F380914

General Info

Members Datasets Scaffolds Average Seq Length
276 133 552 190

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100001979|Ga0070660_1000019794
Length 214
Sequence VARSGASLESRGLTCFDRAMDTPATGSAAPSRGTSNLTYGILAGVAVIGVIFAFSGSAAVFNNWYSLFKAVHVLGAVIWVGGGVTIMIHAIRGQRAYKPEDIVTVAKQAAFMGEKVFAPVGLVTFLMGIAMMINTNWGWGHFWIVAGLIGYASTFIVGIAILSPMAKKIDESAEKNGPTHPETIALIERTLFIARFDVAVLLLVVLDMVTKPFA

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
43 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
74 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
75 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
76 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
77 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
80 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
90 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
91 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
114 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
128 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
133 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.57
Metatranscriptomes 5.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.8
Rhizosphere 93.12
Stem 0
Stem Tuber 0
Unclassified 14.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100001979 3300005339 Bacteria 14151
2 rootH1_10199593 3300003323 Bacteria 1725
3 Ga0058862_12668053 3300004803 Unclassified 1651
4 Ga0070658_10082775 3300005327 Bacteria 2637
5 Ga0070658_10387955 3300005327 Bacteria 1199
6 Ga0070658_10587750 3300005327 Bacteria 965
7 Ga0070683_100177719 3300005329 Bacteria 2020
8 Ga0070683_100681061 3300005329 Bacteria 985
9 Ga0070680_100120436 3300005336 Bacteria 2190
10 Ga0070682_100130743 3300005337 Bacteria 1699
11 Ga0070660_100039670 3300005339 Bacteria 3579
12 Ga0070660_100153719 3300005339 Bacteria 1851
13 Ga0070661_100041354 3300005344 Bacteria 3364
14 Ga0070661_100150917 3300005344 Bacteria 1756
15 Ga0070659_100011434 3300005366 Bacteria 6565
16 Ga0070659_100020069 3300005366 Bacteria 5074
17 Ga0070714_100022366 3300005435 Bacteria 5184
18 Ga0070714_100289733 3300005435 Bacteria 1523
19 Ga0070711_100075206 3300005439 Bacteria 2391
20 Ga0070708_100016836 3300005445 Bacteria 6077
21 Ga0070663_100378271 3300005455 Bacteria 1153
22 Ga0070663_100387235 3300005455 Bacteria 1140
23 Ga0070681_10014323 3300005458 Bacteria 7890
24 Ga0070681_10060565 3300005458 Bacteria 3761
25 Ga0070681_10121584 3300005458 Unclassified 2545
26 Ga0070681_10312964 3300005458 Bacteria 1479
27 Ga0070707_100300465 3300005468 Bacteria 1560
28 Ga0070699_100079085 3300005518 Bacteria 2864
29 Ga0070699_100723651 3300005518 Unclassified 910
30 Ga0070679_100002332 3300005530 Bacteria 17162
31 Ga0070679_100050295 3300005530 Bacteria 4152
32 Ga0070679_100118539 3300005530 Bacteria 2632
33 Ga0070684_100125428 3300005535 Unclassified 2312
34 Ga0068853_100190307 3300005539 Bacteria 1864
35 Ga0068853_100269056 3300005539 Bacteria 1569
36 Ga0068853_101313049 3300005539 Bacteria 699
37 Ga0070696_100058954 3300005546 Bacteria 2682
38 Ga0070693_100079545 3300005547 Unclassified 1951
39 Ga0070665_100017233 3300005548 Bacteria 7249
40 Ga0068855_100024519 3300005563 Bacteria 7218
41 Ga0068855_100038039 3300005563 Bacteria 5719
42 Ga0068855_100119627 3300005563 Bacteria 3015
43 Ga0068855_100199482 3300005563 Bacteria 2253
44 Ga0068855_100221577 3300005563 Unclassified 2121
45 Ga0068857_100035979 3300005577 Bacteria 4386
46 Ga0068854_100137504 3300005578 Bacteria 1872
47 Ga0068856_100191781 3300005614 Bacteria 2057
48 Ga0068856_100395559 3300005614 Bacteria 1401
49 Ga0068852_100015453 3300005616 Bacteria 5922
50 Ga0068852_100556425 3300005616 Bacteria 1148
51 Ga0070712_100038242 3300006175 Bacteria 3278
52 Ga0105245_10679023 3300009098 Bacteria 1062
53 Ga0105241_10188325 3300009174 Bacteria 1716
54 Ga0105237_10026930 3300009545 Bacteria 5873
55 Ga0105237_10093118 3300009545 Bacteria 3003
56 Ga0105238_10008129 3300009551 Bacteria 10489
57 Ga0105238_10179872 3300009551 Unclassified 2092
58 Ga0105238_10229627 3300009551 Bacteria 1833
59 Ga0105239_10063101 3300010375 Bacteria 4067
60 Ga0105239_10399815 3300010375 Bacteria 1555
61 Ga0157373_10035478 3300013100 Bacteria 3580
62 Ga0157370_10046043 3300013104 Bacteria 4183
63 Ga0157370_10113212 3300013104 Bacteria 2536
64 Ga0157370_10935770 3300013104 Bacteria 786
65 Ga0157369_10008579 3300013105 Bacteria 11720
66 Ga0157369_10018377 3300013105 Bacteria 7840
67 Ga0157369_10117019 3300013105 Bacteria 2830
68 Ga0157369_10138468 3300013105 Unclassified 2576
69 Ga0157369_10337862 3300013105 Unclassified 1565
70 Ga0157369_10518390 3300013105 Bacteria 1233
71 Ga0157374_10564334 3300013296 Bacteria 1147
72 Ga0157378_10040525 3300013297 Bacteria 4130
73 Ga0157372_10070004 3300013307 Unclassified 3946
74 Ga0157372_10263015 3300013307 Unclassified 2003
75 Ga0157372_10364046 3300013307 Bacteria 1685
76 Ga0197907_10653717 3300020069 Bacteria 2049
77 Ga0197907_11130145 3300020069 Bacteria 1965
78 Ga0197907_11136382 3300020069 Bacteria 745
79 Ga0206356_10457801 3300020070 Bacteria 1099
80 Ga0206356_11100112 3300020070 Bacteria 1069
81 Ga0206356_11759030 3300020070 Bacteria 3770
82 Ga0206355_1195404 3300020076 Bacteria 872
83 Ga0206354_10005871 3300020081 Bacteria 948
84 Ga0206354_11658504 3300020081 Bacteria 1008
85 Ga0206353_10432921 3300020082 Bacteria 1210
86 Ga0206353_10940423 3300020082 Bacteria 4443
87 Ga0206353_11808121 3300020082 Bacteria 6583
88 Ga0213876_10079065 3300021384 Bacteria 1738
89 Ga0224712_10071427 3300022467 Unclassified 1410
90 Ga0224712_10086559 3300022467 Bacteria 1304
91 Ga0207656_10131511 3300025321 Bacteria 1173
92 Ga0207705_10057409 3300025909 Bacteria 2807
93 Ga0207705_10335999 3300025909 Bacteria 1162
94 Ga0207707_10003156 3300025912 Bacteria 14629
95 Ga0207707_10017568 3300025912 Bacteria 6239
96 Ga0207707_10084768 3300025912 Bacteria 2768
97 Ga0207707_10616871 3300025912 Bacteria 917
98 Ga0207671_10051098 3300025914 Unclassified 3062
99 Ga0207693_10013318 3300025915 Bacteria 6631
100 Ga0207693_10507468 3300025915 Bacteria 941
101 Ga0207663_10014193 3300025916 Bacteria 4354
102 Ga0207663_10416424 3300025916 Bacteria 1030
103 Ga0207660_10060337 3300025917 Unclassified 2726
104 Ga0207660_10079041 3300025917 Bacteria 2412
105 Ga0207660_10259297 3300025917 Bacteria 1374
106 Ga0207657_10000536 3300025919 Bacteria 40425
107 Ga0207657_10001991 3300025919 Bacteria 22076
108 Ga0207657_10088195 3300025919 Unclassified 2594
109 Ga0207657_10751000 3300025919 Bacteria 756
110 Ga0207649_10074040 3300025920 Bacteria 2184
111 Ga0207649_10160187 3300025920 Bacteria 1559
112 Ga0207649_10402415 3300025920 Bacteria 1025
113 Ga0207652_10005032 3300025921 Bacteria 10712
114 Ga0207652_10202557 3300025921 Bacteria 1786
115 Ga0207652_10218664 3300025921 Bacteria 1716
116 Ga0207652_10529137 3300025921 Bacteria 1060
117 Ga0207694_10102838 3300025924 Unclassified 2265
118 Ga0207694_10372937 3300025924 Bacteria 1184
119 Ga0207694_10671275 3300025924 Bacteria 874
120 Ga0207687_10365349 3300025927 Bacteria 1179
121 Ga0207687_10453904 3300025927 Bacteria 1063
122 Ga0207700_10730239 3300025928 Bacteria 885
123 Ga0207664_10074268 3300025929 Bacteria 2746
124 Ga0207664_10367382 3300025929 Unclassified 1276
125 Ga0207690_10023728 3300025932 Bacteria 3832
126 Ga0207690_10116285 3300025932 Bacteria 1934
127 Ga0207661_10258131 3300025944 Bacteria 1551
128 Ga0207661_10399950 3300025944 Bacteria 1245
129 Ga0207661_10609848 3300025944 Bacteria 1002
130 Ga0207667_10068449 3300025949 Bacteria 3697
131 Ga0207667_10123765 3300025949 Unclassified 2664
132 Ga0207667_10220451 3300025949 Bacteria 1943
133 Ga0207640_10313070 3300025981 Bacteria 1247
134 Ga0207639_10623174 3300026041 Bacteria 996
135 Ga0207678_10039442 3300026067 Bacteria 4099
136 Ga0207678_10190351 3300026067 Bacteria 1753
137 Ga0207702_10150975 3300026078 Bacteria 2113
138 Ga0207702_10566276 3300026078 Bacteria 1112
139 Ga0207674_10021632 3300026116 Bacteria 6925
140 Ga0207674_11188584 3300026116 Bacteria 732
141 Ga0207698_10278208 3300026142 Bacteria 1546
142 Ga0207698_10516968 3300026142 Bacteria 1164
143 Ga0265338_10001750 3300028800 Bacteria 34304
144 Ga0265338_10015278 3300028800 Bacteria 8452
145 Ga0265338_10027548 3300028800 Bacteria 5698
146 Ga0265338_10289862 3300028800 Bacteria 1193
147 Ga0265320_10126530 3300031240 Bacteria 1162
148 Ga0265325_10270062 3300031241 Bacteria 765
149 Ga0265316_10245762 3300031344 Unclassified 1315
150 Ga0265313_10025147 3300031595 Bacteria 3163
151 Ga0373926_0027192 3300035083 Unclassified 2003
152 Ga0373936_0222956 3300035113 Bacteria 837
153 Ga0373945_0004288 3300035116 Bacteria 4527
154 Ga0373943_0015112 3300035170 Bacteria 3504
155 Ga0373946_0025519 3300035171 Bacteria 2324
156 Ga0373935_0104079 3300035692 Bacteria 1875
157 Ga0373927_0079407 3300035695 Bacteria 2126
158 Ga0373947_0006002 3300035725 Bacteria 7080
159 Ga0373925_0008836 3300037068 Bacteria 7339
160 Ga0395899_0026374 3300037312 Bacteria 4385
161 Ga0395899_0112033 3300037312 Unclassified 1961
162 Ga0395899_0285842 3300037312 Bacteria 1120
163 Ga0395900_0120558 3300037418 Bacteria 2691
164 Ga0395900_0122296 3300037418 Bacteria 2670
165 Ga0395900_0499120 3300037418 Bacteria 1167
166 Ga0395900_0789026 3300037418 Bacteria 878
167 Ga0395900_0981903 3300037418 Bacteria 765
168 Ga0395898_0010589 3300037466 Bacteria 9629
169 Ga0395898_0045481 3300037466 Bacteria 4315
170 Ga0395898_0065919 3300037466 Bacteria 3510
171 Ga0395898_0102083 3300037466 Bacteria 2753
172 Ga0395898_0169446 3300037466 Bacteria 2087
173 Ga0395905_0009451 3300037471 Bacteria 9528
174 Ga0395905_0112600 3300037471 Bacteria 2556
175 Ga0395905_0252037 3300037471 Unclassified 1649
176 Ga0395901_0000713 3300038443 Bacteria 38015
177 Ga0395901_0030383 3300038443 Bacteria 5566
178 Ga0395901_0076400 3300038443 Bacteria 3494
179 Ga0395901_0096969 3300038443 Bacteria 3090
180 Ga0395901_0234712 3300038443 Unclassified 1914
181 Ga0436360_0830746 3300039438 Bacteria 6002
182 Ga0436363_0881800 3300039450 Unclassified 965
183 Ga0439448_0059857 3300042005 Bacteria 1258
184 Ga0466965_0090368 3300044683 Bacteria 1557
185 Ga0466966_0012927 3300044684 Bacteria 5529
186 Ga0466966_0050309 3300044684 Bacteria 2651
187 Ga0466966_0135023 3300044684 Unclassified 1509
188 Ga0466961_0017369 3300044693 Bacteria 4621
189 Ga0466961_0059986 3300044693 Bacteria 2419
190 Ga0466961_0089191 3300044693 Bacteria 1947
191 Ga0466961_0125942 3300044693 Unclassified 1607
192 Ga0466961_0339052 3300044693 Bacteria 916
193 Ga0466963_0000314 3300044694 Bacteria 21829
194 Ga0466963_0008926 3300044694 Bacteria 6017
195 Ga0466963_0016545 3300044694 Bacteria 4588
196 Ga0466963_0017077 3300044694 Bacteria 4521
197 Ga0466963_0060635 3300044694 Bacteria 2527
198 Ga0466963_0066336 3300044694 Bacteria 2421
199 Ga0466963_0268646 3300044694 Unclassified 1198
200 Ga0466963_0269882 3300044694 Unclassified 1195
201 Ga0466964_0000219 3300044706 Bacteria 16370
202 Ga0466971_0000328 3300044719 Bacteria 18267
203 Ga0466971_0017567 3300044719 Bacteria 3165
204 Ga0466971_0133886 3300044719 Bacteria 1152
205 Ga0466968_0039685 3300044735 Bacteria 1982
206 Ga0466968_0050143 3300044735 Bacteria 1780
207 Ga0466957_0016205 3300044842 Bacteria 4358
208 Ga0466957_0017973 3300044842 Bacteria 4147
209 Ga0466957_0087102 3300044842 Bacteria 1952
210 Ga0466957_0098495 3300044842 Bacteria 1840
211 Ga0466957_0209725 3300044842 Unclassified 1282
212 Ga0466957_0647041 3300044842 Unclassified 743
213 Ga0466960_0323979 3300044901 Bacteria 873
214 Ga0466959_0003432 3300045049 Bacteria 10366
215 Ga0466959_0029309 3300045049 Bacteria 4078
216 Ga0466959_0067708 3300045049 Bacteria 2588
217 Ga0466958_0182846 3300045836 Unclassified 1330
218 Ga0466958_0223130 3300045836 Bacteria 1202
219 Ga0466967_0000665 3300045976 Bacteria 17349
220 Ga0466967_0001969 3300045976 Bacteria 12444
221 Ga0466967_0002135 3300045976 Bacteria 12122
222 Ga0466967_0003924 3300045976 Bacteria 9878
223 Ga0466967_0012229 3300045976 Bacteria 6553
224 Ga0466967_0016463 3300045976 Bacteria 5832
225 Ga0466967_0034282 3300045976 Bacteria 4307
226 Ga0466967_0038933 3300045976 Bacteria 4082
227 Ga0466967_0044814 3300045976 Bacteria 3839
228 Ga0466967_0060417 3300045976 Bacteria 3358
229 Ga0466967_0066659 3300045976 Bacteria 3208
230 Ga0466967_0109903 3300045976 Bacteria 2531
231 Ga0466967_0157592 3300045976 Bacteria 2128
232 Ga0466967_0204418 3300045976 Bacteria 1871
233 Ga0466967_0248562 3300045976 Bacteria 1698
234 Ga0466967_0865034 3300045976 Bacteria 898
235 Ga0466967_1480836 3300045976 Bacteria 676
236 Ga0466967_1509428 3300045976 Unclassified 669
237 Ga0466967_1966953 3300045976 Bacteria 581
238 Ga0495629_0520982 3300046459 Unclassified 800
239 Ga0495582_0267713 3300046473 Unclassified 980
240 Ga0495630_0011431 3300046517 Bacteria 6431
241 Ga0495640_0027301 3300046533 Unclassified 4118
242 Ga0495587_0106450 3300046536 Unclassified 1613
243 Ga0495587_0154607 3300046536 Bacteria 1307
244 Ga0495645_0028047 3300046543 Unclassified 4091
245 Ga0495667_0167672 3300046559 Bacteria 1411
246 Ga0495599_0103728 3300046678 Unclassified 1772
247 Ga0495604_0051401 3300047317 Unclassified 3195
248 Ga0495676_0117410 3300047321 Unclassified 1941
249 Ga0496100_0001278 3300048903 Bacteria 12286
250 Ga0496100_1072135 3300048903 Bacteria 635
251 Ga0496101_0000525 3300048904 Bacteria 23841
252 Ga0496102_0002327 3300048905 Bacteria 16215
253 Ga0496104_0001656 3300048907 Bacteria 19233
254 Ga0496107_0043172 3300048910 Bacteria 3239
255 Ga0496108_0007582 3300048911 Bacteria 8788
256 Ga0496109_0000641 3300048912 Bacteria 29071
257 Ga0496110_0010117 3300048913 Bacteria 7658
258 Ga0496111_0139049 3300048914 Bacteria 1799
259 Ga0496112_0066314 3300048915 Bacteria 3562
260 Ga0496112_0121491 3300048915 Bacteria 2582
261 Ga0496112_0422032 3300048915 Bacteria 1273
262 Ga0496114_0000135 3300048917 Bacteria 53370
263 Ga0496114_0458911 3300048917 Bacteria 1128
264 Ga0496115_0002174 3300048918 Bacteria 14030
265 Ga0501067_0004117 3300049583 Bacteria 8017
266 Ga0501067_0020664 3300049583 Bacteria 3644
267 Ga0501068_0688853 3300049584 Bacteria 668
268 Ga0501069_0010861 3300049585 Bacteria 4824
269 Ga0501070_0205985 3300049586 Bacteria 1615
270 Ga0501074_0381347 3300049590 Bacteria 1000
271 Ga0501080_0242888 3300049742 Bacteria 1643
272 Ga0501080_0367055 3300049742 Bacteria 1298
273 Ga0495601_0058968 3300053077 Unclassified 2433
274 Ga0466962_0008712 3300061719 Bacteria 4863
275 Ga0466962_0056241 3300061719 Bacteria 1879
276 Ga0466962_0062540 3300061719 Bacteria 1777
277 Ga0070660_100001979
278 rootH1_10199593
279 Ga0058862_12668053
280 Ga0070658_10082775
281 Ga0070658_10387955
282 Ga0070658_10587750
283 Ga0070683_100177719
284 Ga0070683_100681061
285 Ga0070680_100120436
286 Ga0070682_100130743
287 Ga0070660_100039670
288 Ga0070660_100153719
289 Ga0070661_100041354
290 Ga0070661_100150917
291 Ga0070659_100011434
292 Ga0070659_100020069
293 Ga0070714_100022366
294 Ga0070714_100289733
295 Ga0070711_100075206
296 Ga0070708_100016836
297 Ga0070663_100378271
298 Ga0070663_100387235
299 Ga0070681_10014323
300 Ga0070681_10060565
301 Ga0070681_10121584
302 Ga0070681_10312964
303 Ga0070707_100300465
304 Ga0070699_100079085
305 Ga0070699_100723651
306 Ga0070679_100002332
307 Ga0070679_100050295
308 Ga0070679_100118539
309 Ga0070684_100125428
310 Ga0068853_100190307
311 Ga0068853_100269056
312 Ga0068853_101313049
313 Ga0070696_100058954
314 Ga0070693_100079545
315 Ga0070665_100017233
316 Ga0068855_100024519
317 Ga0068855_100038039
318 Ga0068855_100119627
319 Ga0068855_100199482
320 Ga0068855_100221577
321 Ga0068857_100035979
322 Ga0068854_100137504
323 Ga0068856_100191781
324 Ga0068856_100395559
325 Ga0068852_100015453
326 Ga0068852_100556425
327 Ga0070712_100038242
328 Ga0105245_10679023
329 Ga0105241_10188325
330 Ga0105237_10026930
331 Ga0105237_10093118
332 Ga0105238_10008129
333 Ga0105238_10179872
334 Ga0105238_10229627
335 Ga0105239_10063101
336 Ga0105239_10399815
337 Ga0157373_10035478
338 Ga0157370_10046043
339 Ga0157370_10113212
340 Ga0157370_10935770
341 Ga0157369_10008579
342 Ga0157369_10018377
343 Ga0157369_10117019
344 Ga0157369_10138468
345 Ga0157369_10337862
346 Ga0157369_10518390
347 Ga0157374_10564334
348 Ga0157378_10040525
349 Ga0157372_10070004
350 Ga0157372_10263015
351 Ga0157372_10364046
352 Ga0197907_10653717
353 Ga0197907_11130145
354 Ga0197907_11136382
355 Ga0206356_10457801
356 Ga0206356_11100112
357 Ga0206356_11759030
358 Ga0206355_1195404
359 Ga0206354_10005871
360 Ga0206354_11658504
361 Ga0206353_10432921
362 Ga0206353_10940423
363 Ga0206353_11808121
364 Ga0213876_10079065
365 Ga0224712_10071427
366 Ga0224712_10086559
367 Ga0207656_10131511
368 Ga0207705_10057409
369 Ga0207705_10335999
370 Ga0207707_10003156
371 Ga0207707_10017568
372 Ga0207707_10084768
373 Ga0207707_10616871
374 Ga0207671_10051098
375 Ga0207693_10013318
376 Ga0207693_10507468
377 Ga0207663_10014193
378 Ga0207663_10416424
379 Ga0207660_10060337
380 Ga0207660_10079041
381 Ga0207660_10259297
382 Ga0207657_10000536
383 Ga0207657_10001991
384 Ga0207657_10088195
385 Ga0207657_10751000
386 Ga0207649_10074040
387 Ga0207649_10160187
388 Ga0207649_10402415
389 Ga0207652_10005032
390 Ga0207652_10202557
391 Ga0207652_10218664
392 Ga0207652_10529137
393 Ga0207694_10102838
394 Ga0207694_10372937
395 Ga0207694_10671275
396 Ga0207687_10365349
397 Ga0207687_10453904
398 Ga0207700_10730239
399 Ga0207664_10074268
400 Ga0207664_10367382
401 Ga0207690_10023728
402 Ga0207690_10116285
403 Ga0207661_10258131
404 Ga0207661_10399950
405 Ga0207661_10609848
406 Ga0207667_10068449
407 Ga0207667_10123765
408 Ga0207667_10220451
409 Ga0207640_10313070
410 Ga0207639_10623174
411 Ga0207678_10039442
412 Ga0207678_10190351
413 Ga0207702_10150975
414 Ga0207702_10566276
415 Ga0207674_10021632
416 Ga0207674_11188584
417 Ga0207698_10278208
418 Ga0207698_10516968
419 Ga0265338_10001750
420 Ga0265338_10015278
421 Ga0265338_10027548
422 Ga0265338_10289862
423 Ga0265320_10126530
424 Ga0265325_10270062
425 Ga0265316_10245762
426 Ga0265313_10025147
427 Ga0373926_0027192
428 Ga0373936_0222956
429 Ga0373945_0004288
430 Ga0373943_0015112
431 Ga0373946_0025519
432 Ga0373935_0104079
433 Ga0373927_0079407
434 Ga0373947_0006002
435 Ga0373925_0008836
436 Ga0395899_0026374
437 Ga0395899_0112033
438 Ga0395899_0285842
439 Ga0395900_0120558
440 Ga0395900_0122296
441 Ga0395900_0499120
442 Ga0395900_0789026
443 Ga0395900_0981903
444 Ga0395898_0010589
445 Ga0395898_0045481
446 Ga0395898_0065919
447 Ga0395898_0102083
448 Ga0395898_0169446
449 Ga0395905_0009451
450 Ga0395905_0112600
451 Ga0395905_0252037
452 Ga0395901_0000713
453 Ga0395901_0030383
454 Ga0395901_0076400
455 Ga0395901_0096969
456 Ga0395901_0234712
457 Ga0436360_0830746
458 Ga0436363_0881800
459 Ga0439448_0059857
460 Ga0466965_0090368
461 Ga0466966_0012927
462 Ga0466966_0050309
463 Ga0466966_0135023
464 Ga0466961_0017369
465 Ga0466961_0059986
466 Ga0466961_0089191
467 Ga0466961_0125942
468 Ga0466961_0339052
469 Ga0466963_0000314
470 Ga0466963_0008926
471 Ga0466963_0016545
472 Ga0466963_0017077
473 Ga0466963_0060635
474 Ga0466963_0066336
475 Ga0466963_0268646
476 Ga0466963_0269882
477 Ga0466964_0000219
478 Ga0466971_0000328
479 Ga0466971_0017567
480 Ga0466971_0133886
481 Ga0466968_0039685
482 Ga0466968_0050143
483 Ga0466957_0016205
484 Ga0466957_0017973
485 Ga0466957_0087102
486 Ga0466957_0098495
487 Ga0466957_0209725
488 Ga0466957_0647041
489 Ga0466960_0323979
490 Ga0466959_0003432
491 Ga0466959_0029309
492 Ga0466959_0067708
493 Ga0466958_0182846
494 Ga0466958_0223130
495 Ga0466967_0000665
496 Ga0466967_0001969
497 Ga0466967_0002135
498 Ga0466967_0003924
499 Ga0466967_0012229
500 Ga0466967_0016463
501 Ga0466967_0034282
502 Ga0466967_0038933
503 Ga0466967_0044814
504 Ga0466967_0060417
505 Ga0466967_0066659
506 Ga0466967_0109903
507 Ga0466967_0157592
508 Ga0466967_0204418
509 Ga0466967_0248562
510 Ga0466967_0865034
511 Ga0466967_1480836
512 Ga0466967_1509428
513 Ga0466967_1966953
514 Ga0495629_0520982
515 Ga0495582_0267713
516 Ga0495630_0011431
517 Ga0495640_0027301
518 Ga0495587_0106450
519 Ga0495587_0154607
520 Ga0495645_0028047
521 Ga0495667_0167672
522 Ga0495599_0103728
523 Ga0495604_0051401
524 Ga0495676_0117410
525 Ga0496100_0001278
526 Ga0496100_1072135
527 Ga0496101_0000525
528 Ga0496102_0002327
529 Ga0496104_0001656
530 Ga0496107_0043172
531 Ga0496108_0007582
532 Ga0496109_0000641
533 Ga0496110_0010117
534 Ga0496111_0139049
535 Ga0496112_0066314
536 Ga0496112_0121491
537 Ga0496112_0422032
538 Ga0496114_0000135
539 Ga0496114_0458911
540 Ga0496115_0002174
541 Ga0501067_0004117
542 Ga0501067_0020664
543 Ga0501068_0688853
544 Ga0501069_0010861
545 Ga0501070_0205985
546 Ga0501074_0381347
547 Ga0501080_0242888
548 Ga0501080_0367055
549 Ga0495601_0058968
550 Ga0466962_0008712
551 Ga0466962_0056241
552 Ga0466962_0062540

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10027

DUF2269

Predicted integral membrane protein (DUF2269)

66

212

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7uuw-assembly1.cif.gz_G cryogenic electron microscopy 3d map of f-actin bound by the actin binding domain of alpha-catenin ortholog, hmp1 0.6243 57 182
3jbi-assembly1.cif.gz_V mdff model of the vinculin tail domain bound to f-actin 0.6226 57 182
2crb-assembly1.cif.gz_A solution structure of mit domain from mouse nrbf-2 0.619 80 161
2ymb-assembly1.cif.gz_D structures of mitd1 0.5812 61 145
6egc-assembly1.cif.gz_A single-chain version of 2l4hc2_23 (pdb 5j0k) 0.5803 43 185
ID Description Score Start End Superfamily
af_Q5ZEN9_6_76_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.6779 80 145 1.20.58.80
af_Q4D731_6_82_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.6722 77 146 1.20.58.80
af_Q4CYK7_41_117_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.6635 77 146 1.20.58.80
af_A0A0R0H530_6_75_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.6574 64 143 1.20.58.80
4q25A01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.6553 43 162 1.20.58.220
ID Description Score Start End GO Terms
AF-A0A537ZEM2-F1-model_v4 DUF2269 family protein 0.8894 46 193 GO:0016020
AF-A0A538DN02-F1-model_v4 DUF2269 family protein 0.8724 45 195 GO:0016020
AF-A0A0Q7EEH9-F1-model_v4 DUF2269 family protein 0.8624 46 194 GO:0016020
AF-A0A428Z1N6-F1-model_v4 DUF2269 domain-containing protein 0.8599 48 193 GO:0016020
AF-A0A537ZEM2-F1-model_v4 DUF2269 family protein 0.8571 46 193 GO:0016020

Map