F380750

General Info

Members Datasets Scaffolds Average Seq Length
275 165 550 210

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_905311_c1|nmdc:mga06r32_905311_c1_107_805
Length 232
Sequence MSVRPGEPLAEEEDNVKHVMWGVAAAIVMAGALGVHAREEAQANPQMSFFITSVGSGNGANLGGLAGADAHCQNLAKAVGAGNKQWRAYLSTQGASAANAKDRIGPGPWVNSKGVQIAANVAELHSDKNNLTKETQLTEKGTVVNGRGDSPNQHDILTGSNLDGTGFPAGEDHTCNNWTSQDTGSAQVGHHDRQGGGANPTSWNNAHASKGCSQQNLIATGGNGYFYCFAAK

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
93 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
94 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
95 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
96 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
97 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
98 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
99 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
102 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
105 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
118 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
123 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
126 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
136 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
137 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
138 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
141 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
142 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
145 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
146 2643221557 Ensifer sp. Root558 Isolate Unclassified
147 2643221610 Ensifer sp. Root74 Isolate Unclassified
148 2643221668 Ensifer sp. Root423 Isolate Unclassified
149 2643221675 Ensifer sp. Root1298 Isolate Unclassified
150 2643221680 Ensifer sp. Root1312 Isolate Unclassified
151 2643221723 Ensifer sp. Root278 Isolate Unclassified
152 2643221726 Ensifer sp. Root954 Isolate Unclassified
153 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
154 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
155 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
156 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
157 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
158 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
159 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
160 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
161 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
162 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
163 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
164 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
165 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.36
Metatranscriptomes 0
Isolates 7.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.82
Nodule 1.09
Rhizoplane 1.09
Rhizosphere 77.45
Stem 0
Stem Tuber 0
Unclassified 9.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_905311_c1 3300050510 Bacteria 838
2 JGI25159J45721_1000011 3300002987 Bacteria 158027
3 JGI25159J45721_1001497 3300002987 Bacteria 9581
4 JGI25151J46595_10101064 3300003187 Bacteria 777
5 JGI25160J50197_1000007 3300003354 Bacteria 316012
6 JGI25160J50197_1000030 3300003354 Bacteria 177919
7 JGI25161J50226_1000016 3300003374 Bacteria 177919
8 Ga0055524_1001133 3300003775 Bacteria 16031
9 Ga0055536_1004845 3300003781 Bacteria 6726
10 Ga0055530_10016023 3300003791 Bacteria 2416
11 Ga0055540_1015869 3300003792 Bacteria 2170
12 Ga0055543_1000006 3300004625 Bacteria 214206
13 Ga0055543_1000225 3300004625 Bacteria 45170
14 Ga0065165_1000011 3300005262 Bacteria 316465
15 Ga0065165_1000215 3300005262 Bacteria 100238
16 Ga0065712_10082541 3300005290 Unclassified 2907
17 Ga0065715_10211091 3300005293 Bacteria 1314
18 Ga0070676_10063527 3300005328 Bacteria 2200
19 Ga0070670_100144276 3300005331 Bacteria 2059
20 Ga0068869_101016616 3300005334 Bacteria 722
21 Ga0070680_100947037 3300005336 Bacteria 743
22 Ga0070689_100161580 3300005340 Bacteria 1811
23 Ga0070668_100286593 3300005347 Bacteria 1377
24 Ga0070675_100006058 3300005354 Bacteria 9264
25 Ga0070675_100239905 3300005354 Bacteria 1584
26 Ga0070675_100368876 3300005354 Bacteria 1276
27 Ga0070688_100025301 3300005365 Unclassified 3514
28 Ga0070659_100292810 3300005366 Unclassified 1356
29 Ga0070701_10195325 3300005438 Unclassified 1193
30 Ga0070708_100163024 3300005445 Bacteria 2078
31 Ga0070678_100009968 3300005456 Bacteria 5781
32 Ga0070681_10065350 3300005458 Bacteria 3606
33 Ga0070698_100000353 3300005471 Bacteria 47490
34 Ga0070698_100067088 3300005471 Bacteria 3609
35 Ga0070698_100647396 3300005471 Unclassified 998
36 Ga0070699_100077013 3300005518 Bacteria 2903
37 Ga0070695_100314873 3300005545 Unclassified 1161
38 Ga0070696_100460090 3300005546 Bacteria 1005
39 Ga0070664_100069673 3300005564 Bacteria 3010
40 Ga0070664_100685464 3300005564 Bacteria 954
41 Ga0068856_101364659 3300005614 Unclassified 724
42 Ga0068859_100293286 3300005617 Bacteria 1719
43 Ga0068864_100035635 3300005618 Bacteria 4237
44 Ga0068864_100573960 3300005618 Bacteria 1092
45 Ga0068870_10028409 3300005840 Bacteria 2809
46 Ga0068870_10092118 3300005840 Bacteria 1697
47 Ga0075368_10010718 3300006042 Bacteria 3319
48 Ga0075368_10152213 3300006042 Bacteria 967
49 Ga0075367_10007085 3300006178 Bacteria 5716
50 Ga0075367_10080041 3300006178 Bacteria 1976
51 Ga0075428_100513164 3300006844 Bacteria 1282
52 Ga0075428_100707931 3300006844 Bacteria 1073
53 Ga0075428_101195434 3300006844 Bacteria 801
54 Ga0075430_100000821 3300006846 Bacteria 24241
55 Ga0075430_100061060 3300006846 Bacteria 3168
56 Ga0075430_100177031 3300006846 Bacteria 1774
57 Ga0075430_100184457 3300006846 Unclassified 1735
58 Ga0075430_100444625 3300006846 Bacteria 1070
59 Ga0075430_100563408 3300006846 Bacteria 940
60 Ga0075431_100159636 3300006847 Bacteria 2319
61 Ga0075431_100190604 3300006847 Unclassified 2101
62 Ga0075431_100246011 3300006847 Bacteria 1818
63 Ga0075431_100525115 3300006847 Bacteria 1173
64 Ga0075431_101121253 3300006847 Bacteria 751
65 Ga0075431_101163756 3300006847 Bacteria 735
66 Ga0075433_10002174 3300006852 Bacteria 14857
67 Ga0075433_10581976 3300006852 Unclassified 983
68 Ga0075434_100781700 3300006871 Unclassified 971
69 Ga0075429_100023697 3300006880 Bacteria 5326
70 Ga0075429_100067543 3300006880 Bacteria 3111
71 Ga0075429_100273031 3300006880 Bacteria 1481
72 Ga0075429_100882638 3300006880 Bacteria 783
73 Ga0097620_100293267 3300006931 Bacteria 1719
74 Ga0111539_10004351 3300009094 Bacteria 18549
75 Ga0111539_10565954 3300009094 Bacteria 1324
76 Ga0105245_10076010 3300009098 Bacteria 3058
77 Ga0114129_10273702 3300009147 Bacteria 2258
78 Ga0114129_12020895 3300009147 Unclassified 697
79 Ga0105248_10880671 3300009177 Bacteria 1011
80 Ga0105246_10145238 3300011119 Bacteria 1789
81 Ga0157378_11206039 3300013297 Bacteria 796
82 Ga0157375_10883778 3300013308 Unclassified 1038
83 Ga0163163_10004260 3300014325 Bacteria 12190
84 Ga0163163_10661614 3300014325 Bacteria 1108
85 Ga0157380_10672369 3300014326 Bacteria 1036
86 Ga0209436_100912 3300025208 Bacteria 11698
87 Ga0209436_122877 3300025208 Unclassified 796
88 Ga0209565_1033347 3300025263 Bacteria 992
89 Ga0209673_1041586 3300025273 Bacteria 1303
90 Ga0209130_1000033 3300025284 Bacteria 316064
91 Ga0209130_1000053 3300025284 Bacteria 214421
92 Ga0209676_1006417 3300025292 Bacteria 5814
93 Ga0209025_1000032 3300025294 Bacteria 416141
94 Ga0209564_1000079 3300025295 Bacteria 266525
95 Ga0209050_1001567 3300025298 Bacteria 23791
96 Ga0209256_1000042 3300025299 Bacteria 341821
97 Ga0207426_1000054 3300025302 Bacteria 384435
98 Ga0207426_1000078 3300025302 Bacteria 316064
99 Ga0209051_1004678 3300025303 Bacteria 8329
100 Ga0209257_1005476 3300025304 Bacteria 8896
101 Ga0207697_10144094 3300025315 Bacteria 1034
102 Ga0207643_10042778 3300025908 Bacteria 2554
103 Ga0207643_10056014 3300025908 Bacteria 2242
104 Ga0207707_10158411 3300025912 Bacteria 1980
105 Ga0207693_10377119 3300025915 Bacteria 1109
106 Ga0207660_10260662 3300025917 Bacteria 1371
107 Ga0207660_10418517 3300025917 Bacteria 1080
108 Ga0207660_10774382 3300025917 Bacteria 783
109 Ga0207649_10352413 3300025920 Bacteria 1090
110 Ga0207650_10025724 3300025925 Bacteria 4194
111 Ga0207659_10003725 3300025926 Bacteria 9192
112 Ga0207659_10089650 3300025926 Bacteria 2294
113 Ga0207659_10410622 3300025926 Bacteria 1134
114 Ga0207670_10147307 3300025936 Bacteria 1743
115 Ga0207711_10783168 3300025941 Unclassified 888
116 Ga0207679_10033281 3300025945 Bacteria 3626
117 Ga0207679_10618612 3300025945 Bacteria 977
118 Ga0207676_10015945 3300026095 Bacteria 5436
119 Ga0207676_10480739 3300026095 Bacteria 1176
120 Ga0207675_100247604 3300026118 Bacteria 1724
121 Ga0207428_10002839 3300027907 Bacteria 17188
122 Ga0207428_10191272 3300027907 Bacteria 1542
123 Ga0268265_10445198 3300028380 Bacteria 1208
124 Ga0307408_100384276 3300031548 Bacteria 1201
125 Ga0307408_101072821 3300031548 Bacteria 746
126 Ga0307405_10158204 3300031731 Bacteria 1601
127 Ga0307405_10428638 3300031731 Bacteria 1043
128 Ga0307410_10088070 3300031852 Bacteria 2198
129 Ga0307406_10193597 3300031901 Bacteria 1491
130 Ga0307406_10244376 3300031901 Unclassified 1348
131 Ga0307406_10628235 3300031901 Bacteria 889
132 Ga0307409_100063677 3300031995 Bacteria 2893
133 Ga0307409_100073153 3300031995 Bacteria 2733
134 Ga0307409_100862318 3300031995 Bacteria 917
135 Ga0307416_100118591 3300032002 Bacteria 2352
136 Ga0307416_100660347 3300032002 Bacteria 1131
137 Ga0307416_100733516 3300032002 Bacteria 1079
138 Ga0307411_10057717 3300032005 Bacteria 2566
139 Ga0307411_10295170 3300032005 Unclassified 1297
140 Ga0307415_100043751 3300032126 Bacteria 2990
141 Ga0307415_100642758 3300032126 Unclassified 950
142 Ga0373934_0044551 3300035086 Bacteria 1754
143 Ga0373937_0018529 3300036401 Bacteria 6219
144 Ga0373925_0297720 3300037068 Bacteria 1302
145 Ga0242420_065002 3300038996 Bacteria 733
146 Ga0439431_0028013 3300041997 Unclassified 1386
147 Ga0439433_0054692 3300041999 Bacteria 945
148 Ga0439462_0008945 3300042015 Unclassified 2533
149 Ga0439462_0116326 3300042015 Bacteria 742
150 Ga0439446_0004817 3300042156 Bacteria 3441
151 Ga0439434_0075597 3300042435 Bacteria 1064
152 Ga0439435_0008500 3300042436 Bacteria 2381
153 Ga0439435_0110379 3300042436 Bacteria 853
154 Ga0439460_0017099 3300042461 Bacteria 1940
155 Ga0451576_0051696 3300045051 Bacteria 4308
156 Ga0451576_0307328 3300045051 Bacteria 1659
157 Ga0495638_0111540 3300046460 Bacteria 1624
158 Ga0495580_0027017 3300046472 Bacteria 4180
159 Ga0496113_0269990 3300048916 Bacteria 1359
160 Ga0496119_0031939 3300048922 Bacteria 3518
161 Ga0496120_0133312 3300048923 Bacteria 1270
162 Ga0496121_0170444 3300048924 Bacteria 1582
163 Ga0501031_0206277 3300049568 Bacteria 1282
164 Ga0501031_0227949 3300049568 Unclassified 1213
165 Ga0501036_0257026 3300049572 Bacteria 1463
166 Ga0501036_0300392 3300049572 Bacteria 1343
167 Ga0501036_0450569 3300049572 Bacteria 1072
168 Ga0501038_0131268 3300049574 Bacteria 2057
169 Ga0501039_0078660 3300049575 Bacteria 2565
170 Ga0501040_0102420 3300049576 Bacteria 1998
171 Ga0501040_0138231 3300049576 Bacteria 1715
172 Ga0501040_0149502 3300049576 Bacteria 1647
173 Ga0501040_0430578 3300049576 Unclassified 949
174 Ga0501041_0080490 3300049577 Bacteria 2006
175 Ga0501041_0093946 3300049577 Bacteria 1852
176 Ga0501041_0151280 3300049577 Bacteria 1449
177 Ga0501041_0192171 3300049577 Bacteria 1279
178 Ga0501042_0004911 3300049578 Bacteria 8561
179 Ga0501042_0042464 3300049578 Bacteria 3237
180 Ga0501042_0068910 3300049578 Bacteria 2530
181 Ga0501046_0177406 3300049580 Bacteria 1595
182 Ga0501048_0017602 3300049582 Bacteria 5262
183 Ga0501048_0047652 3300049582 Bacteria 3058
184 Ga0501048_0166434 3300049582 Bacteria 1561
185 Ga0501048_0275767 3300049582 Bacteria 1195
186 Ga0501048_0925347 3300049582 Bacteria 627
187 Ga0501068_0311278 3300049584 Bacteria 1009
188 Ga0501071_0029171 3300049587 Bacteria 3892
189 Ga0501071_0049412 3300049587 Bacteria 3028
190 Ga0501071_0179184 3300049587 Bacteria 1588
191 Ga0501071_1021034 3300049587 Bacteria 639
192 Ga0501072_0036910 3300049588 Bacteria 3833
193 Ga0501072_0047690 3300049588 Bacteria 3373
194 Ga0501072_0272310 3300049588 Bacteria 1347
195 Ga0501072_0472981 3300049588 Bacteria 992
196 Ga0501074_0653242 3300049590 Bacteria 743
197 Ga0501075_0021596 3300049591 Bacteria 4694
198 Ga0501075_0035663 3300049591 Bacteria 3710
199 Ga0501075_0757056 3300049591 Bacteria 739
200 Ga0501076_0013170 3300049592 Bacteria 6195
201 Ga0501076_0037613 3300049592 Bacteria 3796
202 Ga0501076_0079470 3300049592 Bacteria 2632
203 Ga0501076_0234875 3300049592 Bacteria 1499
204 Ga0501076_0293064 3300049592 Bacteria 1333
205 Ga0501076_0443933 3300049592 Unclassified 1068
206 Ga0501076_0906559 3300049592 Bacteria 727
207 Ga0501077_0072823 3300049593 Bacteria 2177
208 Ga0501077_0221813 3300049593 Bacteria 1202
209 Ga0501077_0225793 3300049593 Bacteria 1190
210 Ga0501079_0116189 3300049741 Bacteria 2080
211 Ga0501080_0761139 3300049742 Bacteria 851
212 Ga0501080_0867246 3300049742 Bacteria 788
213 Ga0501081_0046964 3300049743 Bacteria 2970
214 Ga0501081_0130767 3300049743 Bacteria 1793
215 Ga0501081_0243625 3300049743 Bacteria 1311
216 Ga0501081_0681404 3300049743 Bacteria 771
217 Ga0501268_039510 3300049765 Bacteria 883
218 Ga0501035_0444603 3300049822 Bacteria 1073
219 Ga0501045_0026049 3300049824 Bacteria 4204
220 Ga0501045_0178667 3300049824 Bacteria 1581
221 Ga0501045_0245620 3300049824 Bacteria 1332
222 Ga0501045_0330474 3300049824 Bacteria 1134
223 nmdc:mga05p37_207908_c1 3300050507 Bacteria 2367
224 nmdc:mga09592_30116_c1 3300050508 Bacteria 4516
225 nmdc:mga0qj67_328177_c1 3300050509 Bacteria 1238
226 nmdc:mga0qj67_54366_c1 3300050509 Bacteria 3170
227 nmdc:mga0qj67_7_c1 3300050509 Bacteria 146944
228 nmdc:mga0qj67_99114_c1 3300050509 Unclassified 2347
229 nmdc:mga06r32_129869_c1 3300050510 Bacteria 2491
230 nmdc:mga06r32_133370_c1 3300050510 Bacteria 2457
231 nmdc:mga06r32_212537_c1 3300050510 Unclassified 1922
232 nmdc:mga06r32_439061_c1 3300050510 Bacteria 1285
233 nmdc:mga08y16_2664_c1 3300050511 Bacteria 18362
234 nmdc:mga0n895_419474_c1 3300050512 Bacteria 1353
235 nmdc:mga0a205_146487_c1 3300050515 Bacteria 1904
236 nmdc:mga0a205_32701_c1 3300050515 Bacteria 4986
237 Ga0500641_0002662 3300053096 Bacteria 6311
238 Ga0500592_002496 3300053116 Bacteria 2955
239 Ga0500568_0000212 3300053139 Bacteria 50122
240 Ga0500568_0035455 3300053139 Bacteria 2035
241 Ga0500611_039751 3300053727 Bacteria 1026
242 Ga0501084_0181044 3300054114 Bacteria 1779
243 Ga0501084_0233343 3300054114 Bacteria 1553
244 Ga0501084_0329265 3300054114 Bacteria 1290
245 Ga0501084_0347144 3300054114 Bacteria 1254
246 Ga0501084_0590478 3300054114 Bacteria 938
247 Ga0590071_010781 3300059421 Bacteria 2139
248 Ga0590075_028925 3300059424 Bacteria 1400
249 Ga0590077_003697 3300059426 Bacteria 3160
250 Ga0501082_0062332 3300060353 Bacteria 3210
251 Ga0501082_0119070 3300060353 Bacteria 2288
252 Ga0530510_0094846 3300061734 Bacteria 2179
253 Ga0530510_0189601 3300061734 Bacteria 1526
254 Ga0530510_0806391 3300061734 Bacteria 716
255 2600192704 2599185352 Bacteria 7228948
256 2643803337 2643221557 Bacteria 7184309
257 2644063703 2643221610 Bacteria 7480339
258 2644374981 2643221668 Bacteria 7306521
259 2644414466 2643221675 Bacteria 7473456
260 2644447994 2643221680 Bacteria 7473610
261 2644677556 2643221723 Bacteria 7095460
262 2644690467 2643221726 Bacteria 7455827
263 2692318832 2690316117 Bacteria 6800650
264 2753461798 2751185821 Bacteria 6189929
265 2770197745 2767802442 Bacteria 5747986
266 2792619728 2791355091 Bacteria 6135441
267 2792627503 2791355092 Bacteria 6248105
268 2847422663 2847417321 Bacteria 6913799
269 2848997943 2848992105 Bacteria 6810864
270 2855873867 2855872281 Bacteria 6964271
271 2896384967 2896384573 Bacteria 7700774
272 2920826977 2920822456 Bacteria 6897201
273 2923561061 2923556063 Bacteria 6793593
274 3005412684 3005409236 Bacteria 7188837
275 8005546184 8005542996 Bacteria 7077758
276 nmdc:mga06r32_905311_c1
277 JGI25159J45721_1000011
278 JGI25159J45721_1001497
279 JGI25151J46595_10101064
280 JGI25160J50197_1000007
281 JGI25160J50197_1000030
282 JGI25161J50226_1000016
283 Ga0055524_1001133
284 Ga0055536_1004845
285 Ga0055530_10016023
286 Ga0055540_1015869
287 Ga0055543_1000006
288 Ga0055543_1000225
289 Ga0065165_1000011
290 Ga0065165_1000215
291 Ga0065712_10082541
292 Ga0065715_10211091
293 Ga0070676_10063527
294 Ga0070670_100144276
295 Ga0068869_101016616
296 Ga0070680_100947037
297 Ga0070689_100161580
298 Ga0070668_100286593
299 Ga0070675_100006058
300 Ga0070675_100239905
301 Ga0070675_100368876
302 Ga0070688_100025301
303 Ga0070659_100292810
304 Ga0070701_10195325
305 Ga0070708_100163024
306 Ga0070678_100009968
307 Ga0070681_10065350
308 Ga0070698_100000353
309 Ga0070698_100067088
310 Ga0070698_100647396
311 Ga0070699_100077013
312 Ga0070695_100314873
313 Ga0070696_100460090
314 Ga0070664_100069673
315 Ga0070664_100685464
316 Ga0068856_101364659
317 Ga0068859_100293286
318 Ga0068864_100035635
319 Ga0068864_100573960
320 Ga0068870_10028409
321 Ga0068870_10092118
322 Ga0075368_10010718
323 Ga0075368_10152213
324 Ga0075367_10007085
325 Ga0075367_10080041
326 Ga0075428_100513164
327 Ga0075428_100707931
328 Ga0075428_101195434
329 Ga0075430_100000821
330 Ga0075430_100061060
331 Ga0075430_100177031
332 Ga0075430_100184457
333 Ga0075430_100444625
334 Ga0075430_100563408
335 Ga0075431_100159636
336 Ga0075431_100190604
337 Ga0075431_100246011
338 Ga0075431_100525115
339 Ga0075431_101121253
340 Ga0075431_101163756
341 Ga0075433_10002174
342 Ga0075433_10581976
343 Ga0075434_100781700
344 Ga0075429_100023697
345 Ga0075429_100067543
346 Ga0075429_100273031
347 Ga0075429_100882638
348 Ga0097620_100293267
349 Ga0111539_10004351
350 Ga0111539_10565954
351 Ga0105245_10076010
352 Ga0114129_10273702
353 Ga0114129_12020895
354 Ga0105248_10880671
355 Ga0105246_10145238
356 Ga0157378_11206039
357 Ga0157375_10883778
358 Ga0163163_10004260
359 Ga0163163_10661614
360 Ga0157380_10672369
361 Ga0209436_100912
362 Ga0209436_122877
363 Ga0209565_1033347
364 Ga0209673_1041586
365 Ga0209130_1000033
366 Ga0209130_1000053
367 Ga0209676_1006417
368 Ga0209025_1000032
369 Ga0209564_1000079
370 Ga0209050_1001567
371 Ga0209256_1000042
372 Ga0207426_1000054
373 Ga0207426_1000078
374 Ga0209051_1004678
375 Ga0209257_1005476
376 Ga0207697_10144094
377 Ga0207643_10042778
378 Ga0207643_10056014
379 Ga0207707_10158411
380 Ga0207693_10377119
381 Ga0207660_10260662
382 Ga0207660_10418517
383 Ga0207660_10774382
384 Ga0207649_10352413
385 Ga0207650_10025724
386 Ga0207659_10003725
387 Ga0207659_10089650
388 Ga0207659_10410622
389 Ga0207670_10147307
390 Ga0207711_10783168
391 Ga0207679_10033281
392 Ga0207679_10618612
393 Ga0207676_10015945
394 Ga0207676_10480739
395 Ga0207675_100247604
396 Ga0207428_10002839
397 Ga0207428_10191272
398 Ga0268265_10445198
399 Ga0307408_100384276
400 Ga0307408_101072821
401 Ga0307405_10158204
402 Ga0307405_10428638
403 Ga0307410_10088070
404 Ga0307406_10193597
405 Ga0307406_10244376
406 Ga0307406_10628235
407 Ga0307409_100063677
408 Ga0307409_100073153
409 Ga0307409_100862318
410 Ga0307416_100118591
411 Ga0307416_100660347
412 Ga0307416_100733516
413 Ga0307411_10057717
414 Ga0307411_10295170
415 Ga0307415_100043751
416 Ga0307415_100642758
417 Ga0373934_0044551
418 Ga0373937_0018529
419 Ga0373925_0297720
420 Ga0242420_065002
421 Ga0439431_0028013
422 Ga0439433_0054692
423 Ga0439462_0008945
424 Ga0439462_0116326
425 Ga0439446_0004817
426 Ga0439434_0075597
427 Ga0439435_0008500
428 Ga0439435_0110379
429 Ga0439460_0017099
430 Ga0451576_0051696
431 Ga0451576_0307328
432 Ga0495638_0111540
433 Ga0495580_0027017
434 Ga0496113_0269990
435 Ga0496119_0031939
436 Ga0496120_0133312
437 Ga0496121_0170444
438 Ga0501031_0206277
439 Ga0501031_0227949
440 Ga0501036_0257026
441 Ga0501036_0300392
442 Ga0501036_0450569
443 Ga0501038_0131268
444 Ga0501039_0078660
445 Ga0501040_0102420
446 Ga0501040_0138231
447 Ga0501040_0149502
448 Ga0501040_0430578
449 Ga0501041_0080490
450 Ga0501041_0093946
451 Ga0501041_0151280
452 Ga0501041_0192171
453 Ga0501042_0004911
454 Ga0501042_0042464
455 Ga0501042_0068910
456 Ga0501046_0177406
457 Ga0501048_0017602
458 Ga0501048_0047652
459 Ga0501048_0166434
460 Ga0501048_0275767
461 Ga0501048_0925347
462 Ga0501068_0311278
463 Ga0501071_0029171
464 Ga0501071_0049412
465 Ga0501071_0179184
466 Ga0501071_1021034
467 Ga0501072_0036910
468 Ga0501072_0047690
469 Ga0501072_0272310
470 Ga0501072_0472981
471 Ga0501074_0653242
472 Ga0501075_0021596
473 Ga0501075_0035663
474 Ga0501075_0757056
475 Ga0501076_0013170
476 Ga0501076_0037613
477 Ga0501076_0079470
478 Ga0501076_0234875
479 Ga0501076_0293064
480 Ga0501076_0443933
481 Ga0501076_0906559
482 Ga0501077_0072823
483 Ga0501077_0221813
484 Ga0501077_0225793
485 Ga0501079_0116189
486 Ga0501080_0761139
487 Ga0501080_0867246
488 Ga0501081_0046964
489 Ga0501081_0130767
490 Ga0501081_0243625
491 Ga0501081_0681404
492 Ga0501268_039510
493 Ga0501035_0444603
494 Ga0501045_0026049
495 Ga0501045_0178667
496 Ga0501045_0245620
497 Ga0501045_0330474
498 nmdc:mga05p37_207908_c1
499 nmdc:mga09592_30116_c1
500 nmdc:mga0qj67_328177_c1
501 nmdc:mga0qj67_54366_c1
502 nmdc:mga0qj67_7_c1
503 nmdc:mga0qj67_99114_c1
504 nmdc:mga06r32_129869_c1
505 nmdc:mga06r32_133370_c1
506 nmdc:mga06r32_212537_c1
507 nmdc:mga06r32_439061_c1
508 nmdc:mga08y16_2664_c1
509 nmdc:mga0n895_419474_c1
510 nmdc:mga0a205_146487_c1
511 nmdc:mga0a205_32701_c1
512 Ga0500641_0002662
513 Ga0500592_002496
514 Ga0500568_0000212
515 Ga0500568_0035455
516 Ga0500611_039751
517 Ga0501084_0181044
518 Ga0501084_0233343
519 Ga0501084_0329265
520 Ga0501084_0347144
521 Ga0501084_0590478
522 Ga0590071_010781
523 Ga0590075_028925
524 Ga0590077_003697
525 Ga0501082_0062332
526 Ga0501082_0119070
527 Ga0530510_0094846
528 Ga0530510_0189601
529 Ga0530510_0806391
530 2600192704
531 2643803337
532 2644063703
533 2644374981
534 2644414466
535 2644447994
536 2644677556
537 2644690467
538 2692318832
539 2753461798
540 2770197745
541 2792619728
542 2792627503
543 2847422663
544 2848997943
545 2855873867
546 2896384967
547 2920826977
548 2923561061
549 3005412684
550 8005546184

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dy2-assembly1.cif.gz_A murine collagen alpha1(xv), endostatin domain 0.7492 25 206
1dy2-assembly1.cif.gz_A murine collagen alpha1(xv), endostatin domain 0.7333 25 206
1bnl-assembly1.cif.gz_A zinc dependent dimers observed in crystals of human endostatin 0.7162 22 206
1koe-assembly1.cif.gz_A endostatin 0.7104 25 206
1dy0-assembly1.cif.gz_A murine endostatin, crystal form ii 0.7091 21 206
ID Description Score Start End Superfamily
af_M9ND55_829_1006_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.7826 26 206 3.10.100.10
af_G5EGA4_982_1161_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.7434 19 206 3.10.100.10
af_M9ND55_829_1006_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.7346 26 206 3.10.100.10
af_P39059_1210_1388_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.7329 20 207 3.10.100.10
af_G5EGA4_982_1161_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.7101 19 206 3.10.100.10
ID Description Score Start End GO Terms
AF-A0A1L3LXF0-F1-model_v4 Lectin 0.9988 25 207
AF-A0A8B5TPQ6-F1-model_v4 Lectin 0.9969 18 207
AF-A0A1L3LXF0-F1-model_v4 Lectin 0.9933 25 207
AF-A0A528EI03-F1-model_v4 Lectin 0.9925 21 207
AF-A0A434LIL6-F1-model_v4 Lectin 0.9916 85 207

Map