F380830

General Info

Members Datasets Scaffolds Average Seq Length
276 183 552 208

Family's Representative Sequence

Representative Sequence 3300002076|JGI24749J21850_1000175|JGI24749J21850_10001758
Length 224
Sequence VIVLGLTGSIGMGKSTVAAMFARAGVPVYDADAEVHRLQGRGGKLVAAIDAAFPGSAGAHGIDRAVLGKAVLGDRAALDRLERIVHPALAESRRLFLRRHRARALVVLDIPLLFEKGGWRRVDAVAVVSAPAWKQARRVLARPGMNPLKLRHIRSLQLPDHVKRARADFVIDNGGSIGRTRAAVHHLITCLRTHGVRYCRACVKSSSTPKRLDSTPPPGTGWSK

Samples

Sample ID Description Type Environment
1 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
48 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
49 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
94 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
95 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
100 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
101 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
102 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
107 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
108 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
109 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
110 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
116 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
117 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
118 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
119 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
120 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
121 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
122 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
123 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
135 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
136 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
137 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
138 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
139 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
140 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
141 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
142 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
143 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
144 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
145 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
146 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
147 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
148 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
158 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
159 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
160 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
161 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
162 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
163 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
164 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
165 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
166 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
167 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
168 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
169 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
170 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
171 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
172 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
173 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
174 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
177 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
178 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
179 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
180 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
181 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
182 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
183 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.1
Metatranscriptomes 0
Isolates 2.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.46
Nodule 0.36
Rhizoplane 1.45
Rhizosphere 70.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1000175 3300002076 Bacteria 10173
2 JGI24751J29686_10000572 3300002459 Bacteria 9962
3 JGI24751J29686_10030215 3300002459 Bacteria 1124
4 JGI25151J46595_10028538 3300003187 Bacteria 2221
5 JGI25153J46596_10000073 3300003215 Bacteria 115166
6 Ga0055536_1012882 3300003781 Bacteria 3063
7 Ga0055536_1020743 3300003781 Bacteria 2017
8 Ga0055530_10005156 3300003791 Bacteria 6368
9 Ga0055530_10012590 3300003791 Bacteria 2940
10 Ga0055530_10042852 3300003791 Bacteria 1095
11 Ga0055540_1000681 3300003792 Bacteria 23535
12 Ga0055531_10009125 3300003794 Bacteria 5112
13 Ga0055531_10009462 3300003794 Bacteria 4976
14 Ga0065704_10228453 3300005289 Bacteria 1051
15 Ga0065707_10081714 3300005295 Bacteria 75872
16 Ga0065707_10093096 3300005295 Bacteria 3676
17 Ga0065707_10117631 3300005295 Bacteria 2181
18 Ga0065707_10135257 3300005295 Bacteria 1848
19 Ga0070670_100000158 3300005331 Bacteria 62049
20 Ga0070670_100002129 3300005331 Bacteria 16246
21 Ga0070666_10024671 3300005335 Bacteria 3919
22 Ga0070666_10026936 3300005335 Bacteria 3761
23 Ga0070666_10244167 3300005335 Bacteria 1270
24 Ga0070668_100000001 3300005347 Bacteria 275905
25 Ga0070668_100034767 3300005347 Bacteria 3841
26 Ga0070669_100000031 3300005353 Bacteria 154042
27 Ga0070669_100011473 3300005353 Bacteria 6292
28 Ga0070671_100000106 3300005355 Bacteria 53385
29 Ga0070671_100614220 3300005355 Bacteria 940
30 Ga0070667_100000006 3300005367 Bacteria 336732
31 Ga0070667_100000066 3300005367 Bacteria 134529
32 Ga0070667_100003426 3300005367 Bacteria 13510
33 Ga0070679_100492677 3300005530 Bacteria 1170
34 Ga0068853_100187459 3300005539 Bacteria 1878
35 Ga0070665_100171595 3300005548 Bacteria 2170
36 Ga0068855_100000468 3300005563 Bacteria 49550
37 Ga0068857_100019222 3300005577 Bacteria 5998
38 Ga0068857_100095886 3300005577 Bacteria 2658
39 Ga0068854_100020800 3300005578 Bacteria 4446
40 Ga0068856_100039601 3300005614 Bacteria 4627
41 Ga0068859_100009268 3300005617 Bacteria 9941
42 Ga0068859_100030308 3300005617 Bacteria 5428
43 Ga0068859_100033910 3300005617 Bacteria 5125
44 Ga0068864_100000123 3300005618 Bacteria 75407
45 Ga0068864_100000306 3300005618 Bacteria 43501
46 Ga0068863_100008301 3300005841 Bacteria 10148
47 Ga0068863_100012079 3300005841 Bacteria 8343
48 Ga0068863_100078264 3300005841 Bacteria 3131
49 Ga0068863_100368772 3300005841 Bacteria 1401
50 Ga0068858_100000348 3300005842 Bacteria 48656
51 Ga0068860_100000013 3300005843 Bacteria 323055
52 Ga0068860_100000074 3300005843 Bacteria 173022
53 Ga0068860_100494712 3300005843 Bacteria 1220
54 Ga0068862_100000043 3300005844 Bacteria 164356
55 Ga0068862_100000898 3300005844 Bacteria 28838
56 Ga0075368_10001003 3300006042 Bacteria 8827
57 Ga0075363_100177119 3300006048 Bacteria 1212
58 Ga0075366_10111101 3300006195 Bacteria 1648
59 Ga0075370_10071092 3300006353 Bacteria 1991
60 Ga0075431_100075691 3300006847 Bacteria 3473
61 Ga0097620_100009268 3300006931 Bacteria 9941
62 Ga0097620_100030305 3300006931 Bacteria 5428
63 Ga0097620_100033910 3300006931 Bacteria 5125
64 Ga0079104_1075367 3300006946 Bacteria 701
65 Ga0105240_10054262 3300009093 Bacteria 5023
66 Ga0105240_10261427 3300009093 Bacteria 1996
67 Ga0105240_10516262 3300009093 Bacteria 1326
68 Ga0105241_11136617 3300009174 Bacteria 737
69 Ga0105248_10000081 3300009177 Bacteria 111105
70 Ga0105248_10002998 3300009177 Bacteria 18724
71 Ga0105238_10035160 3300009551 Bacteria 5095
72 Ga0157326_1000003 3300012513 Bacteria 18872
73 Ga0157370_10143178 3300013104 Bacteria 2227
74 Ga0163163_10407025 3300014325 Bacteria 1419
75 Ga0157380_10000040 3300014326 Bacteria 76401
76 Ga0157380_10000292 3300014326 Bacteria 30110
77 Ga0163161_10117015 3300017792 Bacteria 1999
78 Ga0213875_10000166 3300021388 Bacteria 68786
79 Ga0207425_1000005 3300025245 Bacteria 900502
80 Ga0209129_1000701 3300025258 Bacteria 21860
81 Ga0209565_1012712 3300025263 Bacteria 1998
82 Ga0209675_1000638 3300025291 Bacteria 24903
83 Ga0209676_1001537 3300025292 Bacteria 20872
84 Ga0209676_1018923 3300025292 Bacteria 2384
85 Ga0209676_1028255 3300025292 Bacteria 1750
86 Ga0209025_1001007 3300025294 Bacteria 41722
87 Ga0209758_1000002 3300025297 Bacteria 1400310
88 Ga0209050_1000001 3300025298 Bacteria 3563507
89 Ga0209050_1000113 3300025298 Bacteria 209222
90 Ga0209050_1014459 3300025298 Bacteria 3395
91 Ga0209051_1000472 3300025303 Bacteria 52350
92 Ga0209257_1000083 3300025304 Bacteria 296207
93 Ga0209257_1000330 3300025304 Bacteria 99167
94 Ga0209257_1001563 3300025304 Bacteria 26461
95 Ga0209257_1006687 3300025304 Bacteria 7302
96 Ga0209257_1006698 3300025304 Bacteria 7292
97 Ga0207680_10126412 3300025903 Bacteria 1679
98 Ga0207680_10434878 3300025903 Bacteria 930
99 Ga0207681_10000014 3300025923 Bacteria 353422
100 Ga0207681_10031885 3300025923 Bacteria 3445
101 Ga0207681_10133346 3300025923 Bacteria 1839
102 Ga0207694_10027280 3300025924 Bacteria 4348
103 Ga0207650_10000015 3300025925 Bacteria 369173
104 Ga0207650_10003426 3300025925 Bacteria 10905
105 Ga0207644_10000047 3300025931 Bacteria 103158
106 Ga0207644_10490802 3300025931 Bacteria 1012
107 Ga0207711_10004385 3300025941 Bacteria 12034
108 Ga0207711_10006037 3300025941 Bacteria 10237
109 Ga0207667_10007908 3300025949 Bacteria 12697
110 Ga0207668_10000009 3300025972 Bacteria 188071
111 Ga0207668_10024009 3300025972 Bacteria 3929
112 Ga0207640_10689872 3300025981 Bacteria 874
113 Ga0207658_10000010 3300025986 Bacteria 240224
114 Ga0207658_10000132 3300025986 Bacteria 80078
115 Ga0207658_10001234 3300025986 Bacteria 20208
116 Ga0207703_10000368 3300026035 Bacteria 48197
117 Ga0207702_10029623 3300026078 Bacteria 4556
118 Ga0207641_10000584 3300026088 Bacteria 40125
119 Ga0207641_10001281 3300026088 Bacteria 25019
120 Ga0207641_10004714 3300026088 Bacteria 11760
121 Ga0207676_10000021 3300026095 Bacteria 296572
122 Ga0207676_10001450 3300026095 Bacteria 17632
123 Ga0207674_10010801 3300026116 Bacteria 10296
124 Ga0207674_10041523 3300026116 Bacteria 4757
125 Ga0207674_10052220 3300026116 Bacteria 4169
126 Ga0207674_10166639 3300026116 Bacteria 2157
127 Ga0207675_100021606 3300026118 Bacteria 5993
128 Ga0207698_11210117 3300026142 Bacteria 769
129 Ga0209813_10000029 3300027866 Bacteria 68229
130 Ga0268266_11010151 3300028379 Bacteria 805
131 Ga0268265_10000013 3300028380 Bacteria 341536
132 Ga0268265_10002177 3300028380 Bacteria 15159
133 Ga0268264_10000039 3300028381 Bacteria 376641
134 Ga0268264_10000070 3300028381 Bacteria 268524
135 Ga0265338_10041738 3300028800 Bacteria 4287
136 Ga0307408_100006528 3300031548 Bacteria 7731
137 Ga0307405_10157606 3300031731 Bacteria 1604
138 Ga0307405_10272952 3300031731 Bacteria 1269
139 Ga0307410_10064285 3300031852 Bacteria 2521
140 Ga0307406_10088523 3300031901 Bacteria 2078
141 Ga0307406_10285798 3300031901 Bacteria 1260
142 Ga0307412_10004545 3300031911 Bacteria 7730
143 Ga0307412_10015076 3300031911 Bacteria 4572
144 Ga0307412_10016556 3300031911 Bacteria 4395
145 Ga0307412_10020466 3300031911 Bacteria 4027
146 Ga0307412_10097394 3300031911 Bacteria 2073
147 Ga0307412_10274131 3300031911 Bacteria 1321
148 Ga0307412_10708129 3300031911 Bacteria 865
149 Ga0307416_100106362 3300032002 Bacteria 2459
150 Ga0307416_100152851 3300032002 Bacteria 2120
151 Ga0307414_10000212 3300032004 Bacteria 38895
152 Ga0307414_11030273 3300032004 Bacteria 758
153 Ga0307411_11326814 3300032005 Bacteria 656
154 Ga0373927_0087532 3300035695 Bacteria 2022
155 Ga0373927_0276244 3300035695 Bacteria 1105
156 Ga0395905_0524210 3300037471 Bacteria 1085
157 Ga0436364_0545952 3300037853 Bacteria 79385
158 Ga0436364_0736268 3300037853 Bacteria 3261
159 Ga0436365_1521972 3300039437 Bacteria 2494
160 Ga0451807_0952868 3300041486 Bacteria 1028
161 Ga0466970_0140047 3300044765 Bacteria 1332
162 Ga0495638_0069970 3300046460 Bacteria 2149
163 Ga0495584_0264677 3300046491 Bacteria 874
164 Ga0495583_0000279 3300046506 Bacteria 82827
165 Ga0495606_0000406 3300046507 Bacteria 72668
166 Ga0495606_0143904 3300046507 Bacteria 1406
167 Ga0495610_0079212 3300046512 Bacteria 1513
168 Ga0495643_0011737 3300046522 Bacteria 5316
169 Ga0495643_0040067 3300046522 Bacteria 2559
170 Ga0495643_0171817 3300046522 Bacteria 1059
171 Ga0495648_0041650 3300046524 Bacteria 2898
172 Ga0495648_0124757 3300046524 Bacteria 1378
173 Ga0495654_0010230 3300046530 Bacteria 5109
174 Ga0495654_0223101 3300046530 Bacteria 796
175 Ga0495609_0077701 3300046538 Bacteria 1453
176 Ga0495597_0048924 3300046542 Bacteria 1869
177 Ga0495668_0000234 3300046616 Bacteria 79147
178 Ga0495668_0002012 3300046616 Bacteria 17752
179 Ga0495668_0008222 3300046616 Bacteria 6545
180 Ga0495611_0046050 3300046648 Bacteria 1955
181 Ga0495625_0000195 3300046660 Bacteria 96493
182 Ga0495625_0151547 3300046660 Bacteria 1558
183 Ga0495661_0028793 3300046665 Bacteria 3551
184 Ga0495669_0215592 3300046684 Bacteria 919
185 Ga0495670_0034858 3300046691 Bacteria 2507
186 Ga0495670_0280641 3300046691 Bacteria 891
187 Ga0495671_0006295 3300046692 Bacteria 6871
188 Ga0495660_0332795 3300046810 Bacteria 679
189 Ga0495686_0001947 3300047472 Bacteria 20548
190 Ga0496102_0062996 3300048905 Bacteria 3395
191 Ga0496108_0014447 3300048911 Bacteria 6448
192 Ga0496109_0545374 3300048912 Bacteria 1094
193 Ga0496117_0038144 3300048920 Bacteria 3569
194 Ga0496118_0034563 3300048921 Bacteria 4121
195 Ga0496125_0035714 3300048928 Bacteria 4354
196 Ga0495682_0002704 3300049460 Bacteria 8233
197 Ga0501290_000432 3300049513 Bacteria 6576
198 Ga0501292_000013 3300049515 Bacteria 65866
199 Ga0501294_000215 3300049517 Bacteria 7124
200 Ga0501300_003476 3300049523 Bacteria 2354
201 Ga0501031_0394101 3300049568 Bacteria 896
202 Ga0501032_0033728 3300049569 Bacteria 3506
203 Ga0501032_0064366 3300049569 Bacteria 2454
204 Ga0501033_0082055 3300049570 Bacteria 2364
205 Ga0501033_0101295 3300049570 Bacteria 2101
206 Ga0501034_0028784 3300049571 Bacteria 5652
207 Ga0501034_0069510 3300049571 Bacteria 3532
208 Ga0501036_0046291 3300049572 Bacteria 3683
209 Ga0501036_0258734 3300049572 Bacteria 1458
210 Ga0501037_0021339 3300049573 Bacteria 4784
211 Ga0501038_0210741 3300049574 Bacteria 1554
212 Ga0501043_0080443 3300049579 Bacteria 2560
213 Ga0501047_0001071 3300049581 Bacteria 27278
214 Ga0501047_0238586 3300049581 Bacteria 1669
215 Ga0501048_0218734 3300049582 Bacteria 1351
216 Ga0501073_0353401 3300049589 Bacteria 1015
217 Ga0501222_000462 3300049662 Bacteria 6083
218 Ga0501223_001010 3300049663 Bacteria 6648
219 Ga0501224_000280 3300049664 Bacteria 5910
220 Ga0501235_040477 3300049669 Bacteria 1065
221 Ga0501243_053222 3300049675 Bacteria 735
222 Ga0501249_001898 3300049679 Bacteria 4246
223 Ga0501257_000010 3300049686 Bacteria 53242
224 Ga0501257_052871 3300049686 Bacteria 1015
225 Ga0501259_000447 3300049688 Bacteria 6547
226 Ga0501261_000126 3300049690 Bacteria 11424
227 Ga0501225_0034389 3300049705 Bacteria 1395
228 Ga0501279_000004 3300049775 Bacteria 175612
229 Ga0501280_000314 3300049776 Bacteria 12170
230 Ga0501280_000948 3300049776 Bacteria 6063
231 Ga0501281_00073 3300049777 Bacteria 11764
232 Ga0501282_000150 3300049778 Bacteria 8371
233 Ga0501283_032444 3300049779 Bacteria 880
234 Ga0501035_0019392 3300049822 Bacteria 6254
235 Ga0501035_0028457 3300049822 Bacteria 5099
236 Ga0501044_0144609 3300049823 Bacteria 2364
237 Ga0501044_0202341 3300049823 Bacteria 1943
238 nmdc:mga03n38_109448_c1 3300050490 Bacteria 1343
239 nmdc:mga0k408_99042_c1 3300050493 Bacteria 1718
240 nmdc:mga06z11_18_c1 3300050494 Bacteria 78477
241 nmdc:mga04h51_133_c1 3300050495 Bacteria 21746
242 nmdc:mga07m45_27880_c1 3300050496 Bacteria 1506
243 nmdc:mga06r32_24417_c1 3300050510 Bacteria 5611
244 Ga0500643_000403 3300053087 Bacteria 33015
245 Ga0500643_002054 3300053087 Bacteria 10775
246 Ga0500643_019122 3300053087 Bacteria 2261
247 Ga0500647_0008473 3300053091 Bacteria 4464
248 Ga0500555_000414 3300053103 Bacteria 17859
249 Ga0500569_084663 3300053109 Bacteria 1019
250 Ga0500592_000772 3300053116 Bacteria 5263
251 Ga0500594_0001241 3300053118 Bacteria 5515
252 Ga0500614_010560 3300053123 Bacteria 1985
253 Ga0500642_0028578 3300053130 Bacteria 2301
254 Ga0500655_000383 3300053133 Bacteria 9498
255 Ga0500658_0000032 3300053134 Bacteria 90863
256 Ga0500559_0012288 3300053136 Bacteria 3643
257 Ga0500559_0147321 3300053136 Bacteria 1104
258 Ga0500568_0001218 3300053139 Bacteria 17161
259 Ga0500577_0040517 3300053142 Bacteria 1694
260 Ga0500590_001839 3300053148 Bacteria 9001
261 Ga0500604_0021847 3300053151 Bacteria 1812
262 Ga0500622_0004156 3300053156 Bacteria 9264
263 Ga0500627_0000070 3300053158 Bacteria 41863
264 Ga0500627_0000152 3300053158 Bacteria 20430
265 Ga0500627_0034394 3300053158 Bacteria 2148
266 Ga0500627_0076433 3300053158 Bacteria 1489
267 Ga0500570_001639 3300053724 Bacteria 10510
268 Ga0501084_0838730 3300054114 Bacteria 774
269 2585261819 2582581305 Bacteria 4895574
270 2643726801 2643221541 Bacteria 5498788
271 2643819217 2643221560 Bacteria 4801179
272 2643835080 2643221563 Bacteria 4726935
273 2644040307 2643221605 Bacteria 4772303
274 2644046158 2643221606 Bacteria 5588032
275 2644056007 2643221608 Bacteria 4724829
276 2644393031 2643221671 Bacteria 5496681
277 JGI24749J21850_1000175
278 JGI24751J29686_10000572
279 JGI24751J29686_10030215
280 JGI25151J46595_10028538
281 JGI25153J46596_10000073
282 Ga0055536_1012882
283 Ga0055536_1020743
284 Ga0055530_10005156
285 Ga0055530_10012590
286 Ga0055530_10042852
287 Ga0055540_1000681
288 Ga0055531_10009125
289 Ga0055531_10009462
290 Ga0065704_10228453
291 Ga0065707_10081714
292 Ga0065707_10093096
293 Ga0065707_10117631
294 Ga0065707_10135257
295 Ga0070670_100000158
296 Ga0070670_100002129
297 Ga0070666_10024671
298 Ga0070666_10026936
299 Ga0070666_10244167
300 Ga0070668_100000001
301 Ga0070668_100034767
302 Ga0070669_100000031
303 Ga0070669_100011473
304 Ga0070671_100000106
305 Ga0070671_100614220
306 Ga0070667_100000006
307 Ga0070667_100000066
308 Ga0070667_100003426
309 Ga0070679_100492677
310 Ga0068853_100187459
311 Ga0070665_100171595
312 Ga0068855_100000468
313 Ga0068857_100019222
314 Ga0068857_100095886
315 Ga0068854_100020800
316 Ga0068856_100039601
317 Ga0068859_100009268
318 Ga0068859_100030308
319 Ga0068859_100033910
320 Ga0068864_100000123
321 Ga0068864_100000306
322 Ga0068863_100008301
323 Ga0068863_100012079
324 Ga0068863_100078264
325 Ga0068863_100368772
326 Ga0068858_100000348
327 Ga0068860_100000013
328 Ga0068860_100000074
329 Ga0068860_100494712
330 Ga0068862_100000043
331 Ga0068862_100000898
332 Ga0075368_10001003
333 Ga0075363_100177119
334 Ga0075366_10111101
335 Ga0075370_10071092
336 Ga0075431_100075691
337 Ga0097620_100009268
338 Ga0097620_100030305
339 Ga0097620_100033910
340 Ga0079104_1075367
341 Ga0105240_10054262
342 Ga0105240_10261427
343 Ga0105240_10516262
344 Ga0105241_11136617
345 Ga0105248_10000081
346 Ga0105248_10002998
347 Ga0105238_10035160
348 Ga0157326_1000003
349 Ga0157370_10143178
350 Ga0163163_10407025
351 Ga0157380_10000040
352 Ga0157380_10000292
353 Ga0163161_10117015
354 Ga0213875_10000166
355 Ga0207425_1000005
356 Ga0209129_1000701
357 Ga0209565_1012712
358 Ga0209675_1000638
359 Ga0209676_1001537
360 Ga0209676_1018923
361 Ga0209676_1028255
362 Ga0209025_1001007
363 Ga0209758_1000002
364 Ga0209050_1000001
365 Ga0209050_1000113
366 Ga0209050_1014459
367 Ga0209051_1000472
368 Ga0209257_1000083
369 Ga0209257_1000330
370 Ga0209257_1001563
371 Ga0209257_1006687
372 Ga0209257_1006698
373 Ga0207680_10126412
374 Ga0207680_10434878
375 Ga0207681_10000014
376 Ga0207681_10031885
377 Ga0207681_10133346
378 Ga0207694_10027280
379 Ga0207650_10000015
380 Ga0207650_10003426
381 Ga0207644_10000047
382 Ga0207644_10490802
383 Ga0207711_10004385
384 Ga0207711_10006037
385 Ga0207667_10007908
386 Ga0207668_10000009
387 Ga0207668_10024009
388 Ga0207640_10689872
389 Ga0207658_10000010
390 Ga0207658_10000132
391 Ga0207658_10001234
392 Ga0207703_10000368
393 Ga0207702_10029623
394 Ga0207641_10000584
395 Ga0207641_10001281
396 Ga0207641_10004714
397 Ga0207676_10000021
398 Ga0207676_10001450
399 Ga0207674_10010801
400 Ga0207674_10041523
401 Ga0207674_10052220
402 Ga0207674_10166639
403 Ga0207675_100021606
404 Ga0207698_11210117
405 Ga0209813_10000029
406 Ga0268266_11010151
407 Ga0268265_10000013
408 Ga0268265_10002177
409 Ga0268264_10000039
410 Ga0268264_10000070
411 Ga0265338_10041738
412 Ga0307408_100006528
413 Ga0307405_10157606
414 Ga0307405_10272952
415 Ga0307410_10064285
416 Ga0307406_10088523
417 Ga0307406_10285798
418 Ga0307412_10004545
419 Ga0307412_10015076
420 Ga0307412_10016556
421 Ga0307412_10020466
422 Ga0307412_10097394
423 Ga0307412_10274131
424 Ga0307412_10708129
425 Ga0307416_100106362
426 Ga0307416_100152851
427 Ga0307414_10000212
428 Ga0307414_11030273
429 Ga0307411_11326814
430 Ga0373927_0087532
431 Ga0373927_0276244
432 Ga0395905_0524210
433 Ga0436364_0545952
434 Ga0436364_0736268
435 Ga0436365_1521972
436 Ga0451807_0952868
437 Ga0466970_0140047
438 Ga0495638_0069970
439 Ga0495584_0264677
440 Ga0495583_0000279
441 Ga0495606_0000406
442 Ga0495606_0143904
443 Ga0495610_0079212
444 Ga0495643_0011737
445 Ga0495643_0040067
446 Ga0495643_0171817
447 Ga0495648_0041650
448 Ga0495648_0124757
449 Ga0495654_0010230
450 Ga0495654_0223101
451 Ga0495609_0077701
452 Ga0495597_0048924
453 Ga0495668_0000234
454 Ga0495668_0002012
455 Ga0495668_0008222
456 Ga0495611_0046050
457 Ga0495625_0000195
458 Ga0495625_0151547
459 Ga0495661_0028793
460 Ga0495669_0215592
461 Ga0495670_0034858
462 Ga0495670_0280641
463 Ga0495671_0006295
464 Ga0495660_0332795
465 Ga0495686_0001947
466 Ga0496102_0062996
467 Ga0496108_0014447
468 Ga0496109_0545374
469 Ga0496117_0038144
470 Ga0496118_0034563
471 Ga0496125_0035714
472 Ga0495682_0002704
473 Ga0501290_000432
474 Ga0501292_000013
475 Ga0501294_000215
476 Ga0501300_003476
477 Ga0501031_0394101
478 Ga0501032_0033728
479 Ga0501032_0064366
480 Ga0501033_0082055
481 Ga0501033_0101295
482 Ga0501034_0028784
483 Ga0501034_0069510
484 Ga0501036_0046291
485 Ga0501036_0258734
486 Ga0501037_0021339
487 Ga0501038_0210741
488 Ga0501043_0080443
489 Ga0501047_0001071
490 Ga0501047_0238586
491 Ga0501048_0218734
492 Ga0501073_0353401
493 Ga0501222_000462
494 Ga0501223_001010
495 Ga0501224_000280
496 Ga0501235_040477
497 Ga0501243_053222
498 Ga0501249_001898
499 Ga0501257_000010
500 Ga0501257_052871
501 Ga0501259_000447
502 Ga0501261_000126
503 Ga0501225_0034389
504 Ga0501279_000004
505 Ga0501280_000314
506 Ga0501280_000948
507 Ga0501281_00073
508 Ga0501282_000150
509 Ga0501283_032444
510 Ga0501035_0019392
511 Ga0501035_0028457
512 Ga0501044_0144609
513 Ga0501044_0202341
514 nmdc:mga03n38_109448_c1
515 nmdc:mga0k408_99042_c1
516 nmdc:mga06z11_18_c1
517 nmdc:mga04h51_133_c1
518 nmdc:mga07m45_27880_c1
519 nmdc:mga06r32_24417_c1
520 Ga0500643_000403
521 Ga0500643_002054
522 Ga0500643_019122
523 Ga0500647_0008473
524 Ga0500555_000414
525 Ga0500569_084663
526 Ga0500592_000772
527 Ga0500594_0001241
528 Ga0500614_010560
529 Ga0500642_0028578
530 Ga0500655_000383
531 Ga0500658_0000032
532 Ga0500559_0012288
533 Ga0500559_0147321
534 Ga0500568_0001218
535 Ga0500577_0040517
536 Ga0500590_001839
537 Ga0500604_0021847
538 Ga0500622_0004156
539 Ga0500627_0000070
540 Ga0500627_0000152
541 Ga0500627_0034394
542 Ga0500627_0076433
543 Ga0500570_001639
544 Ga0501084_0838730
545 2585261819
546 2643726801
547 2643819217
548 2643835080
549 2644040307
550 2644046158
551 2644056007
552 2644393031

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01121

CoaE

Dephospho-CoA kinase

2

178

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2if2-assembly3.cif.gz_C crystal structure of the putative dephospho-coa kinase from aquifex aeolicus, northeast structural genomics target qr72. 0.8786 1 192
2if2-assembly2.cif.gz_B crystal structure of the putative dephospho-coa kinase from aquifex aeolicus, northeast structural genomics target qr72. 0.8718 1 192
2if2-assembly3.cif.gz_C crystal structure of the putative dephospho-coa kinase from aquifex aeolicus, northeast structural genomics target qr72. 0.8687 1 192
6n39-assembly1.cif.gz_A crystal structure of an dephospho-coa kinase coae from mycobacterium paratuberculosis 0.8606 2 193
2if2-assembly2.cif.gz_B crystal structure of the putative dephospho-coa kinase from aquifex aeolicus, northeast structural genomics target qr72. 0.8596 1 192
ID Description Score Start End Superfamily
af_Q5AK15_1_205_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9275 1 189 3.40.50.300
af_O74414_1_201_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9208 1 189 3.40.50.300
af_P34558_5_214_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9106 2 198 3.40.50.300
af_P9WPA3_1_200_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9054 1 199 3.40.50.300
af_A0A1D6FIF3_118_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9042 75 189 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0Q8Q5E2-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9912 1 201 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A4Q3A1U0-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) 0.9894 1 179 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A1X9YGW4-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9881 1 190 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A2W6TGY6-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.982 2 192 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A0Q8Q5E2-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9815 1 201 GO:0004140
GO:0005524
GO:0005737
GO:0015937

Map