F381095
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 276 | 164 | 276 | 68 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_13027445|Ga0105238_130274452 |
| Length | 84 |
| Sequence | VKIDGPIQGRDVENVMSFCDHCEGQRFDRAQVLRILRATRKKLQKPGTRCSVDQSLAMAIEAVRALEIPHLERLEDLGDDQVVH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 36 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 43 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 44 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 58 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 96 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 99 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 100 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 101 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 102 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 103 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 104 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 105 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 106 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 107 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 108 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 109 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 110 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 111 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 112 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 113 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 114 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 115 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 116 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 117 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 118 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 119 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 120 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 121 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 122 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 123 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 124 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 125 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 126 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 132 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 134 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 135 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 148 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 149 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 150 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 153 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.64 |
| Metatranscriptomes | 0.36 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.17 |
| Rhizosphere | 97.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10727355 | 3300005290 | Bacteria | 537 |
| 2 | Ga0065715_10397867 | 3300005293 | Bacteria | 885 |
| 3 | Ga0065715_10994194 | 3300005293 | Unclassified | 547 |
| 4 | Ga0065707_10540745 | 3300005295 | Bacteria | 728 |
| 5 | Ga0070690_100900303 | 3300005330 | Unclassified | 692 |
| 6 | Ga0070670_100383100 | 3300005331 | Bacteria | 1239 |
| 7 | Ga0070677_10017932 | 3300005333 | Unclassified | 2543 |
| 8 | Ga0070677_10900324 | 3300005333 | Unclassified | 511 |
| 9 | Ga0068869_100042614 | 3300005334 | Unclassified | 3255 |
| 10 | Ga0070660_101570460 | 3300005339 | Unclassified | 560 |
| 11 | Ga0070689_101320776 | 3300005340 | Bacteria | 650 |
| 12 | Ga0070687_100998668 | 3300005343 | Unclassified | 606 |
| 13 | Ga0070669_100075306 | 3300005353 | Bacteria | 2503 |
| 14 | Ga0070669_101226308 | 3300005353 | Bacteria | 648 |
| 15 | Ga0070675_100128874 | 3300005354 | Bacteria | 2154 |
| 16 | Ga0070675_102035802 | 3300005354 | Unclassified | 529 |
| 17 | Ga0070671_101151900 | 3300005355 | Unclassified | 682 |
| 18 | Ga0070674_100144641 | 3300005356 | Bacteria | 1788 |
| 19 | Ga0070673_100207434 | 3300005364 | Bacteria | 1690 |
| 20 | Ga0070673_101398504 | 3300005364 | Unclassified | 658 |
| 21 | Ga0070673_101921985 | 3300005364 | Unclassified | 561 |
| 22 | Ga0070688_100020133 | 3300005365 | Bacteria | 3874 |
| 23 | Ga0070667_101859513 | 3300005367 | Unclassified | 567 |
| 24 | Ga0070667_102252947 | 3300005367 | Bacteria | 513 |
| 25 | Ga0070709_10676022 | 3300005434 | Unclassified | 801 |
| 26 | Ga0070709_10851372 | 3300005434 | Unclassified | 718 |
| 27 | Ga0070700_101352234 | 3300005441 | Unclassified | 600 |
| 28 | Ga0070708_100032855 | 3300005445 | Bacteria | 4503 |
| 29 | Ga0070678_100022927 | 3300005456 | Bacteria | 4150 |
| 30 | Ga0070685_10081427 | 3300005466 | Bacteria | 1941 |
| 31 | Ga0070685_10748699 | 3300005466 | Unclassified | 716 |
| 32 | Ga0070706_100728927 | 3300005467 | Unclassified | 919 |
| 33 | Ga0070706_101621564 | 3300005467 | Bacteria | 590 |
| 34 | Ga0070698_100848506 | 3300005471 | Unclassified | 858 |
| 35 | Ga0070699_100544445 | 3300005518 | Unclassified | 1056 |
| 36 | Ga0070684_100627105 | 3300005535 | Bacteria | 1000 |
| 37 | Ga0068853_101497777 | 3300005539 | Unclassified | 653 |
| 38 | Ga0070672_100714530 | 3300005543 | Unclassified | 878 |
| 39 | Ga0070665_100497058 | 3300005548 | Bacteria | 1231 |
| 40 | Ga0070665_102159450 | 3300005548 | Unclassified | 561 |
| 41 | Ga0070664_102259195 | 3300005564 | Unclassified | 516 |
| 42 | Ga0068852_101054726 | 3300005616 | Bacteria | 832 |
| 43 | Ga0068859_100234908 | 3300005617 | Bacteria | 1922 |
| 44 | Ga0068859_100833535 | 3300005617 | Unclassified | 1009 |
| 45 | Ga0068864_100933697 | 3300005618 | Unclassified | 858 |
| 46 | Ga0068864_101660864 | 3300005618 | Unclassified | 643 |
| 47 | Ga0068861_101654074 | 3300005719 | Bacteria | 632 |
| 48 | Ga0068851_10812706 | 3300005834 | Unclassified | 581 |
| 49 | Ga0068870_10436352 | 3300005840 | Unclassified | 860 |
| 50 | Ga0068863_100552333 | 3300005841 | Bacteria | 1137 |
| 51 | Ga0068863_100721108 | 3300005841 | Unclassified | 992 |
| 52 | Ga0068858_100003770 | 3300005842 | Bacteria | 14981 |
| 53 | Ga0068858_102336667 | 3300005842 | Bacteria | 528 |
| 54 | Ga0068860_101902166 | 3300005843 | Bacteria | 617 |
| 55 | Ga0068860_102581723 | 3300005843 | Unclassified | 527 |
| 56 | Ga0081455_10184140 | 3300005937 | Bacteria | 1579 |
| 57 | Ga0097621_101969824 | 3300006237 | Unclassified | 558 |
| 58 | Ga0075428_100000101 | 3300006844 | Bacteria | 71694 |
| 59 | Ga0075428_100067336 | 3300006844 | Unclassified | 3920 |
| 60 | Ga0075428_100273430 | 3300006844 | Bacteria | 1818 |
| 61 | Ga0075428_100490393 | 3300006844 | Bacteria | 1315 |
| 62 | Ga0075428_101684169 | 3300006844 | Unclassified | 662 |
| 63 | Ga0075428_102063805 | 3300006844 | Unclassified | 590 |
| 64 | Ga0075430_100017978 | 3300006846 | Bacteria | 6018 |
| 65 | Ga0075430_100540444 | 3300006846 | Unclassified | 961 |
| 66 | Ga0075430_100714630 | 3300006846 | Bacteria | 826 |
| 67 | Ga0075433_10025445 | 3300006852 | Bacteria | 5003 |
| 68 | Ga0075433_10084389 | 3300006852 | Bacteria | 2804 |
| 69 | Ga0075433_10430851 | 3300006852 | Bacteria | 1163 |
| 70 | Ga0075434_100007547 | 3300006871 | Bacteria | 10075 |
| 71 | Ga0075434_100013426 | 3300006871 | Bacteria | 7794 |
| 72 | Ga0075434_100200383 | 3300006871 | Bacteria | 2016 |
| 73 | Ga0075434_100287641 | 3300006871 | Bacteria | 1664 |
| 74 | Ga0075434_100562956 | 3300006871 | Bacteria | 1159 |
| 75 | Ga0075429_100030788 | 3300006880 | Bacteria | 4663 |
| 76 | Ga0075429_100537223 | 3300006880 | Bacteria | 1025 |
| 77 | Ga0075429_100544180 | 3300006880 | Bacteria | 1017 |
| 78 | Ga0097620_100234906 | 3300006931 | Bacteria | 1922 |
| 79 | Ga0097620_100833480 | 3300006931 | Unclassified | 1009 |
| 80 | Ga0075435_100064251 | 3300007076 | Bacteria | 2982 |
| 81 | Ga0075435_100124622 | 3300007076 | Bacteria | 2152 |
| 82 | Ga0075435_100162283 | 3300007076 | Unclassified | 1883 |
| 83 | Ga0075435_100682404 | 3300007076 | Bacteria | 892 |
| 84 | Ga0111539_10000315 | 3300009094 | Bacteria | 58955 |
| 85 | Ga0111539_10225607 | 3300009094 | Bacteria | 2182 |
| 86 | Ga0111539_10375500 | 3300009094 | Unclassified | 1655 |
| 87 | Ga0111539_10401215 | 3300009094 | Bacteria | 1597 |
| 88 | Ga0111539_10605921 | 3300009094 | Unclassified | 1275 |
| 89 | Ga0111539_13452953 | 3300009094 | Bacteria | 508 |
| 90 | Ga0105245_11881524 | 3300009098 | Bacteria | 651 |
| 91 | Ga0105247_10013464 | 3300009101 | Bacteria | 4906 |
| 92 | Ga0105247_10107411 | 3300009101 | Unclassified | 1792 |
| 93 | Ga0114129_10133625 | 3300009147 | Bacteria | 3406 |
| 94 | Ga0114129_10274661 | 3300009147 | Bacteria | 2254 |
| 95 | Ga0114129_10279456 | 3300009147 | Bacteria | 2231 |
| 96 | Ga0114129_10407327 | 3300009147 | Bacteria | 1791 |
| 97 | Ga0114129_10543883 | 3300009147 | Bacteria | 1511 |
| 98 | Ga0114129_10688968 | 3300009147 | Bacteria | 1315 |
| 99 | Ga0114129_12550245 | 3300009147 | Bacteria | 611 |
| 100 | Ga0114129_13473828 | 3300009147 | Bacteria | 504 |
| 101 | Ga0105242_10360878 | 3300009176 | Bacteria | 1345 |
| 102 | Ga0105242_10915162 | 3300009176 | Unclassified | 878 |
| 103 | Ga0105248_10034617 | 3300009177 | Bacteria | 5650 |
| 104 | Ga0105248_10315147 | 3300009177 | Bacteria | 1762 |
| 105 | Ga0105248_10371786 | 3300009177 | Bacteria | 1609 |
| 106 | Ga0105248_13106735 | 3300009177 | Bacteria | 528 |
| 107 | Ga0105238_13027445 | 3300009551 | Bacteria | 505 |
| 108 | Ga0105249_10263585 | 3300009553 | Unclassified | 1713 |
| 109 | Ga0157319_1033745 | 3300012497 | Bacteria | 566 |
| 110 | Ga0157374_12712366 | 3300013296 | Bacteria | 523 |
| 111 | Ga0157378_10790072 | 3300013297 | Unclassified | 974 |
| 112 | Ga0163163_12254389 | 3300014325 | Bacteria | 604 |
| 113 | Ga0157380_11313165 | 3300014326 | Unclassified | 771 |
| 114 | Ga0157377_11559572 | 3300014745 | Bacteria | 527 |
| 115 | Ga0157379_10125158 | 3300014968 | Bacteria | 2313 |
| 116 | Ga0157379_12360406 | 3300014968 | Unclassified | 530 |
| 117 | Ga0157376_10152836 | 3300014969 | Bacteria | 2083 |
| 118 | Ga0157376_12546921 | 3300014969 | Bacteria | 551 |
| 119 | Ga0206356_11537359 | 3300020070 | Bacteria | 763 |
| 120 | Ga0207656_10645729 | 3300025321 | Unclassified | 541 |
| 121 | Ga0207682_10047238 | 3300025893 | Unclassified | 1772 |
| 122 | Ga0207642_10402240 | 3300025899 | Unclassified | 820 |
| 123 | Ga0207710_10005992 | 3300025900 | Bacteria | 5211 |
| 124 | Ga0207710_10669843 | 3300025900 | Unclassified | 544 |
| 125 | Ga0207699_10730084 | 3300025906 | Unclassified | 726 |
| 126 | Ga0207645_10631410 | 3300025907 | Unclassified | 728 |
| 127 | Ga0207643_10371896 | 3300025908 | Unclassified | 900 |
| 128 | Ga0207684_11012335 | 3300025910 | Bacteria | 695 |
| 129 | Ga0207662_10907479 | 3300025918 | Unclassified | 624 |
| 130 | Ga0207657_11139524 | 3300025919 | Unclassified | 595 |
| 131 | Ga0207681_10024583 | 3300025923 | Bacteria | 3868 |
| 132 | Ga0207650_11105353 | 3300025925 | Unclassified | 675 |
| 133 | Ga0207659_10403093 | 3300025926 | Bacteria | 1144 |
| 134 | Ga0207687_11505978 | 3300025927 | Bacteria | 578 |
| 135 | Ga0207644_10193402 | 3300025931 | Bacteria | 1601 |
| 136 | Ga0207644_10404297 | 3300025931 | Bacteria | 1117 |
| 137 | Ga0207706_10751740 | 3300025933 | Bacteria | 831 |
| 138 | Ga0207669_10169826 | 3300025937 | Bacteria | 1551 |
| 139 | Ga0207669_10304846 | 3300025937 | Bacteria | 1212 |
| 140 | Ga0207669_11365192 | 3300025937 | Unclassified | 603 |
| 141 | Ga0207711_10427304 | 3300025941 | Bacteria | 1232 |
| 142 | Ga0207711_11642477 | 3300025941 | Bacteria | 586 |
| 143 | Ga0207689_10184476 | 3300025942 | Bacteria | 1721 |
| 144 | Ga0207651_10401354 | 3300025960 | Unclassified | 1166 |
| 145 | Ga0207651_10985847 | 3300025960 | Bacteria | 753 |
| 146 | Ga0207712_10830358 | 3300025961 | Bacteria | 814 |
| 147 | Ga0207712_11031661 | 3300025961 | Bacteria | 730 |
| 148 | Ga0207703_11300484 | 3300026035 | Bacteria | 699 |
| 149 | Ga0207703_11889318 | 3300026035 | Bacteria | 573 |
| 150 | Ga0207708_10525320 | 3300026075 | Bacteria | 995 |
| 151 | Ga0207708_11889021 | 3300026075 | Unclassified | 523 |
| 152 | Ga0207641_11602777 | 3300026088 | Bacteria | 653 |
| 153 | Ga0207676_11162081 | 3300026095 | Unclassified | 764 |
| 154 | Ga0207675_102116490 | 3300026118 | Bacteria | 579 |
| 155 | Ga0207683_10008282 | 3300026121 | Bacteria | 8894 |
| 156 | Ga0207683_11587245 | 3300026121 | Bacteria | 603 |
| 157 | Ga0207698_12333994 | 3300026142 | Unclassified | 547 |
| 158 | Ga0209971_1149229 | 3300027682 | Unclassified | 576 |
| 159 | Ga0207428_10000051 | 3300027907 | Bacteria | 176522 |
| 160 | Ga0207428_10080019 | 3300027907 | Bacteria | 2554 |
| 161 | Ga0207428_11031340 | 3300027907 | Bacteria | 577 |
| 162 | Ga0268266_11739430 | 3300028379 | Unclassified | 598 |
| 163 | Ga0268264_12138200 | 3300028381 | Unclassified | 568 |
| 164 | Ga0307408_100040501 | 3300031548 | Bacteria | 3299 |
| 165 | Ga0307408_100058530 | 3300031548 | Bacteria | 2802 |
| 166 | Ga0307408_100390425 | 3300031548 | Bacteria | 1192 |
| 167 | Ga0307405_10003163 | 3300031731 | Bacteria | 7489 |
| 168 | Ga0307405_10763929 | 3300031731 | Unclassified | 806 |
| 169 | Ga0307405_11637652 | 3300031731 | Unclassified | 569 |
| 170 | Ga0307413_10308155 | 3300031824 | Bacteria | 1204 |
| 171 | Ga0307413_10312675 | 3300031824 | Bacteria | 1196 |
| 172 | Ga0307410_10029124 | 3300031852 | Bacteria | 3512 |
| 173 | Ga0307410_10594654 | 3300031852 | Unclassified | 922 |
| 174 | Ga0307406_10263898 | 3300031901 | Bacteria | 1304 |
| 175 | Ga0307407_10001791 | 3300031903 | Bacteria | 8038 |
| 176 | Ga0307407_11708571 | 3300031903 | Unclassified | 501 |
| 177 | Ga0307412_10002620 | 3300031911 | Bacteria | 9990 |
| 178 | Ga0307409_100071100 | 3300031995 | Bacteria | 2765 |
| 179 | Ga0307409_100132760 | 3300031995 | Bacteria | 2131 |
| 180 | Ga0307409_101410737 | 3300031995 | Bacteria | 723 |
| 181 | Ga0307416_100001377 | 3300032002 | Bacteria | 13141 |
| 182 | Ga0307416_100049182 | 3300032002 | Bacteria | 3351 |
| 183 | Ga0307416_102753178 | 3300032002 | Unclassified | 588 |
| 184 | Ga0307414_10011906 | 3300032004 | Bacteria | 5125 |
| 185 | Ga0307414_10421099 | 3300032004 | Bacteria | 1165 |
| 186 | Ga0307411_10052030 | 3300032005 | Bacteria | 2676 |
| 187 | Ga0307411_10084929 | 3300032005 | Unclassified | 2191 |
| 188 | Ga0307415_100024739 | 3300032126 | Bacteria | 3756 |
| 189 | Ga0307415_100369604 | 3300032126 | Bacteria | 1214 |
| 190 | Ga0307415_101426695 | 3300032126 | Unclassified | 660 |
| 191 | Ga0373940_0138344 | 3300035088 | Bacteria | 768 |
| 192 | Ga0373932_0276983 | 3300035112 | Bacteria | 619 |
| 193 | Ga0436365_0465977 | 3300039437 | Unclassified | 893 |
| 194 | Ga0439453_0127632 | 3300041408 | Bacteria | 588 |
| 195 | Ga0451807_0566257 | 3300041486 | Unclassified | 602 |
| 196 | Ga0450914_005787 | 3300042118 | Bacteria | 1061 |
| 197 | Ga0450920_036086 | 3300042122 | Bacteria | 980 |
| 198 | Ga0450923_074836 | 3300042125 | Bacteria | 755 |
| 199 | Ga0450896_078254 | 3300042133 | Bacteria | 554 |
| 200 | Ga0450906_052952 | 3300042145 | Unclassified | 718 |
| 201 | Ga0439434_0281660 | 3300042435 | Bacteria | 572 |
| 202 | Ga0439444_0142718 | 3300042437 | Unclassified | 574 |
| 203 | Ga0450916_075413 | 3300042530 | Bacteria | 568 |
| 204 | Ga0439440_0111888 | 3300042993 | Unclassified | 752 |
| 205 | Ga0451576_0390992 | 3300045051 | Bacteria | 1458 |
| 206 | Ga0466967_0648017 | 3300045976 | Unclassified | 1044 |
| 207 | Ga0495582_0838266 | 3300046473 | Unclassified | 532 |
| 208 | Ga0495630_0256899 | 3300046517 | Bacteria | 1335 |
| 209 | Ga0495634_0332915 | 3300046642 | Bacteria | 912 |
| 210 | Ga0495635_0120140 | 3300046663 | Bacteria | 1793 |
| 211 | Ga0495658_0241333 | 3300046683 | Bacteria | 1135 |
| 212 | Ga0495658_0572930 | 3300046683 | Unclassified | 723 |
| 213 | Ga0496107_1214679 | 3300048910 | Unclassified | 542 |
| 214 | Ga0496109_1673071 | 3300048912 | Unclassified | 570 |
| 215 | Ga0496110_1566737 | 3300048913 | Unclassified | 569 |
| 216 | Ga0496114_0471502 | 3300048917 | Bacteria | 1111 |
| 217 | Ga0496114_0666185 | 3300048917 | Unclassified | 914 |
| 218 | Ga0501031_0739349 | 3300049568 | Unclassified | 631 |
| 219 | Ga0501033_0192912 | 3300049570 | Unclassified | 1457 |
| 220 | Ga0501036_0047724 | 3300049572 | Bacteria | 3626 |
| 221 | Ga0501040_0126240 | 3300049576 | Unclassified | 1797 |
| 222 | Ga0501041_0060324 | 3300049577 | Unclassified | 2322 |
| 223 | Ga0501042_0216859 | 3300049578 | Unclassified | 1380 |
| 224 | Ga0501043_0996196 | 3300049579 | Unclassified | 597 |
| 225 | Ga0501048_0967622 | 3300049582 | Unclassified | 612 |
| 226 | Ga0501048_1060075 | 3300049582 | Unclassified | 583 |
| 227 | Ga0501072_0184135 | 3300049588 | Bacteria | 1666 |
| 228 | Ga0501072_1530116 | 3300049588 | Bacteria | 515 |
| 229 | Ga0501074_0060514 | 3300049590 | Unclassified | 2729 |
| 230 | Ga0501074_0802715 | 3300049590 | Bacteria | 663 |
| 231 | Ga0501074_1090869 | 3300049590 | Unclassified | 561 |
| 232 | Ga0501075_0447445 | 3300049591 | Unclassified | 985 |
| 233 | Ga0501075_0799591 | 3300049591 | Unclassified | 718 |
| 234 | Ga0501076_0601812 | 3300049592 | Bacteria | 907 |
| 235 | Ga0501076_1146318 | 3300049592 | Unclassified | 640 |
| 236 | Ga0501076_1705655 | 3300049592 | Unclassified | 517 |
| 237 | Ga0501214_033674 | 3300049659 | Bacteria | 715 |
| 238 | Ga0501238_068923 | 3300049671 | Unclassified | 548 |
| 239 | Ga0501248_057257 | 3300049678 | Unclassified | 513 |
| 240 | Ga0501081_0111441 | 3300049743 | Unclassified | 1942 |
| 241 | Ga0501081_0641820 | 3300049743 | Unclassified | 796 |
| 242 | Ga0501081_0757343 | 3300049743 | Unclassified | 730 |
| 243 | Ga0501083_0151742 | 3300049744 | Bacteria | 1517 |
| 244 | Ga0501268_178108 | 3300049765 | Bacteria | 505 |
| 245 | Ga0501045_0047906 | 3300049824 | Unclassified | 3114 |
| 246 | Ga0501045_0236810 | 3300049824 | Bacteria | 1359 |
| 247 | nmdc:mga05p37_1720545_c1 | 3300050507 | Bacteria | 610 |
| 248 | nmdc:mga05p37_349106_c1 | 3300050507 | Bacteria | 1742 |
| 249 | nmdc:mga05p37_445277_c1 | 3300050507 | Unclassified | 1501 |
| 250 | nmdc:mga05p37_53798_c1 | 3300050507 | Bacteria | 4951 |
| 251 | nmdc:mga05p37_557348_c1 | 3300050507 | Bacteria | 1303 |
| 252 | nmdc:mga05p37_973426_c1 | 3300050507 | Bacteria | 905 |
| 253 | nmdc:mga09592_157736_c1 | 3300050508 | Bacteria | 1959 |
| 254 | nmdc:mga09592_1629294_c1 | 3300050508 | Unclassified | 522 |
| 255 | nmdc:mga09592_464701_c1 | 3300050508 | Bacteria | 1091 |
| 256 | nmdc:mga09592_592399_c1 | 3300050508 | Unclassified | 950 |
| 257 | nmdc:mga0qj67_499336_c1 | 3300050509 | Bacteria | 978 |
| 258 | nmdc:mga0qj67_6361_c1 | 3300050509 | Bacteria | 8676 |
| 259 | nmdc:mga0qj67_907701_c1 | 3300050509 | Unclassified | 694 |
| 260 | nmdc:mga06r32_418559_c1 | 3300050510 | Bacteria | 1321 |
| 261 | nmdc:mga06r32_64976_c1 | 3300050510 | Bacteria | 3519 |
| 262 | nmdc:mga08y16_1723932_c1 | 3300050511 | Bacteria | 581 |
| 263 | nmdc:mga08y16_25_c1 | 3300050511 | Bacteria | 235789 |
| 264 | nmdc:mga08y16_43129_c1 | 3300050511 | Bacteria | 4726 |
| 265 | nmdc:mga08y16_524689_c1 | 3300050511 | Bacteria | 591 |
| 266 | nmdc:mga08y16_620492_c1 | 3300050511 | Bacteria | 1088 |
| 267 | nmdc:mga08y16_951069_c1 | 3300050511 | Bacteria | 842 |
| 268 | nmdc:mga0n895_163677_c1 | 3300050512 | Bacteria | 2256 |
| 269 | nmdc:mga0n895_3618_c1 | 3300050512 | Bacteria | 12494 |
| 270 | nmdc:mga0rr50_112987_c1 | 3300050513 | Bacteria | 2152 |
| 271 | nmdc:mga0a205_125843_c1 | 3300050515 | Bacteria | 2462 |
| 272 | nmdc:mga0a205_139888_c1 | 3300050515 | Bacteria | 2321 |
| 273 | nmdc:mga0a205_842_c2 | 3300050515 | Bacteria | 15810 |
| 274 | Ga0495601_1061083 | 3300053077 | Unclassified | 508 |
| 275 | Ga0501082_0221850 | 3300060353 | Bacteria | 1645 |
| 276 | Ga0530510_0084337 | 3300061734 | Bacteria | 2314 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005339 | Ga0070660_101570460 | Ga0070660_1015704601 | 56 |
| 2 | 3300005354 | Ga0070675_102035802 | Ga0070675_1020358021 | 56 |
| 3 | 3300005355 | Ga0070671_101151900 | Ga0070671_1011519002 | 56 |
| 4 | 3300005364 | Ga0070673_101398504 | Ga0070673_1013985042 | 56 |
| 5 | 3300005535 | Ga0070684_100627105 | Ga0070684_1006271053 | 56 |
| 6 | 3300005539 | Ga0068853_101497777 | Ga0068853_1014977772 | 56 |
| 7 | 3300005543 | Ga0070672_100714530 | Ga0070672_1007145302 | 56 |
| 8 | 3300005616 | Ga0068852_101054726 | Ga0068852_1010547261 | 56 |
| 9 | 3300005834 | Ga0068851_10812706 | Ga0068851_108127061 | 56 |
| 10 | 3300025321 | Ga0207656_10645729 | Ga0207656_106457291 | 56 |
| 11 | 3300025919 | Ga0207657_11139524 | Ga0207657_111395241 | 56 |
| 12 | 3300025931 | Ga0207644_10193402 | Ga0207644_101934024 | 56 |
| 13 | 3300026142 | Ga0207698_12333994 | Ga0207698_123339942 | 56 |
| 14 | 3300048910 | Ga0496107_1214679 | Ga0496107_1214679_269_472 | 56 |
| 15 | 3300048912 | Ga0496109_1673071 | Ga0496109_1673071_131_334 | 56 |
| 16 | 3300005618 | Ga0068864_100933697 | Ga0068864_1009336972 | 58 |
| 17 | 3300005841 | Ga0068863_100721108 | Ga0068863_1007211083 | 58 |
| 18 | 3300009177 | Ga0105248_10315147 | Ga0105248_103151472 | 58 |
| 19 | 3300025907 | Ga0207645_10631410 | Ga0207645_106314102 | 58 |
| 20 | 3300026118 | Ga0207675_102116490 | Ga0207675_1021164901 | 63 |
| 21 | 3300009177 | Ga0105248_13106735 | Ga0105248_131067352 | 66 |
| 22 | 3300005293 | Ga0065715_10994194 | Ga0065715_109941942 | 67 |
| 23 | 3300005331 | Ga0070670_100383100 | Ga0070670_1003831002 | 67 |
| 24 | 3300005333 | Ga0070677_10017932 | Ga0070677_100179323 | 67 |
| 25 | 3300005343 | Ga0070687_100998668 | Ga0070687_1009986681 | 67 |
| 26 | 3300005353 | Ga0070669_100075306 | Ga0070669_1000753061 | 67 |
| 27 | 3300005354 | Ga0070675_100128874 | Ga0070675_1001288743 | 67 |
| 28 | 3300005356 | Ga0070674_100144641 | Ga0070674_1001446412 | 67 |
| 29 | 3300005364 | Ga0070673_100207434 | Ga0070673_1002074342 | 67 |
| 30 | 3300005367 | Ga0070667_101859513 | Ga0070667_1018595131 | 67 |
| 31 | 3300005441 | Ga0070700_101352234 | Ga0070700_1013522342 | 67 |
| 32 | 3300005445 | Ga0070708_100032855 | Ga0070708_1000328555 | 67 |
| 33 | 3300005456 | Ga0070678_100022927 | Ga0070678_1000229274 | 67 |
| 34 | 3300005466 | Ga0070685_10748699 | Ga0070685_107486992 | 67 |
| 35 | 3300005467 | Ga0070706_100728927 | Ga0070706_1007289271 | 67 |
| 36 | 3300005471 | Ga0070698_100848506 | Ga0070698_1008485061 | 67 |
| 37 | 3300005548 | Ga0070665_102159450 | Ga0070665_1021594502 | 67 |
| 38 | 3300005617 | Ga0068859_100833535 | Ga0068859_1008335352 | 67 |
| 39 | 3300005840 | Ga0068870_10436352 | Ga0068870_104363522 | 67 |
| 40 | 3300006931 | Ga0097620_100833480 | Ga0097620_1008334802 | 67 |
| 41 | 3300009176 | Ga0105242_10915162 | Ga0105242_109151621 | 67 |
| 42 | 3300009553 | Ga0105249_10263585 | Ga0105249_102635852 | 67 |
| 43 | 3300014968 | Ga0157379_12360406 | Ga0157379_123604061 | 67 |
| 44 | 3300025893 | Ga0207682_10047238 | Ga0207682_100472382 | 67 |
| 45 | 3300025899 | Ga0207642_10402240 | Ga0207642_104022402 | 67 |
| 46 | 3300025908 | Ga0207643_10371896 | Ga0207643_103718962 | 67 |
| 47 | 3300025918 | Ga0207662_10907479 | Ga0207662_109074792 | 67 |
| 48 | 3300025923 | Ga0207681_10024583 | Ga0207681_100245835 | 67 |
| 49 | 3300025926 | Ga0207659_10403093 | Ga0207659_104030932 | 67 |
| 50 | 3300025937 | Ga0207669_10304846 | Ga0207669_103048462 | 67 |
| 51 | 3300025960 | Ga0207651_10401354 | Ga0207651_104013541 | 67 |
| 52 | 3300026075 | Ga0207708_11889021 | Ga0207708_118890211 | 67 |
| 53 | 3300026121 | Ga0207683_10008282 | Ga0207683_100082824 | 67 |
| 54 | 3300028379 | Ga0268266_11739430 | Ga0268266_117394301 | 67 |
| 55 | 3300046473 | Ga0495582_0838266 | Ga0495582_0838266_319_522 | 67 |
| 56 | 3300046683 | Ga0495658_0572930 | Ga0495658_0572930_407_610 | 67 |
| 57 | 3300049678 | Ga0501248_057257 | Ga0501248_057257_211_414 | 67 |
| 58 | 3300005434 | Ga0070709_10676022 | Ga0070709_106760222 | 68 |
| 59 | 3300005937 | Ga0081455_10184140 | Ga0081455_101841402 | 68 |
| 60 | 3300006880 | Ga0075429_100537223 | Ga0075429_1005372232 | 68 |
| 61 | 3300009147 | Ga0114129_10274661 | Ga0114129_102746611 | 68 |
| 62 | 3300031731 | Ga0307405_11637652 | Ga0307405_116376522 | 68 |
| 63 | 3300032002 | Ga0307416_102753178 | Ga0307416_1027531782 | 68 |
| 64 | 3300042118 | Ga0450914_005787 | Ga0450914_005787_527_736 | 68 |
| 65 | 3300045976 | Ga0466967_0648017 | Ga0466967_0648017_174_380 | 68 |
| 66 | 3300050507 | nmdc:mga05p37_445277_c1 | nmdc:mga05p37_445277_c1_1177_1383 | 68 |
| 67 | 3300050508 | nmdc:mga09592_1629294_c1 | nmdc:mga09592_1629294_c1_176_382 | 68 |
| 68 | 3300050511 | nmdc:mga08y16_951069_c1 | nmdc:mga08y16_951069_c1_582_791 | 68 |
| 69 | 3300005290 | Ga0065712_10727355 | Ga0065712_107273552 | 69 |
| 70 | 3300005293 | Ga0065715_10397867 | Ga0065715_103978672 | 69 |
| 71 | 3300005295 | Ga0065707_10540745 | Ga0065707_105407451 | 69 |
| 72 | 3300005330 | Ga0070690_100900303 | Ga0070690_1009003031 | 69 |
| 73 | 3300005333 | Ga0070677_10900324 | Ga0070677_109003241 | 69 |
| 74 | 3300005334 | Ga0068869_100042614 | Ga0068869_1000426143 | 69 |
| 75 | 3300005340 | Ga0070689_101320776 | Ga0070689_1013207762 | 69 |
| 76 | 3300005353 | Ga0070669_101226308 | Ga0070669_1012263081 | 69 |
| 77 | 3300005364 | Ga0070673_101921985 | Ga0070673_1019219851 | 69 |
| 78 | 3300005365 | Ga0070688_100020133 | Ga0070688_1000201332 | 69 |
| 79 | 3300005367 | Ga0070667_102252947 | Ga0070667_1022529471 | 69 |
| 80 | 3300005434 | Ga0070709_10851372 | Ga0070709_108513722 | 69 |
| 81 | 3300005466 | Ga0070685_10081427 | Ga0070685_100814271 | 69 |
| 82 | 3300005467 | Ga0070706_101621564 | Ga0070706_1016215641 | 69 |
| 83 | 3300005518 | Ga0070699_100544445 | Ga0070699_1005444451 | 69 |
| 84 | 3300005548 | Ga0070665_100497058 | Ga0070665_1004970582 | 69 |
| 85 | 3300005564 | Ga0070664_102259195 | Ga0070664_1022591951 | 69 |
| 86 | 3300005617 | Ga0068859_100234908 | Ga0068859_1002349082 | 69 |
| 87 | 3300005618 | Ga0068864_101660864 | Ga0068864_1016608642 | 69 |
| 88 | 3300005719 | Ga0068861_101654074 | Ga0068861_1016540742 | 69 |
| 89 | 3300005841 | Ga0068863_100552333 | Ga0068863_1005523332 | 69 |
| 90 | 3300005842 | Ga0068858_100003770 | Ga0068858_1000037707 | 69 |
| 91 | 3300005842 | Ga0068858_102336667 | Ga0068858_1023366671 | 69 |
| 92 | 3300005843 | Ga0068860_101902166 | Ga0068860_1019021661 | 69 |
| 93 | 3300005843 | Ga0068860_102581723 | Ga0068860_1025817231 | 69 |
| 94 | 3300006237 | Ga0097621_101969824 | Ga0097621_1019698241 | 69 |
| 95 | 3300006844 | Ga0075428_100000101 | Ga0075428_10000010157 | 69 |
| 96 | 3300006844 | Ga0075428_100067336 | Ga0075428_1000673362 | 69 |
| 97 | 3300006844 | Ga0075428_100273430 | Ga0075428_1002734302 | 69 |
| 98 | 3300006844 | Ga0075428_100490393 | Ga0075428_1004903932 | 69 |
| 99 | 3300006844 | Ga0075428_101684169 | Ga0075428_1016841692 | 69 |
| 100 | 3300006844 | Ga0075428_102063805 | Ga0075428_1020638051 | 69 |
| 101 | 3300006846 | Ga0075430_100017978 | Ga0075430_1000179781 | 69 |
| 102 | 3300006846 | Ga0075430_100540444 | Ga0075430_1005404442 | 69 |
| 103 | 3300006846 | Ga0075430_100714630 | Ga0075430_1007146301 | 69 |
| 104 | 3300006852 | Ga0075433_10025445 | Ga0075433_100254453 | 69 |
| 105 | 3300006852 | Ga0075433_10084389 | Ga0075433_100843893 | 69 |
| 106 | 3300006852 | Ga0075433_10430851 | Ga0075433_104308512 | 69 |
| 107 | 3300006871 | Ga0075434_100007547 | Ga0075434_1000075473 | 69 |
| 108 | 3300006871 | Ga0075434_100013426 | Ga0075434_1000134262 | 69 |
| 109 | 3300006871 | Ga0075434_100200383 | Ga0075434_1002003833 | 69 |
| 110 | 3300006871 | Ga0075434_100287641 | Ga0075434_1002876412 | 69 |
| 111 | 3300006871 | Ga0075434_100562956 | Ga0075434_1005629562 | 69 |
| 112 | 3300006880 | Ga0075429_100030788 | Ga0075429_1000307883 | 69 |
| 113 | 3300006880 | Ga0075429_100544180 | Ga0075429_1005441802 | 69 |
| 114 | 3300006931 | Ga0097620_100234906 | Ga0097620_1002349062 | 69 |
| 115 | 3300007076 | Ga0075435_100064251 | Ga0075435_1000642514 | 69 |
| 116 | 3300007076 | Ga0075435_100124622 | Ga0075435_1001246223 | 69 |
| 117 | 3300007076 | Ga0075435_100162283 | Ga0075435_1001622831 | 69 |
| 118 | 3300007076 | Ga0075435_100682404 | Ga0075435_1006824041 | 69 |
| 119 | 3300009094 | Ga0111539_10000315 | Ga0111539_1000031513 | 69 |
| 120 | 3300009094 | Ga0111539_10225607 | Ga0111539_102256072 | 69 |
| 121 | 3300009094 | Ga0111539_10375500 | Ga0111539_103755002 | 69 |
| 122 | 3300009094 | Ga0111539_10401215 | Ga0111539_104012151 | 69 |
| 123 | 3300009094 | Ga0111539_10605921 | Ga0111539_106059212 | 69 |
| 124 | 3300009094 | Ga0111539_13452953 | Ga0111539_134529532 | 69 |
| 125 | 3300009098 | Ga0105245_11881524 | Ga0105245_118815241 | 69 |
| 126 | 3300009101 | Ga0105247_10013464 | Ga0105247_100134643 | 69 |
| 127 | 3300009101 | Ga0105247_10107411 | Ga0105247_101074112 | 69 |
| 128 | 3300009147 | Ga0114129_10133625 | Ga0114129_101336252 | 69 |
| 129 | 3300009147 | Ga0114129_10279456 | Ga0114129_102794562 | 69 |
| 130 | 3300009147 | Ga0114129_10407327 | Ga0114129_104073272 | 69 |
| 131 | 3300009147 | Ga0114129_10543883 | Ga0114129_105438832 | 69 |
| 132 | 3300009147 | Ga0114129_10688968 | Ga0114129_106889682 | 69 |
| 133 | 3300009147 | Ga0114129_12550245 | Ga0114129_125502452 | 69 |
| 134 | 3300009147 | Ga0114129_13473828 | Ga0114129_134738281 | 69 |
| 135 | 3300009176 | Ga0105242_10360878 | Ga0105242_103608782 | 69 |
| 136 | 3300009177 | Ga0105248_10034617 | Ga0105248_100346175 | 69 |
| 137 | 3300009177 | Ga0105248_10371786 | Ga0105248_103717861 | 69 |
| 138 | 3300009551 | Ga0105238_13027445 | Ga0105238_130274452 | 69 |
| 139 | 3300012497 | Ga0157319_1033745 | Ga0157319_10337452 | 69 |
| 140 | 3300013296 | Ga0157374_12712366 | Ga0157374_127123661 | 69 |
| 141 | 3300013297 | Ga0157378_10790072 | Ga0157378_107900722 | 69 |
| 142 | 3300014325 | Ga0163163_12254389 | Ga0163163_122543892 | 69 |
| 143 | 3300014326 | Ga0157380_11313165 | Ga0157380_113131652 | 69 |
| 144 | 3300014745 | Ga0157377_11559572 | Ga0157377_115595722 | 69 |
| 145 | 3300014968 | Ga0157379_10125158 | Ga0157379_101251582 | 69 |
| 146 | 3300014969 | Ga0157376_10152836 | Ga0157376_101528361 | 69 |
| 147 | 3300014969 | Ga0157376_12546921 | Ga0157376_125469211 | 69 |
| 148 | 3300020070 | Ga0206356_11537359 | Ga0206356_115373592 | 69 |
| 149 | 3300025900 | Ga0207710_10005992 | Ga0207710_100059922 | 69 |
| 150 | 3300025900 | Ga0207710_10669843 | Ga0207710_106698432 | 69 |
| 151 | 3300025906 | Ga0207699_10730084 | Ga0207699_107300842 | 69 |
| 152 | 3300025910 | Ga0207684_11012335 | Ga0207684_110123352 | 69 |
| 153 | 3300025925 | Ga0207650_11105353 | Ga0207650_111053531 | 69 |
| 154 | 3300025927 | Ga0207687_11505978 | Ga0207687_115059781 | 69 |
| 155 | 3300025931 | Ga0207644_10404297 | Ga0207644_104042972 | 69 |
| 156 | 3300025933 | Ga0207706_10751740 | Ga0207706_107517402 | 69 |
| 157 | 3300025937 | Ga0207669_10169826 | Ga0207669_101698262 | 69 |
| 158 | 3300025937 | Ga0207669_11365192 | Ga0207669_113651922 | 69 |
| 159 | 3300025941 | Ga0207711_10427304 | Ga0207711_104273042 | 69 |
| 160 | 3300025941 | Ga0207711_11642477 | Ga0207711_116424772 | 69 |
| 161 | 3300025942 | Ga0207689_10184476 | Ga0207689_101844762 | 69 |
| 162 | 3300025960 | Ga0207651_10985847 | Ga0207651_109858472 | 69 |
| 163 | 3300025961 | Ga0207712_10830358 | Ga0207712_108303581 | 69 |
| 164 | 3300025961 | Ga0207712_11031661 | Ga0207712_110316612 | 69 |
| 165 | 3300026035 | Ga0207703_11300484 | Ga0207703_113004842 | 69 |
| 166 | 3300026035 | Ga0207703_11889318 | Ga0207703_118893182 | 69 |
| 167 | 3300026075 | Ga0207708_10525320 | Ga0207708_105253202 | 69 |
| 168 | 3300026088 | Ga0207641_11602777 | Ga0207641_116027771 | 69 |
| 169 | 3300026095 | Ga0207676_11162081 | Ga0207676_111620812 | 69 |
| 170 | 3300026121 | Ga0207683_11587245 | Ga0207683_115872451 | 69 |
| 171 | 3300027682 | Ga0209971_1149229 | Ga0209971_11492292 | 69 |
| 172 | 3300027907 | Ga0207428_10000051 | Ga0207428_1000005140 | 69 |
| 173 | 3300027907 | Ga0207428_10080019 | Ga0207428_100800192 | 69 |
| 174 | 3300027907 | Ga0207428_11031340 | Ga0207428_110313402 | 69 |
| 175 | 3300028381 | Ga0268264_12138200 | Ga0268264_121382001 | 69 |
| 176 | 3300031548 | Ga0307408_100040501 | Ga0307408_1000405014 | 69 |
| 177 | 3300031548 | Ga0307408_100058530 | Ga0307408_1000585302 | 69 |
| 178 | 3300031548 | Ga0307408_100390425 | Ga0307408_1003904252 | 69 |
| 179 | 3300031731 | Ga0307405_10003163 | Ga0307405_100031634 | 69 |
| 180 | 3300031731 | Ga0307405_10763929 | Ga0307405_107639292 | 69 |
| 181 | 3300031824 | Ga0307413_10308155 | Ga0307413_103081551 | 69 |
| 182 | 3300031824 | Ga0307413_10312675 | Ga0307413_103126752 | 69 |
| 183 | 3300031852 | Ga0307410_10029124 | Ga0307410_100291243 | 69 |
| 184 | 3300031852 | Ga0307410_10594654 | Ga0307410_105946542 | 69 |
| 185 | 3300031901 | Ga0307406_10263898 | Ga0307406_102638983 | 69 |
| 186 | 3300031903 | Ga0307407_10001791 | Ga0307407_100017919 | 69 |
| 187 | 3300031903 | Ga0307407_11708571 | Ga0307407_117085711 | 69 |
| 188 | 3300031911 | Ga0307412_10002620 | Ga0307412_100026206 | 69 |
| 189 | 3300031995 | Ga0307409_100071100 | Ga0307409_1000711003 | 69 |
| 190 | 3300031995 | Ga0307409_100132760 | Ga0307409_1001327603 | 69 |
| 191 | 3300031995 | Ga0307409_101410737 | Ga0307409_1014107371 | 69 |
| 192 | 3300032002 | Ga0307416_100001377 | Ga0307416_1000013777 | 69 |
| 193 | 3300032002 | Ga0307416_100049182 | Ga0307416_1000491823 | 69 |
| 194 | 3300032004 | Ga0307414_10011906 | Ga0307414_100119065 | 69 |
| 195 | 3300032004 | Ga0307414_10421099 | Ga0307414_104210992 | 69 |
| 196 | 3300032005 | Ga0307411_10052030 | Ga0307411_100520303 | 69 |
| 197 | 3300032005 | Ga0307411_10084929 | Ga0307411_100849292 | 69 |
| 198 | 3300032126 | Ga0307415_100024739 | Ga0307415_1000247392 | 69 |
| 199 | 3300032126 | Ga0307415_100369604 | Ga0307415_1003696042 | 69 |
| 200 | 3300032126 | Ga0307415_101426695 | Ga0307415_1014266952 | 69 |
| 201 | 3300035088 | Ga0373940_0138344 | Ga0373940_0138344_157_366 | 69 |
| 202 | 3300035112 | Ga0373932_0276983 | Ga0373932_0276983_143_352 | 69 |
| 203 | 3300039437 | Ga0436365_0465977 | Ga0436365_0465977_574_783 | 69 |
| 204 | 3300041408 | Ga0439453_0127632 | Ga0439453_0127632_87_299 | 69 |
| 205 | 3300041486 | Ga0451807_0566257 | Ga0451807_0566257_375_584 | 69 |
| 206 | 3300042122 | Ga0450920_036086 | Ga0450920_036086_632_841 | 69 |
| 207 | 3300042125 | Ga0450923_074836 | Ga0450923_074836_90_299 | 69 |
| 208 | 3300042133 | Ga0450896_078254 | Ga0450896_078254_215_424 | 69 |
| 209 | 3300042145 | Ga0450906_052952 | Ga0450906_052952_48_257 | 69 |
| 210 | 3300042435 | Ga0439434_0281660 | Ga0439434_0281660_310_519 | 69 |
| 211 | 3300042437 | Ga0439444_0142718 | Ga0439444_0142718_144_353 | 69 |
| 212 | 3300042530 | Ga0450916_075413 | Ga0450916_075413_280_489 | 69 |
| 213 | 3300042993 | Ga0439440_0111888 | Ga0439440_0111888_283_492 | 69 |
| 214 | 3300045051 | Ga0451576_0390992 | Ga0451576_0390992_223_432 | 69 |
| 215 | 3300046517 | Ga0495630_0256899 | Ga0495630_0256899_349_558 | 69 |
| 216 | 3300046642 | Ga0495634_0332915 | Ga0495634_0332915_666_875 | 69 |
| 217 | 3300046663 | Ga0495635_0120140 | Ga0495635_0120140_311_520 | 69 |
| 218 | 3300046683 | Ga0495658_0241333 | Ga0495658_0241333_395_604 | 69 |
| 219 | 3300048913 | Ga0496110_1566737 | Ga0496110_1566737_119_349 | 69 |
| 220 | 3300048917 | Ga0496114_0471502 | Ga0496114_0471502_293_502 | 69 |
| 221 | 3300048917 | Ga0496114_0666185 | Ga0496114_0666185_158_412 | 69 |
| 222 | 3300049568 | Ga0501031_0739349 | Ga0501031_0739349_244_453 | 69 |
| 223 | 3300049570 | Ga0501033_0192912 | Ga0501033_0192912_90_299 | 69 |
| 224 | 3300049572 | Ga0501036_0047724 | Ga0501036_0047724_1798_2007 | 69 |
| 225 | 3300049576 | Ga0501040_0126240 | Ga0501040_0126240_358_567 | 69 |
| 226 | 3300049577 | Ga0501041_0060324 | Ga0501041_0060324_1295_1504 | 69 |
| 227 | 3300049578 | Ga0501042_0216859 | Ga0501042_0216859_62_271 | 69 |
| 228 | 3300049579 | Ga0501043_0996196 | Ga0501043_0996196_281_490 | 69 |
| 229 | 3300049582 | Ga0501048_0967622 | Ga0501048_0967622_370_579 | 69 |
| 230 | 3300049582 | Ga0501048_1060075 | Ga0501048_1060075_333_542 | 69 |
| 231 | 3300049588 | Ga0501072_0184135 | Ga0501072_0184135_233_442 | 69 |
| 232 | 3300049588 | Ga0501072_1530116 | Ga0501072_1530116_295_504 | 69 |
| 233 | 3300049590 | Ga0501074_0060514 | Ga0501074_0060514_2189_2398 | 69 |
| 234 | 3300049590 | Ga0501074_0802715 | Ga0501074_0802715_169_378 | 69 |
| 235 | 3300049590 | Ga0501074_1090869 | Ga0501074_1090869_325_534 | 69 |
| 236 | 3300049591 | Ga0501075_0447445 | Ga0501075_0447445_491_700 | 69 |
| 237 | 3300049591 | Ga0501075_0799591 | Ga0501075_0799591_354_563 | 69 |
| 238 | 3300049592 | Ga0501076_0601812 | Ga0501076_0601812_255_464 | 69 |
| 239 | 3300049592 | Ga0501076_1146318 | Ga0501076_1146318_260_469 | 69 |
| 240 | 3300049592 | Ga0501076_1705655 | Ga0501076_1705655_161_370 | 69 |
| 241 | 3300049659 | Ga0501214_033674 | Ga0501214_033674_181_393 | 69 |
| 242 | 3300049671 | Ga0501238_068923 | Ga0501238_068923_254_463 | 69 |
| 243 | 3300049743 | Ga0501081_0111441 | Ga0501081_0111441_656_865 | 69 |
| 244 | 3300049743 | Ga0501081_0641820 | Ga0501081_0641820_98_307 | 69 |
| 245 | 3300049743 | Ga0501081_0757343 | Ga0501081_0757343_113_322 | 69 |
| 246 | 3300049744 | Ga0501083_0151742 | Ga0501083_0151742_1083_1292 | 69 |
| 247 | 3300049765 | Ga0501268_178108 | Ga0501268_178108_131_340 | 69 |
| 248 | 3300049824 | Ga0501045_0047906 | Ga0501045_0047906_770_979 | 69 |
| 249 | 3300049824 | Ga0501045_0236810 | Ga0501045_0236810_954_1163 | 69 |
| 250 | 3300050507 | nmdc:mga05p37_1720545_c1 | nmdc:mga05p37_1720545_c1_151_363 | 69 |
| 251 | 3300050507 | nmdc:mga05p37_349106_c1 | nmdc:mga05p37_349106_c1_978_1187 | 69 |
| 252 | 3300050507 | nmdc:mga05p37_53798_c1 | nmdc:mga05p37_53798_c1_2258_2467 | 69 |
| 253 | 3300050507 | nmdc:mga05p37_557348_c1 | nmdc:mga05p37_557348_c1_241_450 | 69 |
| 254 | 3300050507 | nmdc:mga05p37_973426_c1 | nmdc:mga05p37_973426_c1_28_237 | 69 |
| 255 | 3300050508 | nmdc:mga09592_157736_c1 | nmdc:mga09592_157736_c1_166_375 | 69 |
| 256 | 3300050508 | nmdc:mga09592_464701_c1 | nmdc:mga09592_464701_c1_603_812 | 69 |
| 257 | 3300050508 | nmdc:mga09592_592399_c1 | nmdc:mga09592_592399_c1_688_897 | 69 |
| 258 | 3300050509 | nmdc:mga0qj67_499336_c1 | nmdc:mga0qj67_499336_c1_684_893 | 69 |
| 259 | 3300050509 | nmdc:mga0qj67_6361_c1 | nmdc:mga0qj67_6361_c1_7320_7529 | 69 |
| 260 | 3300050509 | nmdc:mga0qj67_907701_c1 | nmdc:mga0qj67_907701_c1_413_622 | 69 |
| 261 | 3300050510 | nmdc:mga06r32_418559_c1 | nmdc:mga06r32_418559_c1_67_276 | 69 |
| 262 | 3300050510 | nmdc:mga06r32_64976_c1 | nmdc:mga06r32_64976_c1_2592_2801 | 69 |
| 263 | 3300050511 | nmdc:mga08y16_1723932_c1 | nmdc:mga08y16_1723932_c1_94_306 | 69 |
| 264 | 3300050511 | nmdc:mga08y16_25_c1 | nmdc:mga08y16_25_c1_220365_220574 | 69 |
| 265 | 3300050511 | nmdc:mga08y16_43129_c1 | nmdc:mga08y16_43129_c1_3610_3819 | 69 |
| 266 | 3300050511 | nmdc:mga08y16_524689_c1 | nmdc:mga08y16_524689_c1_214_423 | 69 |
| 267 | 3300050511 | nmdc:mga08y16_620492_c1 | nmdc:mga08y16_620492_c1_608_817 | 69 |
| 268 | 3300050512 | nmdc:mga0n895_163677_c1 | nmdc:mga0n895_163677_c1_1036_1245 | 69 |
| 269 | 3300050512 | nmdc:mga0n895_3618_c1 | nmdc:mga0n895_3618_c1_6486_6695 | 69 |
| 270 | 3300050513 | nmdc:mga0rr50_112987_c1 | nmdc:mga0rr50_112987_c1_1920_2129 | 69 |
| 271 | 3300050515 | nmdc:mga0a205_125843_c1 | nmdc:mga0a205_125843_c1_499_708 | 69 |
| 272 | 3300050515 | nmdc:mga0a205_139888_c1 | nmdc:mga0a205_139888_c1_398_607 | 69 |
| 273 | 3300050515 | nmdc:mga0a205_842_c2 | nmdc:mga0a205_842_c2_9500_9709 | 69 |
| 274 | 3300053077 | Ga0495601_1061083 | Ga0495601_1061083_260_469 | 69 |
| 275 | 3300060353 | Ga0501082_0221850 | Ga0501082_0221850_48_257 | 69 |
| 276 | 3300061734 | Ga0530510_0084337 | Ga0530510_0084337_1637_1846 | 69 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8p4a-assembly1.cif.gz_F | structural insights into human co-transcriptional capping - structure 1 | 0.4822 | 1 | 54 |
| 6bv7-assembly1.cif.gz_A | nmr structure of sodium/calcium exchanger 1 (ncx1) two-helix bundle (thb) domain | 0.4685 | 1 | 53 |
| 7naf-assembly1.cif.gz_R | state e2 nucleolar 60s ribosomal biogenesis intermediate - spb1-mtd local model | 0.4435 | 1 | 51 |
| 6bv7-assembly1.cif.gz_A | nmr structure of sodium/calcium exchanger 1 (ncx1) two-helix bundle (thb) domain | 0.4409 | 1 | 53 |
| 8p4a-assembly1.cif.gz_F | structural insights into human co-transcriptional capping - structure 1 | 0.3995 | 1 | 54 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4drbE00 | Mainly Alpha;Orthogonal Bundle;Histone, subunit A;Histone, subunit A | 0.574 | 15 | 52 | 1.10.20.10 |
| af_Q6P698_1_82_1.10.238.10 | Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand | 0.5378 | 8 | 56 | 1.10.238.10 |
| af_A0A2R8RSF3_2_287_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.5165 | 15 | 52 | 1.20.1270.60 |
| 3nzqB04 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.4943 | 17 | 64 | 1.10.287.3440 |
| af_Q6DHF1_14_110_1.10.287.1060 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like | 0.4741 | 15 | 52 | 1.10.287.1060 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E6ZW96-F1-model_v4 | Uncharacterized protein | 0.6793 | 1 | 69 |
|
| AF-A0A2E6ZW96-F1-model_v4 | Uncharacterized protein | 0.6708 | 1 | 69 |
|
| AF-A0A382EVE1-F1-model_v4 | L-seryl-tRNA selenium transferase N-terminal domain-containing protein | 0.6447 | 12 | 69 |
GO:0004125
|
| AF-A0A2V5L337-F1-model_v4 | L-seryl-tRNA(Sec) selenium transferase (EC 2.9.1.1) (Selenocysteine synthase) (Sec synthase) (Selenocysteinyl-tRNA(Sec) synthase) | 0.6214 | 3 | 69 |
GO:0001514
GO:0001717 GO:0004125 GO:0005737 |
| AF-A0A2V5LKD2-F1-model_v4 | L-seryl-tRNA(Sec) selenium transferase | 0.6002 | 8 | 69 |
GO:0016740
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar