F380743

General Info

Members Datasets Scaffolds Average Seq Length
275 165 550 157

Family's Representative Sequence

Representative Sequence 3300050496|nmdc:mga07m45_556737_c1|nmdc:mga07m45_556737_c1_70_630
Length 186
Sequence MSLSMVLRFLSPTPTPRLGLLRQNVTVSGMTDRLEPGDTAPDFTLPTDDGGSVSLKDLRGRKVIVYFYPNAMTPGCTTQACDFTDSLSALEGAGYTVVGISPNDPAKLAKFRERDGLTITLASDADRAVMTAYGAYGEKKLYGKTVEGVIRSTFVVAEDGRIELAQYNVKATGHVAKLRRDLGLAS

Samples

Sample ID Description Type Environment
1 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
106 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
107 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
108 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
109 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
110 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
124 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
125 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
164 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
165 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 0.36
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.45
Nodule 0
Rhizoplane 14.18
Rhizosphere 82.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga07m45_556737_c1 3300050496 Bacteria 663
2 LJQas_1000652 3300000549 Bacteria 5593
3 JGI24739J22299_10240837 3300001989 Bacteria 530
4 JGI24737J22298_10092252 3300001990 Bacteria 898
5 JGI24735J21928_10028090 3300002067 Bacteria 1681
6 Ga0070658_10060927 3300005327 Bacteria 3074
7 Ga0070658_10154621 3300005327 Bacteria 1922
8 Ga0070658_10455981 3300005327 Bacteria 1102
9 Ga0070658_10925929 3300005327 Bacteria 758
10 Ga0070676_10173144 3300005328 Bacteria 1398
11 Ga0070683_100002484 3300005329 Bacteria 14674
12 Ga0070683_100017850 3300005329 Bacteria 6272
13 Ga0070683_100147221 3300005329 Bacteria 2232
14 Ga0070683_100283172 3300005329 Bacteria 1577
15 Ga0070690_100110870 3300005330 Bacteria 1831
16 Ga0070670_100391353 3300005331 Bacteria 1226
17 Ga0070682_100032459 3300005337 Bacteria 3166
18 Ga0070660_100014043 3300005339 Bacteria 5765
19 Ga0070660_100123153 3300005339 Bacteria 2070
20 Ga0070661_100090100 3300005344 Bacteria 2271
21 Ga0070661_100530604 3300005344 Bacteria 945
22 Ga0070659_100183900 3300005366 Bacteria 1716
23 Ga0070659_100526419 3300005366 Bacteria 1010
24 Ga0070714_100136966 3300005435 Bacteria 2194
25 Ga0070694_100181522 3300005444 Bacteria 1557
26 Ga0070663_100487288 3300005455 Bacteria 1022
27 Ga0070662_100092775 3300005457 Bacteria 2270
28 Ga0070662_100458476 3300005457 Bacteria 1059
29 Ga0070681_11757323 3300005458 Bacteria 547
30 Ga0070685_10247569 3300005466 Bacteria 1179
31 Ga0070699_100453937 3300005518 Bacteria 1162
32 Ga0070684_100002110 3300005535 Bacteria 14647
33 Ga0070684_100438485 3300005535 Bacteria 1206
34 Ga0070684_100811146 3300005535 Bacteria 875
35 Ga0068853_100279050 3300005539 Bacteria 1540
36 Ga0070665_100000957 3300005548 Bacteria 36788
37 Ga0070665_100069023 3300005548 Bacteria 3543
38 Ga0070665_100920477 3300005548 Bacteria 887
39 Ga0068855_100044304 3300005563 Bacteria 5266
40 Ga0070664_100078897 3300005564 Bacteria 2833
41 Ga0068857_100007737 3300005577 Bacteria 9257
42 Ga0068856_100007197 3300005614 Bacteria 10853
43 Ga0068856_100183545 3300005614 Bacteria 2106
44 Ga0068864_100200782 3300005618 Bacteria 1831
45 Ga0068864_100432270 3300005618 Bacteria 1256
46 Ga0068864_101781000 3300005618 Bacteria 621
47 Ga0068861_100150346 3300005719 Bacteria 1910
48 Ga0068858_100021952 3300005842 Bacteria 5962
49 Ga0068860_100255292 3300005843 Bacteria 1708
50 Ga0068862_101276184 3300005844 Bacteria 735
51 Ga0075363_100046636 3300006048 Bacteria 2300
52 Ga0075364_10110234 3300006051 Bacteria 1836
53 Ga0075370_10568431 3300006353 Bacteria 686
54 Ga0068865_100216565 3300006881 Bacteria 1495
55 Ga0068865_100923389 3300006881 Bacteria 760
56 Ga0111539_11298464 3300009094 Bacteria 845
57 Ga0105245_10001389 3300009098 Bacteria 21921
58 Ga0105245_10064429 3300009098 Bacteria 3312
59 Ga0105245_10291714 3300009098 Bacteria 1598
60 Ga0105245_10695018 3300009098 Bacteria 1050
61 Ga0105247_10014218 3300009101 Bacteria 4776
62 Ga0105243_10066113 3300009148 Bacteria 2907
63 Ga0105243_10142877 3300009148 Bacteria 2044
64 Ga0105243_10398495 3300009148 Bacteria 1278
65 Ga0105243_10682258 3300009148 Bacteria 999
66 Ga0105241_10886094 3300009174 Bacteria 828
67 Ga0105242_10022620 3300009176 Bacteria 4947
68 Ga0105242_11242779 3300009176 Bacteria 766
69 Ga0105242_11585516 3300009176 Bacteria 688
70 Ga0105248_10226769 3300009177 Bacteria 2103
71 Ga0105237_10051599 3300009545 Bacteria 4131
72 Ga0105237_10090703 3300009545 Bacteria 3045
73 Ga0105238_11045340 3300009551 Bacteria 838
74 Ga0105249_10048920 3300009553 Bacteria 3855
75 Ga0105249_10094928 3300009553 Bacteria 2796
76 Ga0105239_10003486 3300010375 Bacteria 19258
77 Ga0105239_10007963 3300010375 Bacteria 12104
78 Ga0105239_10172806 3300010375 Bacteria 2416
79 Ga0105246_10030718 3300011119 Bacteria 3550
80 Ga0105246_12273546 3300011119 Bacteria 529
81 Ga0157371_10183289 3300013102 Bacteria 1498
82 Ga0157371_10709259 3300013102 Bacteria 753
83 Ga0157370_10726405 3300013104 Bacteria 906
84 Ga0157369_10010908 3300013105 Bacteria 10347
85 Ga0157369_10259115 3300013105 Bacteria 1814
86 Ga0157374_11675613 3300013296 Bacteria 660
87 Ga0163162_10002716 3300013306 Bacteria 16784
88 Ga0163162_11512564 3300013306 Bacteria 765
89 Ga0157372_10022009 3300013307 Bacteria 6892
90 Ga0157372_10136598 3300013307 Bacteria 2824
91 Ga0157372_10234840 3300013307 Bacteria 2127
92 Ga0157372_10687883 3300013307 Bacteria 1190
93 Ga0157372_12128437 3300013307 Bacteria 645
94 Ga0157375_10167585 3300013308 Bacteria 2342
95 Ga0157375_10653402 3300013308 Bacteria 1208
96 Ga0163163_10083001 3300014325 Bacteria 3209
97 Ga0163163_10184023 3300014325 Bacteria 2137
98 Ga0182008_10032092 3300014497 Bacteria 2640
99 Ga0157379_10062751 3300014968 Bacteria 3322
100 Ga0157379_11491416 3300014968 Bacteria 658
101 Ga0157376_10676710 3300014969 Bacteria 1035
102 Ga0157376_11066195 3300014969 Bacteria 833
103 Ga0206353_10900330 3300020082 Bacteria 1168
104 Ga0207642_10238169 3300025899 Bacteria 1026
105 Ga0207688_10050208 3300025901 Bacteria 2334
106 Ga0207688_10053554 3300025901 Bacteria 2263
107 Ga0207647_10021628 3300025904 Bacteria 4292
108 Ga0207647_10071860 3300025904 Bacteria 2087
109 Ga0207705_10010070 3300025909 Bacteria 6881
110 Ga0207705_10502240 3300025909 Bacteria 942
111 Ga0207705_10544117 3300025909 Bacteria 902
112 Ga0207671_10070573 3300025914 Bacteria 2605
113 Ga0207657_10023569 3300025919 Bacteria 5728
114 Ga0207657_10025056 3300025919 Bacteria 5510
115 Ga0207652_10109684 3300025921 Bacteria 2447
116 Ga0207652_10694558 3300025921 Bacteria 908
117 Ga0207687_10137445 3300025927 Bacteria 1850
118 Ga0207687_10244571 3300025927 Bacteria 1423
119 Ga0207687_10562992 3300025927 Bacteria 957
120 Ga0207664_10013827 3300025929 Bacteria 5810
121 Ga0207690_10374671 3300025932 Bacteria 1130
122 Ga0207690_11044425 3300025932 Bacteria 680
123 Ga0207706_10046339 3300025933 Bacteria 3849
124 Ga0207706_10781750 3300025933 Bacteria 812
125 Ga0207686_10649330 3300025934 Bacteria 835
126 Ga0207709_10025790 3300025935 Bacteria 3368
127 Ga0207709_10346284 3300025935 Bacteria 1120
128 Ga0207709_10461494 3300025935 Bacteria 984
129 Ga0207704_10113765 3300025938 Bacteria 1835
130 Ga0207704_10323482 3300025938 Bacteria 1191
131 Ga0207704_10465226 3300025938 Bacteria 1012
132 Ga0207691_10117466 3300025940 Bacteria 2360
133 Ga0207711_10232101 3300025941 Bacteria 1690
134 Ga0207661_10011604 3300025944 Bacteria 6392
135 Ga0207661_10290460 3300025944 Bacteria 1463
136 Ga0207679_10050079 3300025945 Bacteria 3050
137 Ga0207667_10125941 3300025949 Bacteria 2639
138 Ga0207712_10461352 3300025961 Bacteria 1079
139 Ga0207712_10926418 3300025961 Bacteria 771
140 Ga0207668_11108390 3300025972 Bacteria 710
141 Ga0207658_10251112 3300025986 Bacteria 1503
142 Ga0207703_10028389 3300026035 Bacteria 4411
143 Ga0207639_10184012 3300026041 Bacteria 1779
144 Ga0207639_10875583 3300026041 Bacteria 839
145 Ga0207678_10027347 3300026067 Bacteria 4975
146 Ga0207678_10536381 3300026067 Bacteria 1022
147 Ga0207702_10096363 3300026078 Bacteria 2602
148 Ga0207702_10813087 3300026078 Bacteria 924
149 Ga0207675_100166364 3300026118 Bacteria 2106
150 Ga0207675_100181485 3300026118 Bacteria 2015
151 Ga0207675_101006173 3300026118 Bacteria 852
152 Ga0207698_11016390 3300026142 Bacteria 840
153 Ga0268266_10009722 3300028379 Bacteria 8454
154 Ga0268266_10236878 3300028379 Bacteria 1683
155 Ga0268266_10517427 3300028379 Bacteria 1141
156 Ga0268265_11194113 3300028380 Bacteria 758
157 Ga0268264_10034080 3300028381 Bacteria 4187
158 Ga0307408_100842948 3300031548 Bacteria 835
159 Ga0307405_11120124 3300031731 Bacteria 677
160 Ga0307413_10076371 3300031824 Bacteria 2129
161 Ga0307410_10065964 3300031852 Bacteria 2492
162 Ga0307407_10036602 3300031903 Bacteria 2706
163 Ga0307407_10608449 3300031903 Bacteria 814
164 Ga0307407_11422961 3300031903 Bacteria 547
165 Ga0307412_10346935 3300031911 Bacteria 1190
166 Ga0307412_10618944 3300031911 Bacteria 919
167 Ga0307409_100011357 3300031995 Bacteria 5608
168 Ga0307409_100134624 3300031995 Bacteria 2118
169 Ga0307409_101012236 3300031995 Bacteria 849
170 Ga0307409_101897812 3300031995 Bacteria 625
171 Ga0307416_100002929 3300032002 Bacteria 9946
172 Ga0307416_100139609 3300032002 Bacteria 2200
173 Ga0307416_102078559 3300032002 Bacteria 670
174 Ga0307414_10440917 3300032004 Bacteria 1140
175 Ga0307411_10187793 3300032005 Bacteria 1575
176 Ga0307415_100006264 3300032126 Bacteria 6393
177 Ga0395901_0695860 3300038443 Bacteria 1015
178 Ga0395901_1029393 3300038443 Bacteria 798
179 Ga0451849_0169198 3300041505 Bacteria 552
180 Ga0451843_0596534 3300041509 Bacteria 614
181 Ga0439445_0221903 3300042004 Bacteria 561
182 Ga0439458_0188418 3300042157 Bacteria 562
183 Ga0439464_0114790 3300042439 Bacteria 826
184 Ga0466969_0095293 3300044656 Bacteria 1406
185 Ga0466966_0002194 3300044684 Bacteria 12680
186 Ga0466961_0057670 3300044693 Bacteria 2472
187 Ga0466963_0163320 3300044694 Bacteria 1551
188 Ga0466963_0204286 3300044694 Bacteria 1382
189 Ga0466963_0226161 3300044694 Bacteria 1311
190 Ga0466964_0024392 3300044706 Bacteria 2357
191 Ga0466968_0050234 3300044735 Bacteria 1779
192 Ga0466968_0084111 3300044735 Bacteria 1402
193 Ga0466970_0125373 3300044765 Bacteria 1408
194 Ga0466957_0042866 3300044842 Bacteria 2739
195 Ga0466960_0040312 3300044901 Bacteria 2208
196 Ga0466958_0679220 3300045836 Bacteria 671
197 Ga0466967_0003367 3300045976 Bacteria 10403
198 Ga0466967_0025128 3300045976 Bacteria 4908
199 Ga0466967_0055280 3300045976 Bacteria 3496
200 Ga0466967_0487019 3300045976 Bacteria 1209
201 Ga0495603_0305872 3300046455 Bacteria 913
202 Ga0495629_0475820 3300046459 Bacteria 844
203 Ga0495641_0055424 3300046461 Bacteria 1800
204 Ga0495593_0123851 3300047673 Bacteria 1314
205 Ga0495614_0109042 3300048089 Bacteria 1215
206 Ga0496100_0030492 3300048903 Bacteria 3346
207 Ga0496100_0631562 3300048903 Bacteria 833
208 Ga0496101_0144387 3300048904 Bacteria 1816
209 Ga0496101_0531210 3300048904 Bacteria 930
210 Ga0496101_1425363 3300048904 Bacteria 540
211 Ga0496102_0213649 3300048905 Bacteria 1818
212 Ga0496102_0313075 3300048905 Bacteria 1479
213 Ga0496102_0972394 3300048905 Bacteria 770
214 Ga0496103_0031620 3300048906 Bacteria 3226
215 Ga0496104_0055033 3300048907 Bacteria 3761
216 Ga0496105_0058739 3300048908 Bacteria 3174
217 Ga0496105_0398141 3300048908 Bacteria 1093
218 Ga0496106_0133664 3300048909 Bacteria 1947
219 Ga0496106_0875783 3300048909 Bacteria 710
220 Ga0496107_0129378 3300048910 Bacteria 1863
221 Ga0496107_0312980 3300048910 Bacteria 1169
222 Ga0496107_0340304 3300048910 Bacteria 1116
223 Ga0496107_0381322 3300048910 Bacteria 1049
224 Ga0496108_0008499 3300048911 Bacteria 8329
225 Ga0496108_0026740 3300048911 Bacteria 4763
226 Ga0496108_0237893 3300048911 Bacteria 1584
227 Ga0496108_0326905 3300048911 Bacteria 1337
228 Ga0496109_0069529 3300048912 Bacteria 3229
229 Ga0496109_0093942 3300048912 Bacteria 2776
230 Ga0496109_0274532 3300048912 Bacteria 1588
231 Ga0496109_1170281 3300048912 Bacteria 706
232 Ga0496110_1038078 3300048913 Bacteria 727
233 Ga0496111_0002381 3300048914 Bacteria 11328
234 Ga0496111_0242930 3300048914 Bacteria 1337
235 Ga0496112_0260899 3300048915 Bacteria 1682
236 Ga0496113_0717459 3300048916 Bacteria 797
237 Ga0496113_0856175 3300048916 Bacteria 720
238 Ga0496113_0954742 3300048916 Bacteria 677
239 Ga0496114_0003522 3300048917 Bacteria 12014
240 Ga0496114_0008014 3300048917 Bacteria 8359
241 Ga0496114_1513891 3300048917 Bacteria 559
242 Ga0496115_0025512 3300048918 Bacteria 4602
243 Ga0496115_0155034 3300048918 Bacteria 1892
244 Ga0496115_0345995 3300048918 Bacteria 1213
245 Ga0496121_0000025 3300048924 Bacteria 453467
246 Ga0501032_0090268 3300049569 Bacteria 2033
247 Ga0501033_0402895 3300049570 Bacteria 954
248 Ga0501034_0059180 3300049571 Bacteria 3849
249 Ga0501034_0670026 3300049571 Bacteria 938
250 Ga0501036_0007731 3300049572 Bacteria 8784
251 Ga0501036_0399763 3300049572 Bacteria 1146
252 Ga0501037_0015018 3300049573 Bacteria 5695
253 Ga0501039_0081308 3300049575 Bacteria 2522
254 Ga0501039_0419022 3300049575 Bacteria 1052
255 Ga0501041_1009265 3300049577 Bacteria 535
256 Ga0501042_0047619 3300049578 Bacteria 3057
257 Ga0501043_0050580 3300049579 Bacteria 3266
258 Ga0501046_0104833 3300049580 Bacteria 2166
259 Ga0501047_0185501 3300049581 Bacteria 1945
260 Ga0501048_0014002 3300049582 Bacteria 5946
261 Ga0501069_0014171 3300049585 Bacteria 4258
262 Ga0501070_0004792 3300049586 Bacteria 11571
263 Ga0501070_0026744 3300049586 Bacteria 4839
264 Ga0501070_0385283 3300049586 Bacteria 1135
265 Ga0501072_0285707 3300049588 Bacteria 1312
266 Ga0501073_0032451 3300049589 Bacteria 3723
267 Ga0501074_0032554 3300049590 Bacteria 3777
268 Ga0501074_0084620 3300049590 Bacteria 2273
269 Ga0501225_0209061 3300049705 Bacteria 623
270 Ga0501035_0018674 3300049822 Bacteria 6386
271 Ga0501035_0209178 3300049822 Bacteria 1670
272 Ga0495619_0094036 3300053085 Bacteria 2033
273 Ga0530510_0037055 3300061734 Bacteria 3515
274 2861521220 2861520306 Bacteria 8348283
275 8045832720 8045830549 Bacteria 4444727
276 nmdc:mga07m45_556737_c1
277 LJQas_1000652
278 JGI24739J22299_10240837
279 JGI24737J22298_10092252
280 JGI24735J21928_10028090
281 Ga0070658_10060927
282 Ga0070658_10154621
283 Ga0070658_10455981
284 Ga0070658_10925929
285 Ga0070676_10173144
286 Ga0070683_100002484
287 Ga0070683_100017850
288 Ga0070683_100147221
289 Ga0070683_100283172
290 Ga0070690_100110870
291 Ga0070670_100391353
292 Ga0070682_100032459
293 Ga0070660_100014043
294 Ga0070660_100123153
295 Ga0070661_100090100
296 Ga0070661_100530604
297 Ga0070659_100183900
298 Ga0070659_100526419
299 Ga0070714_100136966
300 Ga0070694_100181522
301 Ga0070663_100487288
302 Ga0070662_100092775
303 Ga0070662_100458476
304 Ga0070681_11757323
305 Ga0070685_10247569
306 Ga0070699_100453937
307 Ga0070684_100002110
308 Ga0070684_100438485
309 Ga0070684_100811146
310 Ga0068853_100279050
311 Ga0070665_100000957
312 Ga0070665_100069023
313 Ga0070665_100920477
314 Ga0068855_100044304
315 Ga0070664_100078897
316 Ga0068857_100007737
317 Ga0068856_100007197
318 Ga0068856_100183545
319 Ga0068864_100200782
320 Ga0068864_100432270
321 Ga0068864_101781000
322 Ga0068861_100150346
323 Ga0068858_100021952
324 Ga0068860_100255292
325 Ga0068862_101276184
326 Ga0075363_100046636
327 Ga0075364_10110234
328 Ga0075370_10568431
329 Ga0068865_100216565
330 Ga0068865_100923389
331 Ga0111539_11298464
332 Ga0105245_10001389
333 Ga0105245_10064429
334 Ga0105245_10291714
335 Ga0105245_10695018
336 Ga0105247_10014218
337 Ga0105243_10066113
338 Ga0105243_10142877
339 Ga0105243_10398495
340 Ga0105243_10682258
341 Ga0105241_10886094
342 Ga0105242_10022620
343 Ga0105242_11242779
344 Ga0105242_11585516
345 Ga0105248_10226769
346 Ga0105237_10051599
347 Ga0105237_10090703
348 Ga0105238_11045340
349 Ga0105249_10048920
350 Ga0105249_10094928
351 Ga0105239_10003486
352 Ga0105239_10007963
353 Ga0105239_10172806
354 Ga0105246_10030718
355 Ga0105246_12273546
356 Ga0157371_10183289
357 Ga0157371_10709259
358 Ga0157370_10726405
359 Ga0157369_10010908
360 Ga0157369_10259115
361 Ga0157374_11675613
362 Ga0163162_10002716
363 Ga0163162_11512564
364 Ga0157372_10022009
365 Ga0157372_10136598
366 Ga0157372_10234840
367 Ga0157372_10687883
368 Ga0157372_12128437
369 Ga0157375_10167585
370 Ga0157375_10653402
371 Ga0163163_10083001
372 Ga0163163_10184023
373 Ga0182008_10032092
374 Ga0157379_10062751
375 Ga0157379_11491416
376 Ga0157376_10676710
377 Ga0157376_11066195
378 Ga0206353_10900330
379 Ga0207642_10238169
380 Ga0207688_10050208
381 Ga0207688_10053554
382 Ga0207647_10021628
383 Ga0207647_10071860
384 Ga0207705_10010070
385 Ga0207705_10502240
386 Ga0207705_10544117
387 Ga0207671_10070573
388 Ga0207657_10023569
389 Ga0207657_10025056
390 Ga0207652_10109684
391 Ga0207652_10694558
392 Ga0207687_10137445
393 Ga0207687_10244571
394 Ga0207687_10562992
395 Ga0207664_10013827
396 Ga0207690_10374671
397 Ga0207690_11044425
398 Ga0207706_10046339
399 Ga0207706_10781750
400 Ga0207686_10649330
401 Ga0207709_10025790
402 Ga0207709_10346284
403 Ga0207709_10461494
404 Ga0207704_10113765
405 Ga0207704_10323482
406 Ga0207704_10465226
407 Ga0207691_10117466
408 Ga0207711_10232101
409 Ga0207661_10011604
410 Ga0207661_10290460
411 Ga0207679_10050079
412 Ga0207667_10125941
413 Ga0207712_10461352
414 Ga0207712_10926418
415 Ga0207668_11108390
416 Ga0207658_10251112
417 Ga0207703_10028389
418 Ga0207639_10184012
419 Ga0207639_10875583
420 Ga0207678_10027347
421 Ga0207678_10536381
422 Ga0207702_10096363
423 Ga0207702_10813087
424 Ga0207675_100166364
425 Ga0207675_100181485
426 Ga0207675_101006173
427 Ga0207698_11016390
428 Ga0268266_10009722
429 Ga0268266_10236878
430 Ga0268266_10517427
431 Ga0268265_11194113
432 Ga0268264_10034080
433 Ga0307408_100842948
434 Ga0307405_11120124
435 Ga0307413_10076371
436 Ga0307410_10065964
437 Ga0307407_10036602
438 Ga0307407_10608449
439 Ga0307407_11422961
440 Ga0307412_10346935
441 Ga0307412_10618944
442 Ga0307409_100011357
443 Ga0307409_100134624
444 Ga0307409_101012236
445 Ga0307409_101897812
446 Ga0307416_100002929
447 Ga0307416_100139609
448 Ga0307416_102078559
449 Ga0307414_10440917
450 Ga0307411_10187793
451 Ga0307415_100006264
452 Ga0395901_0695860
453 Ga0395901_1029393
454 Ga0451849_0169198
455 Ga0451843_0596534
456 Ga0439445_0221903
457 Ga0439458_0188418
458 Ga0439464_0114790
459 Ga0466969_0095293
460 Ga0466966_0002194
461 Ga0466961_0057670
462 Ga0466963_0163320
463 Ga0466963_0204286
464 Ga0466963_0226161
465 Ga0466964_0024392
466 Ga0466968_0050234
467 Ga0466968_0084111
468 Ga0466970_0125373
469 Ga0466957_0042866
470 Ga0466960_0040312
471 Ga0466958_0679220
472 Ga0466967_0003367
473 Ga0466967_0025128
474 Ga0466967_0055280
475 Ga0466967_0487019
476 Ga0495603_0305872
477 Ga0495629_0475820
478 Ga0495641_0055424
479 Ga0495593_0123851
480 Ga0495614_0109042
481 Ga0496100_0030492
482 Ga0496100_0631562
483 Ga0496101_0144387
484 Ga0496101_0531210
485 Ga0496101_1425363
486 Ga0496102_0213649
487 Ga0496102_0313075
488 Ga0496102_0972394
489 Ga0496103_0031620
490 Ga0496104_0055033
491 Ga0496105_0058739
492 Ga0496105_0398141
493 Ga0496106_0133664
494 Ga0496106_0875783
495 Ga0496107_0129378
496 Ga0496107_0312980
497 Ga0496107_0340304
498 Ga0496107_0381322
499 Ga0496108_0008499
500 Ga0496108_0026740
501 Ga0496108_0237893
502 Ga0496108_0326905
503 Ga0496109_0069529
504 Ga0496109_0093942
505 Ga0496109_0274532
506 Ga0496109_1170281
507 Ga0496110_1038078
508 Ga0496111_0002381
509 Ga0496111_0242930
510 Ga0496112_0260899
511 Ga0496113_0717459
512 Ga0496113_0856175
513 Ga0496113_0954742
514 Ga0496114_0003522
515 Ga0496114_0008014
516 Ga0496114_1513891
517 Ga0496115_0025512
518 Ga0496115_0155034
519 Ga0496115_0345995
520 Ga0496121_0000025
521 Ga0501032_0090268
522 Ga0501033_0402895
523 Ga0501034_0059180
524 Ga0501034_0670026
525 Ga0501036_0007731
526 Ga0501036_0399763
527 Ga0501037_0015018
528 Ga0501039_0081308
529 Ga0501039_0419022
530 Ga0501041_1009265
531 Ga0501042_0047619
532 Ga0501043_0050580
533 Ga0501046_0104833
534 Ga0501047_0185501
535 Ga0501048_0014002
536 Ga0501069_0014171
537 Ga0501070_0004792
538 Ga0501070_0026744
539 Ga0501070_0385283
540 Ga0501072_0285707
541 Ga0501073_0032451
542 Ga0501074_0032554
543 Ga0501074_0084620
544 Ga0501225_0209061
545 Ga0501035_0018674
546 Ga0501035_0209178
547 Ga0495619_0094036
548 Ga0530510_0037055
549 2861521220
550 8045832720

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

36

165

0.98

PF08534

Redoxin

Redoxin

35

182

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.9483 13 153
5io2-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c48s mutant 0.9458 13 153
3gkm-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.9277 5 153
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.9228 1 153
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.9123 2 155
ID Description Score Start End Superfamily
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9889 4 153 3.40.30.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.976 4 153 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9657 4 153 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9578 5 152 3.40.30.10
5iphA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9483 13 153 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A522QG15-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9934 3 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-K4MJT0-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9929 2 153 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A3E0I1U9-F1-model_v4 deleted 0.9921 3 155
AF-A0A317CZZ0-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.992 13 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A6J6J0E4-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9913 2 153 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Map