga0307408_100058530 Ga0307408_1000585302 69
178 3300031548 Ga0307408_100390425 Ga0307408_1003904252 69
179 3300031731 Ga0307405_10003163 Ga0307405_100031634 69
180 3300031731 Ga0307405_10763929 Ga0307405_107639292 69
181 3300031824 Ga0307413_10308155 Ga0307413_103081551 69
182 3300031824 Ga0307413_10312675 Ga0307413_103126752 69
183 3300031852 Ga0307410_10029124 Ga0307410_100291243 69
184 3300031852 Ga0307410_10594654 Ga0307410_105946542 69
185 3300031901 Ga0307406_10263898 Ga0307406_102638983 69
186 3300031903 Ga0307407_10001791 Ga0307407_100017919 69
187 3300031903 Ga0307407_11708571 Ga0307407_117085711 69
188 3300031911 Ga0307412_10002620 Ga0307412_100026206 69
189 3300031995 Ga0307409_100071100 Ga0307409_1000711003 69
190 3300031995 Ga0307409_100132760 Ga0307409_1001327603 69
191 3300031995 Ga0307409_101410737 Ga0307409_1014107371 69
192 3300032002 Ga0307416_100001377 Ga0307416_1000013777 69
193 3300032002 Ga0307416_100049182 Ga0307416_1000491823 69
194 3300032004 Ga0307414_10011906 Ga0307414_100119065 69
195 3300032004 Ga0307414_10421099 Ga0307414_104210992 69
196 3300032005 Ga0307411_10052030 Ga0307411_100520303 69
197 3300032005 Ga0307411_10084929 Ga0307411_100849292 69
198 3300032126 Ga0307415_100024739 Ga0307415_1000247392 69
199 3300032126 Ga0307415_100369604 Ga0307415_1003696042 69
200 3300032126 Ga0307415_101426695 Ga0307415_1014266952 69
201 3300035088 Ga0373940_0138344 Ga0373940_0138344_157_366 69
202 3300035112 Ga0373932_0276983 Ga0373932_0276983_143_352 69
203 3300039437 Ga0436365_0465977 Ga0436365_0465977_574_783 69
204 3300041408 Ga0439453_0127632 Ga0439453_0127632_87_299 69
205 3300041486 Ga0451807_0566257 Ga0451807_0566257_375_584 69
206 3300042122 Ga0450920_036086 Ga0450920_036086_632_841 69
207 3300042125 Ga0450923_074836 Ga0450923_074836_90_299 69
208 3300042133 Ga0450896_078254 Ga0450896_078254_215_424 69
209 3300042145 Ga0450906_052952 Ga0450906_052952_48_257 69
210 3300042435 Ga0439434_0281660 Ga0439434_0281660_310_519 69
211 3300042437 Ga0439444_0142718 Ga0439444_0142718_144_353 69
212 3300042530 Ga0450916_075413 Ga0450916_075413_280_489 69
213 3300042993 Ga0439440_0111888 Ga0439440_0111888_283_492 69
214 3300045051 Ga0451576_0390992 Ga0451576_0390992_223_432 69
215 3300046517 Ga0495630_0256899 Ga0495630_0256899_349_558 69
216 3300046642 Ga0495634_0332915 Ga0495634_0332915_666_875 69
217 3300046663 Ga0495635_0120140 Ga0495635_0120140_311_520 69
218 3300046683 Ga0495658_0241333 Ga0495658_0241333_395_604 69
219 3300048913 Ga0496110_1566737 Ga0496110_1566737_119_349 69
220 3300048917 Ga0496114_0471502 Ga0496114_0471502_293_502 69
221 3300048917 Ga0496114_0666185 Ga0496114_0666185_158_412 69
222 3300049568 Ga0501031_0739349 Ga0501031_0739349_244_453 69
223 3300049570 Ga0501033_0192912 Ga0501033_0192912_90_299 69
224 3300049572 Ga0501036_0047724 Ga0501036_0047724_1798_2007 69
225 3300049576 Ga0501040_0126240 Ga0501040_0126240_358_567 69
226 3300049577 Ga0501041_0060324 Ga0501041_0060324_1295_1504 69
227 3300049578 Ga0501042_0216859 Ga0501042_0216859_62_271 69
228 3300049579 Ga0501043_0996196 Ga0501043_0996196_281_490 69
229 3300049582 Ga0501048_0967622 Ga0501048_0967622_370_579 69
230 3300049582 Ga0501048_1060075 Ga0501048_1060075_333_542 69
231 3300049588 Ga0501072_0184135 Ga0501072_0184135_233_442 69
232 3300049588 Ga0501072_1530116 Ga0501072_1530116_295_504 69
233 3300049590 Ga0501074_0060514 Ga0501074_0060514_2189_2398 69
234 3300049590 Ga0501074_0802715 Ga0501074_0802715_169_378 69
235 3300049590 Ga0501074_1090869 Ga0501074_1090869_325_534 69
236 3300049591 Ga0501075_0447445 Ga0501075_0447445_491_700 69
237 3300049591 Ga0501075_0799591 Ga0501075_0799591_354_563 69
238 3300049592 Ga0501076_0601812 Ga0501076_0601812_255_464 69
239 3300049592 Ga0501076_1146318 Ga0501076_1146318_260_469 69
240 3300049592 Ga0501076_1705655 Ga0501076_1705655_161_370 69
241 3300049659 Ga0501214_033674 Ga0501214_033674_181_393 69
242 3300049671 Ga0501238_068923 Ga0501238_068923_254_463 69
243 3300049743 Ga0501081_0111441 Ga0501081_0111441_656_865 69
244 3300049743 Ga0501081_0641820 Ga0501081_0641820_98_307 69
245 3300049743 Ga0501081_0757343 Ga0501081_0757343_113_322 69
246 3300049744 Ga0501083_0151742 Ga0501083_0151742_1083_1292 69
247 3300049765 Ga0501268_178108 Ga0501268_178108_131_340 69
248 3300049824 Ga0501045_0047906 Ga0501045_0047906_770_979 69
249 3300049824 Ga0501045_0236810 Ga0501045_0236810_954_1163 69
250 3300050507 nmdc:mga05p37_1720545_c1 nmdc:mga05p37_1720545_c1_151_363 69
251 3300050507 nmdc:mga05p37_349106_c1 nmdc:mga05p37_349106_c1_978_1187 69
252 3300050507 nmdc:mga05p37_53798_c1 nmdc:mga05p37_53798_c1_2258_2467 69
253 3300050507 nmdc:mga05p37_557348_c1 nmdc:mga05p37_557348_c1_241_450 69
254 3300050507 nmdc:mga05p37_973426_c1 nmdc:mga05p37_973426_c1_28_237 69
255 3300050508 nmdc:mga09592_157736_c1 nmdc:mga09592_157736_c1_166_375 69
256 3300050508 nmdc:mga09592_464701_c1 nmdc:mga09592_464701_c1_603_812 69
257 3300050508 nmdc:mga09592_592399_c1 nmdc:mga09592_592399_c1_688_897 69
258 3300050509 nmdc:mga0qj67_499336_c1 nmdc:mga0qj67_499336_c1_684_893 69
259 3300050509 nmdc:mga0qj67_6361_c1 nmdc:mga0qj67_6361_c1_7320_7529 69
260 3300050509 nmdc:mga0qj67_907701_c1 nmdc:mga0qj67_907701_c1_413_622 69
261 3300050510 nmdc:mga06r32_418559_c1 nmdc:mga06r32_418559_c1_67_276 69
262 3300050510 nmdc:mga06r32_64976_c1 nmdc:mga06r32_64976_c1_2592_2801 69
263 3300050511 nmdc:mga08y16_1723932_c1 nmdc:mga08y16_1723932_c1_94_306 69
264 3300050511 nmdc:mga08y16_25_c1 nmdc:mga08y16_25_c1_220365_220574 69
265 3300050511 nmdc:mga08y16_43129_c1 nmdc:mga08y16_43129_c1_3610_3819 69
266 3300050511 nmdc:mga08y16_524689_c1 nmdc:mga08y16_524689_c1_214_423 69
267 3300050511 nmdc:mga08y16_620492_c1 nmdc:mga08y16_620492_c1_608_817 69
268 3300050512 nmdc:mga0n895_163677_c1 nmdc:mga0n895_163677_c1_1036_1245 69
269 3300050512 nmdc:mga0n895_3618_c1 nmdc:mga0n895_3618_c1_6486_6695 69
270 3300050513 nmdc:mga0rr50_112987_c1 nmdc:mga0rr50_112987_c1_1920_2129 69
271 3300050515 nmdc:mga0a205_125843_c1 nmdc:mga0a205_125843_c1_499_708 69
272 3300050515 nmdc:mga0a205_139888_c1 nmdc:mga0a205_139888_c1_398_607 69
273 3300050515 nmdc:mga0a205_842_c2 nmdc:mga0a205_842_c2_9500_9709 69
274 3300053077 Ga0495601_1061083 Ga0495601_1061083_260_469 69
275 3300060353 Ga0501082_0221850 Ga0501082_0221850_48_257 69
276 3300061734 Ga0530510_0084337 Ga0530510_0084337_1637_1846 69

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p4a-assembly1.cif.gz_F structural insights into human co-transcriptional capping - structure 1 0.4822 1 54
6bv7-assembly1.cif.gz_A nmr structure of sodium/calcium exchanger 1 (ncx1) two-helix bundle (thb) domain 0.4685 1 53
7naf-assembly1.cif.gz_R state e2 nucleolar 60s ribosomal biogenesis intermediate - spb1-mtd local model 0.4435 1 51
6bv7-assembly1.cif.gz_A nmr structure of sodium/calcium exchanger 1 (ncx1) two-helix bundle (thb) domain 0.4409 1 53
8p4a-assembly1.cif.gz_F structural insights into human co-transcriptional capping - structure 1 0.3995 1 54
ID Description Score Start End Superfamily
4drbE00 Mainly Alpha;Orthogonal Bundle;Histone, subunit A;Histone, subunit A 0.574 15 52 1.10.20.10
af_Q6P698_1_82_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.5378 8 56 1.10.238.10
af_A0A2R8RSF3_2_287_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.5165 15 52 1.20.1270.60
3nzqB04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4943 17 64 1.10.287.3440
af_Q6DHF1_14_110_1.10.287.1060 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.4741 15 52 1.10.287.1060
ID Description Score Start End GO Terms
AF-A0A2E6ZW96-F1-model_v4 Uncharacterized protein 0.6793 1 69
AF-A0A2E6ZW96-F1-model_v4 Uncharacterized protein 0.6708 1 69
AF-A0A382EVE1-F1-model_v4 L-seryl-tRNA selenium transferase N-terminal domain-containing protein 0.6447 12 69 GO:0004125
AF-A0A2V5L337-F1-model_v4 L-seryl-tRNA(Sec) selenium transferase (EC 2.9.1.1) (Selenocysteine synthase) (Sec synthase) (Selenocysteinyl-tRNA(Sec) synthase) 0.6214 3 69 GO:0001514
GO:0001717
GO:0004125
GO:0005737
AF-A0A2V5LKD2-F1-model_v4 L-seryl-tRNA(Sec) selenium transferase 0.6002 8 69 GO:0016740

Feature Viewer

pLDDT pTM Quality
72.73 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map