F381035

General Info

Members Datasets Scaffolds Average Seq Length
276 213 552 394

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100192846|Ga0075428_1001928461
Length 452
Sequence MSMARLVITAVTIEGRSKSEVAREYGVSRVWVQKLIHRFDADGEAAFEPRSRRPHSNPYAVDLGVEDQIVRLRKQLSKDGLDAGAETIAAHLQINGVSAVPAVSTIWRILSRRGFVVAQPQKRPRSSWHRFCAEQPNERWQADITHWRLADGAEVEILNILDDHSRVNIAAKARRITLGPQVVDTFTAAFGRWGLPASVLTDNGAVFTAKQRGEGRVALEVQLGLRGIRLQHSRPYHPQTCGKVERFHQTQKKWLRAQPRAATLVRLQHQLNRFQTYYNTVRPHRALGRRTPAQAYAARPKAVPTGPIIPTHYRVRHDKIDRWGAVTLRHNSRLHHIGLGARLAGTPISLLIDDLHIRVIDRHTGELIRELILDPSRDYQPRGLPPGPPKQNAAIPRPASRSRPKRXXXSRGQGWPKATRRAPALTAARTAPPSPAGMPDTPRNATMSRDTC

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
120 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
146 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
147 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
148 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
169 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.16
Nodule 0
Rhizoplane 3.99
Rhizosphere 88.04
Stem 0
Stem Tuber 0
Unclassified 8.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100192846 3300006844 Unclassified 2203
2 JGI25407J50210_10018928 3300003373 Bacteria 1789
3 JGI25407J50210_10022300 3300003373 Bacteria 1646
4 JGI25407J50210_10031285 3300003373 Bacteria 1378
5 Ga0055525_1002934 3300003759 Bacteria 1602
6 JGI25405J52794_10009058 3300003911 Unclassified 1872
7 Ga0070682_100169984 3300005337 Bacteria 1514
8 Ga0070660_100052349 3300005339 Bacteria 3148
9 Ga0070692_10039313 3300005345 Bacteria 2415
10 Ga0070668_100190076 3300005347 Unclassified 1681
11 Ga0070659_100123070 3300005366 Bacteria 2103
12 Ga0070709_10169049 3300005434 Bacteria 1526
13 Ga0070714_100304918 3300005435 Bacteria 1485
14 Ga0070710_10080936 3300005437 Bacteria 1896
15 Ga0070710_10181287 3300005437 Bacteria 1319
16 Ga0070708_100155693 3300005445 Bacteria 2127
17 Ga0070708_100197871 3300005445 Bacteria 1881
18 Ga0070708_100245777 3300005445 Bacteria 1680
19 Ga0070662_100013407 3300005457 Bacteria 5454
20 Ga0068867_100394456 3300005459 Bacteria 1166
21 Ga0070706_100038032 3300005467 Bacteria 4443
22 Ga0070706_100289853 3300005467 Unclassified 1527
23 Ga0070707_100264545 3300005468 Bacteria 1673
24 Ga0070698_100014251 3300005471 Bacteria 8404
25 Ga0070698_100186750 3300005471 Bacteria 2011
26 Ga0070698_100217099 3300005471 Bacteria 1847
27 Ga0070698_100311008 3300005471 Unclassified 1506
28 Ga0070699_100099993 3300005518 Bacteria 2542
29 Ga0070699_100213458 3300005518 Bacteria 1719
30 Ga0070697_100167553 3300005536 Bacteria 1858
31 Ga0068853_100162921 3300005539 Bacteria 2013
32 Ga0070672_100252915 3300005543 Bacteria 1484
33 Ga0070665_100161101 3300005548 Bacteria 2246
34 Ga0070704_100016412 3300005549 Bacteria 4678
35 Ga0068855_100231356 3300005563 Bacteria 2069
36 Ga0070664_100325213 3300005564 Bacteria 1394
37 Ga0068856_100356885 3300005614 Bacteria 1480
38 Ga0068856_100460452 3300005614 Unclassified 1292
39 Ga0070702_100044588 3300005615 Bacteria 2505
40 Ga0068859_100170826 3300005617 Bacteria 2255
41 Ga0068864_100417098 3300005618 Unclassified 1278
42 Ga0068866_10128529 3300005718 Bacteria 1438
43 Ga0068861_100227949 3300005719 Bacteria 1578
44 Ga0068863_100108850 3300005841 Bacteria 2638
45 Ga0068862_100215718 3300005844 Bacteria 1735
46 Ga0081455_10003703 3300005937 Bacteria 17504
47 Ga0081455_10003831 3300005937 Bacteria 17155
48 Ga0081455_10016831 3300005937 Bacteria 7032
49 Ga0081455_10049804 3300005937 Bacteria 3608
50 Ga0081455_10104645 3300005937 Bacteria 2264
51 Ga0081538_10000222 3300005981 Bacteria 64190
52 Ga0081538_10087166 3300005981 Bacteria 1631
53 Ga0070717_10323911 3300006028 Bacteria 1373
54 Ga0075365_10055249 3300006038 Bacteria 2635
55 Ga0075363_100153125 3300006048 Bacteria 1302
56 Ga0075362_10011704 3300006177 Bacteria 3462
57 Ga0075367_10043470 3300006178 Bacteria 2631
58 Ga0075369_10081163 3300006186 Bacteria 1438
59 Ga0075370_10039781 3300006353 Bacteria 2650
60 Ga0075428_100171725 3300006844 Unclassified 2350
61 Ga0075431_100343558 3300006847 Bacteria 1501
62 Ga0075433_10200016 3300006852 Bacteria 1776
63 Ga0075434_100410921 3300006871 Bacteria 1374
64 Ga0075429_100176858 3300006880 Bacteria 1870
65 Ga0075429_100242089 3300006880 Unclassified 1580
66 Ga0068865_100169429 3300006881 Bacteria 1673
67 Ga0068865_100193823 3300006881 Unclassified 1573
68 Ga0075436_100085563 3300006914 Unclassified 2189
69 Ga0097620_100170824 3300006931 Bacteria 2255
70 Ga0075435_100197610 3300007076 Unclassified 1703
71 Ga0111539_10072871 3300009094 Bacteria 4050
72 Ga0105245_10238027 3300009098 Bacteria 1763
73 Ga0105247_10152179 3300009101 Bacteria 1525
74 Ga0105243_10056431 3300009148 Bacteria 3123
75 Ga0105243_10207601 3300009148 Bacteria 1722
76 Ga0105248_10167422 3300009177 Bacteria 2477
77 Ga0105248_10383849 3300009177 Bacteria 1582
78 Ga0105238_10247743 3300009551 Bacteria 1759
79 Ga0105238_10249654 3300009551 Bacteria 1752
80 Ga0105249_10378321 3300009553 Bacteria 1441
81 Ga0105239_10191419 3300010375 Unclassified 2290
82 Ga0105239_10239047 3300010375 Bacteria 2038
83 Ga0157369_10304961 3300013105 Unclassified 1656
84 Ga0163162_10392129 3300013306 Bacteria 1521
85 Ga0157372_10350310 3300013307 Bacteria 1720
86 Ga0163163_10205564 3300014325 Bacteria 2017
87 Ga0163163_10458078 3300014325 Bacteria 1336
88 Ga0157380_10000677 3300014326 Bacteria 21112
89 Ga0157376_10157734 3300014969 Bacteria 2054
90 Ga0163161_10122215 3300017792 Bacteria 1957
91 Ga0213876_10039563 3300021384 Bacteria 2491
92 Ga0213875_10033902 3300021388 Bacteria 2412
93 Ga0209563_100321 3300025230 Bacteria 18972
94 Ga0209677_110557 3300025253 Bacteria 1524
95 Ga0207688_10108852 3300025901 Bacteria 1607
96 Ga0207684_10306790 3300025910 Bacteria 1368
97 Ga0207684_10312613 3300025910 Unclassified 1354
98 Ga0207657_10142767 3300025919 Bacteria 1955
99 Ga0207646_10234147 3300025922 Bacteria 1659
100 Ga0207646_10275251 3300025922 Bacteria 1521
101 Ga0207694_10204007 3300025924 Bacteria 1609
102 Ga0207687_10216076 3300025927 Bacteria 1507
103 Ga0207700_10001581 3300025928 Bacteria 12931
104 Ga0207644_10235744 3300025931 Bacteria 1455
105 Ga0207706_10237871 3300025933 Bacteria 1592
106 Ga0207709_10129648 3300025935 Bacteria 1717
107 Ga0207669_10202049 3300025937 Bacteria 1443
108 Ga0207704_10171966 3300025938 Bacteria 1555
109 Ga0207665_10115564 3300025939 Bacteria 1890
110 Ga0207711_10199442 3300025941 Bacteria 1826
111 Ga0207711_10354840 3300025941 Bacteria 1358
112 Ga0207661_10304899 3300025944 Bacteria 1428
113 Ga0207712_10194927 3300025961 Unclassified 1602
114 Ga0207668_10367895 3300025972 Unclassified 1206
115 Ga0207658_10133245 3300025986 Bacteria 2000
116 Ga0207677_10225960 3300026023 Bacteria 1504
117 Ga0207639_10275903 3300026041 Unclassified 1477
118 Ga0207708_10069614 3300026075 Bacteria 2694
119 Ga0207648_10050561 3300026089 Bacteria 3635
120 Ga0207676_10403150 3300026095 Unclassified 1278
121 Ga0207675_100015651 3300026118 Bacteria 7073
122 Ga0207675_100066950 3300026118 Bacteria 3357
123 Ga0207683_10020226 3300026121 Bacteria 5690
124 Ga0207698_10294536 3300026142 Unclassified 1508
125 Ga0207428_10019796 3300027907 Bacteria 5733
126 Ga0207428_10214521 3300027907 Bacteria 1445
127 Ga0268265_10148954 3300028380 Bacteria 1971
128 Ga0268264_10256909 3300028381 Bacteria 1626
129 Ga0265770_1008419 3300030878 Bacteria 1470
130 Ga0265760_10015400 3300031090 Bacteria 2191
131 Ga0265327_10000607 3300031251 Bacteria 59510
132 Ga0307405_10085291 3300031731 Bacteria 2076
133 Ga0307406_10242266 3300031901 Bacteria 1353
134 Ga0307407_10145358 3300031903 Bacteria 1534
135 Ga0307407_10172718 3300031903 Bacteria 1425
136 Ga0307409_100078265 3300031995 Bacteria 2659
137 Ga0307415_100034266 3300032126 Bacteria 3304
138 Ga0373960_0038025 3300035121 Bacteria 1378
139 Ga0373931_0098104 3300035691 Bacteria 1644
140 Ga0373931_0108340 3300035691 Bacteria 1572
141 Ga0373937_0180766 3300036401 Bacteria 1981
142 Ga0373937_0220291 3300036401 Bacteria 1786
143 Ga0373925_0121739 3300037068 Bacteria 2026
144 Ga0395900_0167435 3300037418 Bacteria 2239
145 Ga0395900_0388366 3300037418 Bacteria 1362
146 Ga0395898_0196174 3300037466 Bacteria 1928
147 Ga0395898_0253199 3300037466 Bacteria 1679
148 Ga0395898_0288887 3300037466 Bacteria 1564
149 Ga0395905_0037229 3300037471 Bacteria 4569
150 Ga0436364_0119272 3300037853 Bacteria 2929
151 Ga0395901_0296955 3300038443 Bacteria 1675
152 Ga0395901_0302774 3300038443 Bacteria 1657
153 Ga0395901_0406814 3300038443 Bacteria 1397
154 Ga0436365_0176013 3300039437 Bacteria 3258
155 Ga0436363_1695904 3300039450 Bacteria 1360
156 Ga0439448_0008728 3300042005 Bacteria 2971
157 Ga0439456_018767 3300042013 Bacteria 1453
158 Ga0466972_0083426 3300044658 Bacteria 1520
159 Ga0466972_0117243 3300044658 Bacteria 1256
160 Ga0466965_0006978 3300044683 Bacteria 5167
161 Ga0466965_0124789 3300044683 Bacteria 1331
162 Ga0466966_0111228 3300044684 Bacteria 1688
163 Ga0466966_0118080 3300044684 Bacteria 1631
164 Ga0466961_0011885 3300044693 Bacteria 5564
165 Ga0466961_0100072 3300044693 Bacteria 1827
166 Ga0466963_0165273 3300044694 Bacteria 1541
167 Ga0466964_0052903 3300044706 Bacteria 1670
168 Ga0466971_0047942 3300044719 Bacteria 1920
169 Ga0466968_0028333 3300044735 Bacteria 2309
170 Ga0466970_0038051 3300044765 Bacteria 2551
171 Ga0466970_0046541 3300044765 Bacteria 2311
172 Ga0466957_0071522 3300044842 Bacteria 2145
173 Ga0466960_0102237 3300044901 Bacteria 1477
174 Ga0466959_0118254 3300045049 Bacteria 1886
175 Ga0466959_0118979 3300045049 Bacteria 1879
176 Ga0466958_0165115 3300045836 Bacteria 1400
177 Ga0466967_0153007 3300045976 Bacteria 2158
178 Ga0495627_040401 3300046453 Bacteria 1436
179 Ga0495629_0171776 3300046459 Bacteria 1504
180 Ga0495629_0179777 3300046459 Bacteria 1466
181 Ga0495641_0079964 3300046461 Bacteria 1464
182 Ga0495651_0036454 3300046462 Bacteria 3829
183 Ga0495653_0054023 3300046463 Bacteria 3071
184 Ga0495582_0114849 3300046473 Bacteria 1513
185 Ga0495582_0166942 3300046473 Bacteria 1252
186 Ga0495664_0052896 3300046477 Bacteria 2414
187 Ga0495616_0106357 3300046513 Bacteria 1309
188 Ga0495628_0257210 3300046516 Bacteria 1302
189 Ga0495630_0153233 3300046517 Bacteria 1754
190 Ga0495630_0167252 3300046517 Bacteria 1674
191 Ga0495631_0062777 3300046518 Bacteria 1609
192 Ga0495637_0068882 3300046520 Bacteria 1433
193 Ga0495644_0016538 3300046523 Bacteria 2823
194 Ga0495666_0027576 3300046526 Bacteria 2795
195 Ga0495665_0086499 3300046531 Bacteria 1647
196 Ga0495665_0098204 3300046531 Bacteria 1537
197 Ga0495621_0008825 3300046539 Bacteria 3037
198 Ga0495597_0081060 3300046542 Bacteria 1388
199 Ga0495645_0230229 3300046543 Bacteria 1242
200 Ga0495667_0041580 3300046559 Bacteria 3048
201 Ga0495656_0080802 3300046615 Bacteria 1466
202 Ga0495668_0086732 3300046616 Bacteria 1717
203 Ga0495634_0171681 3300046642 Bacteria 1362
204 Ga0495635_0163536 3300046663 Bacteria 1514
205 Ga0495659_0050099 3300046664 Bacteria 1518
206 Ga0495657_0124010 3300046675 Bacteria 1624
207 Ga0495647_0058529 3300046681 Bacteria 1515
208 Ga0495658_0149654 3300046683 Bacteria 1433
209 Ga0495658_0198547 3300046683 Bacteria 1249
210 Ga0495613_0162293 3300046689 Bacteria 1589
211 Ga0495589_0098110 3300046794 Bacteria 1419
212 Ga0495600_0166379 3300046809 Bacteria 1424
213 Ga0495581_0238286 3300047315 Bacteria 1064
214 Ga0495604_0102095 3300047317 Bacteria 2105
215 Ga0495680_0000143 3300047322 Bacteria 71946
216 Ga0495614_0094095 3300048089 Bacteria 1305
217 Ga0495615_0020634 3300048090 Bacteria 1479
218 Ga0496100_0215942 3300048903 Bacteria 1405
219 Ga0496102_0342682 3300048905 Bacteria 1407
220 Ga0496105_0254996 3300048908 Bacteria 1420
221 Ga0496108_0169528 3300048911 Bacteria 1888
222 Ga0496109_0275197 3300048912 Bacteria 1586
223 Ga0496109_0285521 3300048912 Bacteria 1555
224 Ga0496109_0355859 3300048912 Bacteria 1383
225 Ga0496110_0094759 3300048913 Bacteria 2673
226 Ga0496111_0175950 3300048914 Bacteria 1591
227 Ga0496112_0298196 3300048915 Bacteria 1557
228 Ga0496113_0285303 3300048916 Bacteria 1320
229 Ga0501032_0060797 3300049569 Bacteria 2534
230 Ga0501034_0252155 3300049571 Bacteria 1709
231 Ga0501036_0137940 3300049572 Bacteria 2058
232 Ga0501036_0251304 3300049572 Bacteria 1482
233 Ga0501038_0086038 3300049574 Bacteria 2642
234 Ga0501038_0208906 3300049574 Bacteria 1563
235 Ga0501039_0032461 3300049575 Bacteria 4026
236 Ga0501039_0195768 3300049575 Bacteria 1589
237 Ga0501040_0056901 3300049576 Bacteria 2684
238 Ga0501040_0167659 3300049576 Bacteria 1554
239 Ga0501071_0272589 3300049587 Bacteria 1279
240 Ga0501072_0260096 3300049588 Bacteria 1381
241 Ga0501074_0105516 3300049590 Bacteria 2017
242 Ga0501075_0090190 3300049591 Bacteria 2325
243 Ga0501077_0145098 3300049593 Bacteria 1505
244 Ga0501077_0174324 3300049593 Bacteria 1366
245 Ga0501079_0143408 3300049741 Bacteria 1861
246 Ga0501079_0230557 3300049741 Bacteria 1446
247 Ga0501081_0157342 3300049743 Bacteria 1635
248 Ga0501035_0028405 3300049822 Bacteria 5106
249 Ga0501045_0139047 3300049824 Bacteria 1806
250 Ga0501045_0240599 3300049824 Bacteria 1347
251 nmdc:mga03683_26813_c1 3300050489 Bacteria 2277
252 nmdc:mga03n38_89326_c1 3300050490 Bacteria 1464
253 nmdc:mga0yw44_72809_c1 3300050492 Bacteria 2137
254 nmdc:mga06z11_21246_c1 3300050494 Bacteria 3014
255 nmdc:mga07m45_81135_c1 3300050496 Bacteria 1852
256 nmdc:mga05p37_129195_c1 3300050507 Plasmid 3101
257 nmdc:mga09592_238598_c1 3300050508 Unclassified 1575
258 nmdc:mga08y16_433381_c1 3300050511 Unclassified 1343
259 nmdc:mga0n895_425191_c1 3300050512 Unclassified 1343
260 nmdc:mga0n895_68566_c1 3300050512 Bacteria 3514
261 nmdc:mga08x19_141436_c1 3300050514 Unclassified 1626
262 nmdc:mga0sz30_120513_c1 3300050516 Bacteria 1152
263 nmdc:mga0sz30_73531_c1 3300050516 Bacteria 1474
264 Ga0495601_0171515 3300053077 Bacteria 1418
265 Ga0495601_0180133 3300053077 Bacteria 1382
266 Ga0495595_0027113 3300053084 Bacteria 2550
267 Ga0495619_0000744 3300053085 Bacteria 21210
268 Ga0495619_0155963 3300053085 Bacteria 1575
269 Ga0500573_0173492 3300053140 Bacteria 1164
270 Ga0501084_0304760 3300054114 Bacteria 1345
271 Ga0590075_008319 3300059424 Bacteria 2477
272 Ga0501082_0295868 3300060353 Bacteria 1409
273 Ga0466962_0054839 3300061719 Bacteria 1904
274 Ga0466962_0116318 3300061719 Bacteria 1288
275 Ga0530510_0009215 3300061734 Bacteria 6919
276 Ga0530510_0186137 3300061734 Bacteria 1541
277 Ga0075428_100192846
278 JGI25407J50210_10018928
279 JGI25407J50210_10022300
280 JGI25407J50210_10031285
281 Ga0055525_1002934
282 JGI25405J52794_10009058
283 Ga0070682_100169984
284 Ga0070660_100052349
285 Ga0070692_10039313
286 Ga0070668_100190076
287 Ga0070659_100123070
288 Ga0070709_10169049
289 Ga0070714_100304918
290 Ga0070710_10080936
291 Ga0070710_10181287
292 Ga0070708_100155693
293 Ga0070708_100197871
294 Ga0070708_100245777
295 Ga0070662_100013407
296 Ga0068867_100394456
297 Ga0070706_100038032
298 Ga0070706_100289853
299 Ga0070707_100264545
300 Ga0070698_100014251
301 Ga0070698_100186750
302 Ga0070698_100217099
303 Ga0070698_100311008
304 Ga0070699_100099993
305 Ga0070699_100213458
306 Ga0070697_100167553
307 Ga0068853_100162921
308 Ga0070672_100252915
309 Ga0070665_100161101
310 Ga0070704_100016412
311 Ga0068855_100231356
312 Ga0070664_100325213
313 Ga0068856_100356885
314 Ga0068856_100460452
315 Ga0070702_100044588
316 Ga0068859_100170826
317 Ga0068864_100417098
318 Ga0068866_10128529
319 Ga0068861_100227949
320 Ga0068863_100108850
321 Ga0068862_100215718
322 Ga0081455_10003703
323 Ga0081455_10003831
324 Ga0081455_10016831
325 Ga0081455_10049804
326 Ga0081455_10104645
327 Ga0081538_10000222
328 Ga0081538_10087166
329 Ga0070717_10323911
330 Ga0075365_10055249
331 Ga0075363_100153125
332 Ga0075362_10011704
333 Ga0075367_10043470
334 Ga0075369_10081163
335 Ga0075370_10039781
336 Ga0075428_100171725
337 Ga0075431_100343558
338 Ga0075433_10200016
339 Ga0075434_100410921
340 Ga0075429_100176858
341 Ga0075429_100242089
342 Ga0068865_100169429
343 Ga0068865_100193823
344 Ga0075436_100085563
345 Ga0097620_100170824
346 Ga0075435_100197610
347 Ga0111539_10072871
348 Ga0105245_10238027
349 Ga0105247_10152179
350 Ga0105243_10056431
351 Ga0105243_10207601
352 Ga0105248_10167422
353 Ga0105248_10383849
354 Ga0105238_10247743
355 Ga0105238_10249654
356 Ga0105249_10378321
357 Ga0105239_10191419
358 Ga0105239_10239047
359 Ga0157369_10304961
360 Ga0163162_10392129
361 Ga0157372_10350310
362 Ga0163163_10205564
363 Ga0163163_10458078
364 Ga0157380_10000677
365 Ga0157376_10157734
366 Ga0163161_10122215
367 Ga0213876_10039563
368 Ga0213875_10033902
369 Ga0209563_100321
370 Ga0209677_110557
371 Ga0207688_10108852
372 Ga0207684_10306790
373 Ga0207684_10312613
374 Ga0207657_10142767
375 Ga0207646_10234147
376 Ga0207646_10275251
377 Ga0207694_10204007
378 Ga0207687_10216076
379 Ga0207700_10001581
380 Ga0207644_10235744
381 Ga0207706_10237871
382 Ga0207709_10129648
383 Ga0207669_10202049
384 Ga0207704_10171966
385 Ga0207665_10115564
386 Ga0207711_10199442
387 Ga0207711_10354840
388 Ga0207661_10304899
389 Ga0207712_10194927
390 Ga0207668_10367895
391 Ga0207658_10133245
392 Ga0207677_10225960
393 Ga0207639_10275903
394 Ga0207708_10069614
395 Ga0207648_10050561
396 Ga0207676_10403150
397 Ga0207675_100015651
398 Ga0207675_100066950
399 Ga0207683_10020226
400 Ga0207698_10294536
401 Ga0207428_10019796
402 Ga0207428_10214521
403 Ga0268265_10148954
404 Ga0268264_10256909
405 Ga0265770_1008419
406 Ga0265760_10015400
407 Ga0265327_10000607
408 Ga0307405_10085291
409 Ga0307406_10242266
410 Ga0307407_10145358
411 Ga0307407_10172718
412 Ga0307409_100078265
413 Ga0307415_100034266
414 Ga0373960_0038025
415 Ga0373931_0098104
416 Ga0373931_0108340
417 Ga0373937_0180766
418 Ga0373937_0220291
419 Ga0373925_0121739
420 Ga0395900_0167435
421 Ga0395900_0388366
422 Ga0395898_0196174
423 Ga0395898_0253199
424 Ga0395898_0288887
425 Ga0395905_0037229
426 Ga0436364_0119272
427 Ga0395901_0296955
428 Ga0395901_0302774
429 Ga0395901_0406814
430 Ga0436365_0176013
431 Ga0436363_1695904
432 Ga0439448_0008728
433 Ga0439456_018767
434 Ga0466972_0083426
435 Ga0466972_0117243
436 Ga0466965_0006978
437 Ga0466965_0124789
438 Ga0466966_0111228
439 Ga0466966_0118080
440 Ga0466961_0011885
441 Ga0466961_0100072
442 Ga0466963_0165273
443 Ga0466964_0052903
444 Ga0466971_0047942
445 Ga0466968_0028333
446 Ga0466970_0038051
447 Ga0466970_0046541
448 Ga0466957_0071522
449 Ga0466960_0102237
450 Ga0466959_0118254
451 Ga0466959_0118979
452 Ga0466958_0165115
453 Ga0466967_0153007
454 Ga0495627_040401
455 Ga0495629_0171776
456 Ga0495629_0179777
457 Ga0495641_0079964
458 Ga0495651_0036454
459 Ga0495653_0054023
460 Ga0495582_0114849
461 Ga0495582_0166942
462 Ga0495664_0052896
463 Ga0495616_0106357
464 Ga0495628_0257210
465 Ga0495630_0153233
466 Ga0495630_0167252
467 Ga0495631_0062777
468 Ga0495637_0068882
469 Ga0495644_0016538
470 Ga0495666_0027576
471 Ga0495665_0086499
472 Ga0495665_0098204
473 Ga0495621_0008825
474 Ga0495597_0081060
475 Ga0495645_0230229
476 Ga0495667_0041580
477 Ga0495656_0080802
478 Ga0495668_0086732
479 Ga0495634_0171681
480 Ga0495635_0163536
481 Ga0495659_0050099
482 Ga0495657_0124010
483 Ga0495647_0058529
484 Ga0495658_0149654
485 Ga0495658_0198547
486 Ga0495613_0162293
487 Ga0495589_0098110
488 Ga0495600_0166379
489 Ga0495581_0238286
490 Ga0495604_0102095
491 Ga0495680_0000143
492 Ga0495614_0094095
493 Ga0495615_0020634
494 Ga0496100_0215942
495 Ga0496102_0342682
496 Ga0496105_0254996
497 Ga0496108_0169528
498 Ga0496109_0275197
499 Ga0496109_0285521
500 Ga0496109_0355859
501 Ga0496110_0094759
502 Ga0496111_0175950
503 Ga0496112_0298196
504 Ga0496113_0285303
505 Ga0501032_0060797
506 Ga0501034_0252155
507 Ga0501036_0137940
508 Ga0501036_0251304
509 Ga0501038_0086038
510 Ga0501038_0208906
511 Ga0501039_0032461
512 Ga0501039_0195768
513 Ga0501040_0056901
514 Ga0501040_0167659
515 Ga0501071_0272589
516 Ga0501072_0260096
517 Ga0501074_0105516
518 Ga0501075_0090190
519 Ga0501077_0145098
520 Ga0501077_0174324
521 Ga0501079_0143408
522 Ga0501079_0230557
523 Ga0501081_0157342
524 Ga0501035_0028405
525 Ga0501045_0139047
526 Ga0501045_0240599
527 nmdc:mga03683_26813_c1
528 nmdc:mga03n38_89326_c1
529 nmdc:mga0yw44_72809_c1
530 nmdc:mga06z11_21246_c1
531 nmdc:mga07m45_81135_c1
532 nmdc:mga05p37_129195_c1
533 nmdc:mga09592_238598_c1
534 nmdc:mga08y16_433381_c1
535 nmdc:mga0n895_425191_c1
536 nmdc:mga0n895_68566_c1
537 nmdc:mga08x19_141436_c1
538 nmdc:mga0sz30_120513_c1
539 nmdc:mga0sz30_73531_c1
540 Ga0495601_0171515
541 Ga0495601_0180133
542 Ga0495595_0027113
543 Ga0495619_0000744
544 Ga0495619_0155963
545 Ga0500573_0173492
546 Ga0501084_0304760
547 Ga0590075_008319
548 Ga0501082_0295868
549 Ga0466962_0054839
550 Ga0466962_0116318
551 Ga0530510_0009215
552 Ga0530510_0186137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13683

rve_3

Integrase core domain

226

292

0.99

PF00665

rve

Integrase core domain

133

238

0.96

PF13518

HTH_28

Helix-turn-helix domain

5

55

0.92

PF13565

HTH_32

Homeodomain-like domain

31

110

0.88

PF13551

HTH_29

Winged helix-turn helix

13

58

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qbv-assembly1.cif.gz_B structure of the htlv-2 integrase catalytic core domain in complex with magnesium (dimeric form) 0.8833 138 300
6qbt-assembly1.cif.gz_A structure of the htlv-2 integrase catalytic core domain in complex with magnesium (trimeric form) 0.8811 137 300
8d8k-assembly1.cif.gz_6 yeast mitochondrial small subunit assembly intermediate (state 2) 0.8766 4 42
3sv1-assembly2.cif.gz_B crystal structure of app peptide bound rat mint2 parm 0.8755 350 376
3sv1-assembly1.cif.gz_A crystal structure of app peptide bound rat mint2 parm 0.8728 350 376
ID Description Score Start End Superfamily
af_P37007_135_295_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9168 135 295 3.30.420.10
af_P37007_135_295_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9006 135 295 3.30.420.10
3l2qA03 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8875 143 261 3.30.420.10
3sv1C00 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8862 350 376 2.30.29.30
af_I6YC39_133_303_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8805 135 302 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A7V9AX17-F1-model_v4 Transposase 0.98 317 387
AF-A0A3C0XPY3-F1-model_v4 Transposase 0.9795 316 388
AF-A0A2U2NAA7-F1-model_v4 IS481 family transposase 0.9731 142 309 GO:0003676
GO:0015074
AF-A0A4P6MUL7-F1-model_v4 Transposase 0.9725 322 383
AF-A0A853GA30-F1-model_v4 Transposase family protein 0.9489 137 302 GO:0003676
GO:0015074

Map