F380942

General Info

Members Datasets Scaffolds Average Seq Length
276 195 552 213

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100184998|Ga0070688_1001849982
Length 231
Sequence VVPGDESDSTVADSNTGMDRLPRGRHGLSPEFVAANQRERLIAGLIQALYEVGYQRTTVSLIGQRAAVSKSDFYKHFESKDDCFVAAYEVAVDQIRERVLVACRDAKQNDWALRVRAAIEALLKTFAAEPALASITLVEGLRAGRGVYDRYQAAIESFVGYLREGAPPGPTGTEVPEATDEAVIGGIASLLGRRVLAGDGEELERLFPEILEFALTAYLGVEEARRIVSAG

Samples

Sample ID Description Type Environment
1 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
106 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
137 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
155 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
156 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
190 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
193 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
194 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 1.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.09
Nodule 0
Rhizoplane 10.87
Rhizosphere 82.61
Stem 0
Stem Tuber 0
Unclassified 7.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070688_100184998 3300005365 Unclassified 1447
2 JGI24740J21852_10003061 3300001979 Bacteria 7397
3 Ga0070683_100002371 3300005329 Bacteria 14965
4 Ga0070683_100053041 3300005329 Bacteria 3758
5 Ga0070666_10013293 3300005335 Bacteria 5219
6 Ga0070682_100000072 3300005337 Bacteria 93808
7 Ga0068868_100012561 3300005338 Bacteria 6193
8 Ga0070660_100166039 3300005339 Bacteria 1781
9 Ga0070691_10000052 3300005341 Bacteria 32264
10 Ga0070661_100000116 3300005344 Bacteria 66712
11 Ga0070668_100024904 3300005347 Bacteria 4536
12 Ga0070671_100584857 3300005355 Bacteria 964
13 Ga0070673_100002079 3300005364 Bacteria 12071
14 Ga0070688_100000066 3300005365 Bacteria 52354
15 Ga0070688_100001648 3300005365 Bacteria 11173
16 Ga0070659_100004708 3300005366 Bacteria 9737
17 Ga0070667_100001620 3300005367 Bacteria 20157
18 Ga0070714_100044465 3300005435 Bacteria 3760
19 Ga0070713_100018675 3300005436 Bacteria 5272
20 Ga0070711_100439430 3300005439 Unclassified 1066
21 Ga0070700_100131114 3300005441 Bacteria 1692
22 Ga0070694_100512083 3300005444 Unclassified 956
23 Ga0070663_100006309 3300005455 Bacteria 7116
24 Ga0070678_100068110 3300005456 Bacteria 2652
25 Ga0068867_100003856 3300005459 Bacteria 10543
26 Ga0070685_10000165 3300005466 Bacteria 43529
27 Ga0070685_10000230 3300005466 Bacteria 36879
28 Ga0070679_100016482 3300005530 Bacteria 7130
29 Ga0070684_100057427 3300005535 Bacteria 3398
30 Ga0070684_100186434 3300005535 Bacteria 1887
31 Ga0070684_100380405 3300005535 Bacteria 1300
32 Ga0068853_100139596 3300005539 Bacteria 2175
33 Ga0070695_100461393 3300005545 Bacteria 975
34 Ga0070665_100000846 3300005548 Bacteria 39881
35 Ga0070665_100620252 3300005548 Unclassified 1094
36 Ga0068855_100184139 3300005563 Unclassified 2360
37 Ga0068855_100503935 3300005563 Unclassified 1315
38 Ga0070664_100008800 3300005564 Bacteria 8179
39 Ga0068854_100000044 3300005578 Bacteria 91882
40 Ga0070702_100063247 3300005615 Bacteria 2160
41 Ga0068852_100000695 3300005616 Bacteria 22042
42 Ga0068852_100190294 3300005616 Bacteria 1936
43 Ga0068851_10000248 3300005834 Bacteria 25411
44 Ga0068870_10019517 3300005840 Unclassified 3288
45 Ga0068863_100004151 3300005841 Bacteria 14307
46 Ga0068860_100545906 3300005843 Bacteria 1161
47 Ga0081455_10010603 3300005937 Bacteria 9323
48 Ga0081455_10021869 3300005937 Bacteria 5991
49 Ga0081540_1000503 3300005983 Bacteria 38494
50 Ga0070715_10415583 3300006163 Unclassified 751
51 Ga0070712_100000398 3300006175 Bacteria 24725
52 Ga0068865_100000019 3300006881 Bacteria 105996
53 Ga0105245_10000012 3300009098 Bacteria 267151
54 Ga0105245_10011485 3300009098 Bacteria 7714
55 Ga0105247_10000204 3300009101 Bacteria 58153
56 Ga0105247_10442686 3300009101 Bacteria 935
57 Ga0105243_10047064 3300009148 Bacteria 3394
58 Ga0105241_10242702 3300009174 Bacteria 1524
59 Ga0105241_10485255 3300009174 Unclassified 1099
60 Ga0105242_10000104 3300009176 Bacteria 60125
61 Ga0105242_10000708 3300009176 Bacteria 26091
62 Ga0105242_10443968 3300009176 Bacteria 1221
63 Ga0105248_10000126 3300009177 Bacteria 88461
64 Ga0105237_10368850 3300009545 Bacteria 1440
65 Ga0105238_10123467 3300009551 Bacteria 2569
66 Ga0105239_10085827 3300010375 Bacteria 3470
67 Ga0105239_10726366 3300010375 Bacteria 1136
68 Ga0157373_10204615 3300013100 Bacteria 1392
69 Ga0157371_10002479 3300013102 Bacteria 17548
70 Ga0157370_10045099 3300013104 Bacteria 4232
71 Ga0157370_10119834 3300013104 Bacteria 2457
72 Ga0157370_10961123 3300013104 Unclassified 774
73 Ga0157369_10000135 3300013105 Bacteria 105364
74 Ga0157378_10000598 3300013297 Bacteria 33812
75 Ga0157378_10013636 3300013297 Bacteria 7107
76 Ga0157378_10028090 3300013297 Bacteria 4961
77 Ga0157372_10001053 3300013307 Bacteria 30139
78 Ga0157375_10002149 3300013308 Bacteria 17037
79 Ga0157375_10302220 3300013308 Bacteria 1764
80 Ga0157380_10000009 3300014326 Bacteria 142155
81 Ga0157380_10590738 3300014326 Bacteria 1097
82 Ga0157379_10188101 3300014968 Bacteria 1866
83 Ga0157379_10207996 3300014968 Bacteria 1771
84 Ga0157376_10020413 3300014969 Bacteria 5124
85 Ga0157376_10829762 3300014969 Bacteria 939
86 Ga0163161_10029702 3300017792 Bacteria 3886
87 Ga0206354_10072416 3300020081 Bacteria 1476
88 Ga0206353_10337502 3300020082 Bacteria 1008
89 Ga0154015_1491069 3300020610 Unclassified 2569
90 Ga0207656_10000466 3300025321 Bacteria 13545
91 Ga0207656_10001576 3300025321 Bacteria 7583
92 Ga0207710_10000365 3300025900 Bacteria 31650
93 Ga0207680_10001149 3300025903 Bacteria 12477
94 Ga0207680_10097250 3300025903 Unclassified 1885
95 Ga0207654_10423080 3300025911 Unclassified 930
96 Ga0207707_10113558 3300025912 Bacteria 2367
97 Ga0207695_10212005 3300025913 Bacteria 1847
98 Ga0207693_10001041 3300025915 Bacteria 24820
99 Ga0207663_10013839 3300025916 Bacteria 4398
100 Ga0207649_10000005 3300025920 Bacteria 356179
101 Ga0207649_10315223 3300025920 Unclassified 1147
102 Ga0207652_10008865 3300025921 Bacteria 8104
103 Ga0207694_10309878 3300025924 Bacteria 1301
104 Ga0207687_10000011 3300025927 Bacteria 388349
105 Ga0207687_10006247 3300025927 Bacteria 7882
106 Ga0207700_10000016 3300025928 Bacteria 202434
107 Ga0207664_10002111 3300025929 Bacteria 13080
108 Ga0207690_10033135 3300025932 Bacteria 3320
109 Ga0207686_10000063 3300025934 Bacteria 96427
110 Ga0207686_10010056 3300025934 Bacteria 5146
111 Ga0207709_10010540 3300025935 Bacteria 5090
112 Ga0207704_10000009 3300025938 Bacteria 198266
113 Ga0207704_10728704 3300025938 Unclassified 823
114 Ga0207711_10000024 3300025941 Bacteria 293596
115 Ga0207711_10539584 3300025941 Unclassified 1088
116 Ga0207661_10000275 3300025944 Bacteria 33001
117 Ga0207661_10088650 3300025944 Bacteria 2572
118 Ga0207679_10024880 3300025945 Bacteria 4110
119 Ga0207667_10148726 3300025949 Unclassified 2411
120 Ga0207651_10026101 3300025960 Bacteria 3643
121 Ga0207668_10013374 3300025972 Bacteria 5051
122 Ga0207640_10000125 3300025981 Bacteria 58750
123 Ga0207658_10077774 3300025986 Bacteria 2532
124 Ga0207658_10287300 3300025986 Bacteria 1412
125 Ga0207658_10847376 3300025986 Archaea 831
126 Ga0207677_10006986 3300026023 Bacteria 6210
127 Ga0207639_10087561 3300026041 Bacteria 2483
128 Ga0207678_10039179 3300026067 Bacteria 4113
129 Ga0207708_10193177 3300026075 Bacteria 1621
130 Ga0207702_10000099 3300026078 Bacteria 100461
131 Ga0207702_10043505 3300026078 Bacteria 3771
132 Ga0207641_10008573 3300026088 Bacteria 8443
133 Ga0207648_10005689 3300026089 Bacteria 12502
134 Ga0207683_10110027 3300026121 Bacteria 2466
135 Ga0207698_10000009 3300026142 Bacteria 281300
136 Ga0268266_10000342 3300028379 Bacteria 72894
137 Ga0268266_10003048 3300028379 Bacteria 17158
138 Ga0265319_1000091 3300028563 Bacteria 70394
139 Ga0265338_10000752 3300028800 Bacteria 55238
140 Ga0265325_10007063 3300031241 Bacteria 6762
141 Ga0451807_2358537 3300041486 Bacteria 2466
142 Ga0451833_1356887 3300041491 Bacteria 2451
143 Ga0466957_0004936 3300044842 Bacteria 7464
144 Ga0466957_0075784 3300044842 Bacteria 2088
145 Ga0466958_0076259 3300045836 Bacteria 2058
146 Ga0466967_0000005 3300045976 Bacteria 149543
147 Ga0466967_0449630 3300045976 Bacteria 1259
148 Ga0495592_0000532 3300046454 Bacteria 27337
149 Ga0495629_0000552 3300046459 Bacteria 30604
150 Ga0495629_0003869 3300046459 Bacteria 11288
151 Ga0495641_0005533 3300046461 Bacteria 8485
152 Ga0495651_0021442 3300046462 Bacteria 5022
153 Ga0495582_0000007 3300046473 Bacteria 139882
154 Ga0495662_0001430 3300046476 Bacteria 11822
155 Ga0495594_0000007 3300046499 Bacteria 160047
156 Ga0495606_0000057 3300046507 Bacteria 197956
157 Ga0495608_0000010 3300046511 Bacteria 258660
158 Ga0495628_0000704 3300046516 Bacteria 30877
159 Ga0495628_0030900 3300046516 Unclassified 4334
160 Ga0495630_0000011 3300046517 Bacteria 232063
161 Ga0495630_0001454 3300046517 Bacteria 16406
162 Ga0495652_0000003 3300046529 Bacteria 597094
163 Ga0495652_0051866 3300046529 Bacteria 3501
164 Ga0495587_0011418 3300046536 Bacteria 5629
165 Ga0495587_0020693 3300046536 Bacteria 4058
166 Ga0495587_0142219 3300046536 Bacteria 1369
167 Ga0495622_0000437 3300046557 Bacteria 27136
168 Ga0495625_0001012 3300046660 Bacteria 37072
169 Ga0495635_0000026 3300046663 Bacteria 142517
170 Ga0495657_0000005 3300046675 Bacteria 254860
171 Ga0495647_0000351 3300046681 Bacteria 12999
172 Ga0495658_0000007 3300046683 Bacteria 139822
173 Ga0495658_0002596 3300046683 Bacteria 9092
174 Ga0495613_0007052 3300046689 Bacteria 8364
175 Ga0495624_0003396 3300046690 Bacteria 11814
176 Ga0495604_0000078 3300047317 Bacteria 83632
177 Ga0495674_0001786 3300047319 Bacteria 21206
178 Ga0495676_0026802 3300047321 Bacteria 4953
179 Ga0495676_0185648 3300047321 Bacteria 1454
180 Ga0495680_0005689 3300047322 Bacteria 11667
181 Ga0495675_0000004 3300047444 Bacteria 211049
182 Ga0495673_0154478 3300047469 Bacteria 885
183 Ga0495593_0101709 3300047673 Bacteria 1473
184 Ga0495602_0000009 3300048088 Bacteria 258991
185 Ga0495602_0000570 3300048088 Bacteria 34302
186 Ga0496100_0147593 3300048903 Bacteria 1674
187 Ga0496101_0273979 3300048904 Bacteria 1318
188 Ga0496102_0000045 3300048905 Bacteria 186726
189 Ga0496102_0026043 3300048905 Bacteria 5212
190 Ga0496102_0207562 3300048905 Bacteria 1847
191 Ga0496103_0000050 3300048906 Bacteria 152034
192 Ga0496103_0074976 3300048906 Bacteria 2121
193 Ga0496104_0000002 3300048907 Bacteria 686017
194 Ga0496104_0003112 3300048907 Bacteria 14308
195 Ga0496104_0017049 3300048907 Bacteria 6609
196 Ga0496105_0000001 3300048908 Bacteria 1328178
197 Ga0496105_0000351 3300048908 Bacteria 30325
198 Ga0496105_0012422 3300048908 Bacteria 6741
199 Ga0496105_0716163 3300048908 Unclassified 767
200 Ga0496106_0243219 3300048909 Bacteria 1438
201 Ga0496108_0000094 3300048911 Bacteria 93075
202 Ga0496108_0106825 3300048911 Bacteria 2390
203 Ga0496109_0000076 3300048912 Bacteria 104273
204 Ga0496109_0000248 3300048912 Bacteria 51780
205 Ga0496109_0432932 3300048912 Bacteria 1243
206 Ga0496110_0001428 3300048913 Bacteria 17262
207 Ga0496110_0093191 3300048913 Bacteria 2696
208 Ga0496111_0000001 3300048914 Bacteria 194837
209 Ga0496111_0180638 3300048914 Bacteria 1568
210 Ga0496112_0007872 3300048915 Bacteria 9490
211 Ga0496113_0000033 3300048916 Bacteria 59422
212 Ga0496113_0088976 3300048916 Bacteria 2376
213 Ga0496114_0000003 3300048917 Bacteria 630981
214 Ga0496115_0000071 3300048918 Bacteria 91922
215 Ga0496116_0000557 3300048919 Bacteria 49954
216 Ga0496117_0004714 3300048920 Bacteria 14807
217 Ga0496118_0001304 3300048921 Bacteria 37961
218 Ga0496119_0003008 3300048922 Bacteria 17854
219 Ga0496119_0012622 3300048922 Bacteria 6840
220 Ga0496119_0018358 3300048922 Bacteria 5211
221 Ga0496119_0172199 3300048922 Bacteria 1142
222 Ga0496120_0007264 3300048923 Bacteria 8282
223 Ga0496121_0010365 3300048924 Bacteria 10526
224 Ga0496121_0019448 3300048924 Bacteria 6789
225 Ga0496124_0041514 3300048927 Bacteria 3969
226 Ga0496125_0125674 3300048928 Bacteria 1818
227 Ga0496126_0023988 3300048929 Bacteria 5898
228 Ga0496126_0267811 3300048929 Bacteria 1418
229 Ga0501031_0005999 3300049568 Bacteria 7930
230 Ga0501032_0005430 3300049569 Bacteria 9470
231 Ga0501033_0002771 3300049570 Bacteria 14700
232 Ga0501034_0019221 3300049571 Bacteria 6993
233 Ga0501034_0058344 3300049571 Bacteria 3879
234 Ga0501034_0286238 3300049571 Unclassified 1587
235 Ga0501036_0007955 3300049572 Bacteria 8677
236 Ga0501037_0012861 3300049573 Bacteria 6167
237 Ga0501038_0002980 3300049574 Bacteria 15783
238 Ga0501040_0056085 3300049576 Bacteria 2703
239 Ga0501042_0081822 3300049578 Bacteria 2314
240 Ga0501043_0008412 3300049579 Bacteria 8126
241 Ga0501046_0010956 3300049580 Bacteria 7774
242 Ga0501047_0004982 3300049581 Bacteria 12465
243 Ga0501047_0010632 3300049581 Bacteria 8701
244 Ga0501047_0104101 3300049581 Bacteria 2718
245 Ga0501047_0242167 3300049581 Bacteria 1654
246 Ga0501048_0008910 3300049582 Bacteria 7553
247 Ga0501068_0016514 3300049584 Bacteria 4256
248 Ga0501068_0064432 3300049584 Bacteria 2230
249 Ga0501069_0014298 3300049585 Bacteria 4242
250 Ga0501070_0002754 3300049586 Bacteria 15347
251 Ga0501070_0125972 3300049586 Bacteria 2117
252 Ga0501070_0270296 3300049586 Bacteria 1388
253 Ga0501073_0033340 3300049589 Bacteria 3667
254 Ga0501074_0036411 3300049590 Bacteria 3564
255 Ga0501074_0162143 3300049590 Unclassified 1597
256 Ga0501079_0041462 3300049741 Bacteria 3554
257 Ga0501080_0033103 3300049742 Bacteria 4824
258 Ga0501083_0003488 3300049744 Bacteria 11002
259 Ga0501083_0008477 3300049744 Bacteria 7262
260 Ga0501035_0003459 3300049822 Bacteria 15111
261 Ga0501044_0004658 3300049823 Bacteria 15347
262 Ga0501044_0192687 3300049823 Bacteria 2000
263 Ga0501045_0055309 3300049824 Bacteria 2902
264 nmdc:mga0qj67_39012_c1 3300050509 Bacteria 3728
265 Ga0495601_0007034 3300053077 Bacteria 6593
266 Ga0495655_0000004 3300053083 Bacteria 293683
267 Ga0495655_0000572 3300053083 Bacteria 6069
268 Ga0495595_0000005 3300053084 Bacteria 258660
269 Ga0495595_0050618 3300053084 Bacteria 1924
270 Ga0495619_0000030 3300053085 Bacteria 157134
271 Ga0495619_0000040 3300053085 Bacteria 118238
272 Ga0495619_0034658 3300053085 Bacteria 3282
273 Ga0500566_0029146 3300053094 Bacteria 3225
274 Ga0500595_049698 3300053119 Unclassified 1305
275 Ga0500628_000004 3300053129 Bacteria 202098
276 Ga0501082_0012506 3300060353 Bacteria 7291
277 Ga0070688_100184998
278 JGI24740J21852_10003061
279 Ga0070683_100002371
280 Ga0070683_100053041
281 Ga0070666_10013293
282 Ga0070682_100000072
283 Ga0068868_100012561
284 Ga0070660_100166039
285 Ga0070691_10000052
286 Ga0070661_100000116
287 Ga0070668_100024904
288 Ga0070671_100584857
289 Ga0070673_100002079
290 Ga0070688_100000066
291 Ga0070688_100001648
292 Ga0070659_100004708
293 Ga0070667_100001620
294 Ga0070714_100044465
295 Ga0070713_100018675
296 Ga0070711_100439430
297 Ga0070700_100131114
298 Ga0070694_100512083
299 Ga0070663_100006309
300 Ga0070678_100068110
301 Ga0068867_100003856
302 Ga0070685_10000165
303 Ga0070685_10000230
304 Ga0070679_100016482
305 Ga0070684_100057427
306 Ga0070684_100186434
307 Ga0070684_100380405
308 Ga0068853_100139596
309 Ga0070695_100461393
310 Ga0070665_100000846
311 Ga0070665_100620252
312 Ga0068855_100184139
313 Ga0068855_100503935
314 Ga0070664_100008800
315 Ga0068854_100000044
316 Ga0070702_100063247
317 Ga0068852_100000695
318 Ga0068852_100190294
319 Ga0068851_10000248
320 Ga0068870_10019517
321 Ga0068863_100004151
322 Ga0068860_100545906
323 Ga0081455_10010603
324 Ga0081455_10021869
325 Ga0081540_1000503
326 Ga0070715_10415583
327 Ga0070712_100000398
328 Ga0068865_100000019
329 Ga0105245_10000012
330 Ga0105245_10011485
331 Ga0105247_10000204
332 Ga0105247_10442686
333 Ga0105243_10047064
334 Ga0105241_10242702
335 Ga0105241_10485255
336 Ga0105242_10000104
337 Ga0105242_10000708
338 Ga0105242_10443968
339 Ga0105248_10000126
340 Ga0105237_10368850
341 Ga0105238_10123467
342 Ga0105239_10085827
343 Ga0105239_10726366
344 Ga0157373_10204615
345 Ga0157371_10002479
346 Ga0157370_10045099
347 Ga0157370_10119834
348 Ga0157370_10961123
349 Ga0157369_10000135
350 Ga0157378_10000598
351 Ga0157378_10013636
352 Ga0157378_10028090
353 Ga0157372_10001053
354 Ga0157375_10002149
355 Ga0157375_10302220
356 Ga0157380_10000009
357 Ga0157380_10590738
358 Ga0157379_10188101
359 Ga0157379_10207996
360 Ga0157376_10020413
361 Ga0157376_10829762
362 Ga0163161_10029702
363 Ga0206354_10072416
364 Ga0206353_10337502
365 Ga0154015_1491069
366 Ga0207656_10000466
367 Ga0207656_10001576
368 Ga0207710_10000365
369 Ga0207680_10001149
370 Ga0207680_10097250
371 Ga0207654_10423080
372 Ga0207707_10113558
373 Ga0207695_10212005
374 Ga0207693_10001041
375 Ga0207663_10013839
376 Ga0207649_10000005
377 Ga0207649_10315223
378 Ga0207652_10008865
379 Ga0207694_10309878
380 Ga0207687_10000011
381 Ga0207687_10006247
382 Ga0207700_10000016
383 Ga0207664_10002111
384 Ga0207690_10033135
385 Ga0207686_10000063
386 Ga0207686_10010056
387 Ga0207709_10010540
388 Ga0207704_10000009
389 Ga0207704_10728704
390 Ga0207711_10000024
391 Ga0207711_10539584
392 Ga0207661_10000275
393 Ga0207661_10088650
394 Ga0207679_10024880
395 Ga0207667_10148726
396 Ga0207651_10026101
397 Ga0207668_10013374
398 Ga0207640_10000125
399 Ga0207658_10077774
400 Ga0207658_10287300
401 Ga0207658_10847376
402 Ga0207677_10006986
403 Ga0207639_10087561
404 Ga0207678_10039179
405 Ga0207708_10193177
406 Ga0207702_10000099
407 Ga0207702_10043505
408 Ga0207641_10008573
409 Ga0207648_10005689
410 Ga0207683_10110027
411 Ga0207698_10000009
412 Ga0268266_10000342
413 Ga0268266_10003048
414 Ga0265319_1000091
415 Ga0265338_10000752
416 Ga0265325_10007063
417 Ga0451807_2358537
418 Ga0451833_1356887
419 Ga0466957_0004936
420 Ga0466957_0075784
421 Ga0466958_0076259
422 Ga0466967_0000005
423 Ga0466967_0449630
424 Ga0495592_0000532
425 Ga0495629_0000552
426 Ga0495629_0003869
427 Ga0495641_0005533
428 Ga0495651_0021442
429 Ga0495582_0000007
430 Ga0495662_0001430
431 Ga0495594_0000007
432 Ga0495606_0000057
433 Ga0495608_0000010
434 Ga0495628_0000704
435 Ga0495628_0030900
436 Ga0495630_0000011
437 Ga0495630_0001454
438 Ga0495652_0000003
439 Ga0495652_0051866
440 Ga0495587_0011418
441 Ga0495587_0020693
442 Ga0495587_0142219
443 Ga0495622_0000437
444 Ga0495625_0001012
445 Ga0495635_0000026
446 Ga0495657_0000005
447 Ga0495647_0000351
448 Ga0495658_0000007
449 Ga0495658_0002596
450 Ga0495613_0007052
451 Ga0495624_0003396
452 Ga0495604_0000078
453 Ga0495674_0001786
454 Ga0495676_0026802
455 Ga0495676_0185648
456 Ga0495680_0005689
457 Ga0495675_0000004
458 Ga0495673_0154478
459 Ga0495593_0101709
460 Ga0495602_0000009
461 Ga0495602_0000570
462 Ga0496100_0147593
463 Ga0496101_0273979
464 Ga0496102_0000045
465 Ga0496102_0026043
466 Ga0496102_0207562
467 Ga0496103_0000050
468 Ga0496103_0074976
469 Ga0496104_0000002
470 Ga0496104_0003112
471 Ga0496104_0017049
472 Ga0496105_0000001
473 Ga0496105_0000351
474 Ga0496105_0012422
475 Ga0496105_0716163
476 Ga0496106_0243219
477 Ga0496108_0000094
478 Ga0496108_0106825
479 Ga0496109_0000076
480 Ga0496109_0000248
481 Ga0496109_0432932
482 Ga0496110_0001428
483 Ga0496110_0093191
484 Ga0496111_0000001
485 Ga0496111_0180638
486 Ga0496112_0007872
487 Ga0496113_0000033
488 Ga0496113_0088976
489 Ga0496114_0000003
490 Ga0496115_0000071
491 Ga0496116_0000557
492 Ga0496117_0004714
493 Ga0496118_0001304
494 Ga0496119_0003008
495 Ga0496119_0012622
496 Ga0496119_0018358
497 Ga0496119_0172199
498 Ga0496120_0007264
499 Ga0496121_0010365
500 Ga0496121_0019448
501 Ga0496124_0041514
502 Ga0496125_0125674
503 Ga0496126_0023988
504 Ga0496126_0267811
505 Ga0501031_0005999
506 Ga0501032_0005430
507 Ga0501033_0002771
508 Ga0501034_0019221
509 Ga0501034_0058344
510 Ga0501034_0286238
511 Ga0501036_0007955
512 Ga0501037_0012861
513 Ga0501038_0002980
514 Ga0501040_0056085
515 Ga0501042_0081822
516 Ga0501043_0008412
517 Ga0501046_0010956
518 Ga0501047_0004982
519 Ga0501047_0010632
520 Ga0501047_0104101
521 Ga0501047_0242167
522 Ga0501048_0008910
523 Ga0501068_0016514
524 Ga0501068_0064432
525 Ga0501069_0014298
526 Ga0501070_0002754
527 Ga0501070_0125972
528 Ga0501070_0270296
529 Ga0501073_0033340
530 Ga0501074_0036411
531 Ga0501074_0162143
532 Ga0501079_0041462
533 Ga0501080_0033103
534 Ga0501083_0003488
535 Ga0501083_0008477
536 Ga0501035_0003459
537 Ga0501044_0004658
538 Ga0501044_0192687
539 Ga0501045_0055309
540 nmdc:mga0qj67_39012_c1
541 Ga0495601_0007034
542 Ga0495655_0000004
543 Ga0495655_0000572
544 Ga0495595_0000005
545 Ga0495595_0050618
546 Ga0495619_0000030
547 Ga0495619_0000040
548 Ga0495619_0034658
549 Ga0500566_0029146
550 Ga0500595_049698
551 Ga0500628_000004
552 Ga0501082_0012506

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

41

87

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.8166 20 110
3whc-assembly2.cif.gz_D crystal structure of a transcriptional regulator fadr from bacillus subtilis in complex with stearoyl-coa 0.8105 20 203
3whc-assembly2.cif.gz_D crystal structure of a transcriptional regulator fadr from bacillus subtilis in complex with stearoyl-coa 0.7911 20 203
6o6o-assembly1.cif.gz_B structure of the regulator fasr from mycobacterium tuberculosis 0.7805 21 200
7jnp-assembly1.cif.gz_B mtrr bound to the rpoh operator from neisseria gonorrhoeae 0.7771 20 190
ID Description Score Start End Superfamily
3whcC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.981 20 62 1.10.10.60
3whcD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9784 20 62 1.10.10.60
5gpaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9768 22 60 1.10.10.60
5gp9B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.974 22 60 1.10.10.60
3whbA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9736 20 62 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A537YT36-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9594 17 213 GO:0000976
GO:0003700
AF-A0A838V4D0-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9486 20 214 GO:0003677
GO:0006355
AF-A0A838V0B7-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9418 1 214 GO:0000976
GO:0003700
AF-A0A840IEB6-F1-model_v4 AcrR family transcriptional regulator 0.9377 24 213 GO:0000976
GO:0003700
AF-A0A537YT74-F1-model_v4 TetR/AcrR family transcriptional regulator 0.934 3 212 GO:0000976
GO:0003700

Map