F380742
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 275 | 201 | 266 | 135 |
Family's Representative Sequence
| Representative Sequence | 3300050496|nmdc:mga07m45_167899_c1|nmdc:mga07m45_167899_c1_341_778 |
| Length | 145 |
| Sequence | VRHRRALTIMQFHRGRLIDHVHLRVADLDASKRFYKAALEAVGLAHTLSEGPDHFSADELWVDRATGPVSQVHLAFQAADRAQVDRFHAAALAAGGRDNGAPGERPYHPGYYGAFVFDPDGNNVEAVFHGPSRKSAESVVVTPVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 4 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 5 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 6 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 7 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 8 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 9 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 61 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 62 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 63 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 86 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 87 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 128 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 129 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 130 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 131 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 132 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 133 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 134 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 135 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 136 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 137 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 138 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 139 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 140 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 141 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 142 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 143 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 144 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 145 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 146 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 147 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 148 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 149 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 150 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 151 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 152 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 153 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 154 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 155 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 156 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 157 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 158 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 159 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 160 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 178 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 184 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 186 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 187 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 188 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 189 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 190 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 191 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 192 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 196 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 198 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 199 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 200 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 201 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.73 |
| Metatranscriptomes | 0 |
| Isolates | 3.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.73 |
| Nodule | 2.91 |
| Rhizoplane | 2.91 |
| Rhizosphere | 73.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10044705 | 3300003322 | Bacteria | 3459 |
| 2 | rootH1_10269311 | 3300003323 | Bacteria | 1913 |
| 3 | Ga0065704_10626300 | 3300005289 | Bacteria | 594 |
| 4 | Ga0070658_10062932 | 3300005327 | Bacteria | 3024 |
| 5 | Ga0070658_10320595 | 3300005327 | Bacteria | 1323 |
| 6 | Ga0070676_10227035 | 3300005328 | Bacteria | 1236 |
| 7 | Ga0070690_100139642 | 3300005330 | Bacteria | 1644 |
| 8 | Ga0070670_100028593 | 3300005331 | Bacteria | 4797 |
| 9 | Ga0070677_10000682 | 3300005333 | Bacteria | 11360 |
| 10 | Ga0068869_100034316 | 3300005334 | Bacteria | 3588 |
| 11 | Ga0070666_10005985 | 3300005335 | Bacteria | 7472 |
| 12 | Ga0070666_10101397 | 3300005335 | Bacteria | 1984 |
| 13 | Ga0068868_100012860 | 3300005338 | Bacteria | 6122 |
| 14 | Ga0068868_100528900 | 3300005338 | Bacteria | 1036 |
| 15 | Ga0068868_100565259 | 3300005338 | Bacteria | 1004 |
| 16 | Ga0070660_100009325 | 3300005339 | Bacteria | 6896 |
| 17 | Ga0070689_100372002 | 3300005340 | Bacteria | 1203 |
| 18 | Ga0070687_100509615 | 3300005343 | Unclassified | 811 |
| 19 | Ga0070661_100371963 | 3300005344 | Bacteria | 1125 |
| 20 | Ga0070668_100010119 | 3300005347 | Bacteria | 6991 |
| 21 | Ga0070675_100000542 | 3300005354 | Bacteria | 25851 |
| 22 | Ga0070671_100002141 | 3300005355 | Bacteria | 15246 |
| 23 | Ga0070671_100014187 | 3300005355 | Bacteria | 6433 |
| 24 | Ga0070671_100120138 | 3300005355 | Bacteria | 2211 |
| 25 | Ga0070671_100466872 | 3300005355 | Bacteria | 1084 |
| 26 | Ga0070674_100000170 | 3300005356 | Bacteria | 30382 |
| 27 | Ga0070674_101184924 | 3300005356 | Bacteria | 677 |
| 28 | Ga0070673_100000311 | 3300005364 | Bacteria | 25555 |
| 29 | Ga0070673_100044142 | 3300005364 | Bacteria | 3450 |
| 30 | Ga0070673_101862948 | 3300005364 | Bacteria | 570 |
| 31 | Ga0070688_100131852 | 3300005365 | Bacteria | 1687 |
| 32 | Ga0070688_100484925 | 3300005365 | Bacteria | 930 |
| 33 | Ga0070667_100007642 | 3300005367 | Bacteria | 8967 |
| 34 | Ga0070700_100264700 | 3300005441 | Bacteria | 1239 |
| 35 | Ga0070663_100014379 | 3300005455 | Bacteria | 5080 |
| 36 | Ga0070663_100141922 | 3300005455 | Bacteria | 1835 |
| 37 | Ga0070663_100289904 | 3300005455 | Bacteria | 1307 |
| 38 | Ga0070678_100002670 | 3300005456 | Bacteria | 9826 |
| 39 | Ga0070678_100277450 | 3300005456 | Bacteria | 1416 |
| 40 | Ga0070662_100021720 | 3300005457 | Bacteria | 4386 |
| 41 | Ga0068867_100004392 | 3300005459 | Bacteria | 9919 |
| 42 | Ga0068867_100418265 | 3300005459 | Bacteria | 1135 |
| 43 | Ga0070685_10007184 | 3300005466 | Bacteria | 5690 |
| 44 | Ga0070706_100001321 | 3300005467 | Bacteria | 26375 |
| 45 | Ga0070699_100146456 | 3300005518 | Bacteria | 2087 |
| 46 | Ga0070679_101792879 | 3300005530 | Bacteria | 562 |
| 47 | Ga0068853_100009967 | 3300005539 | Bacteria | 7672 |
| 48 | Ga0070672_100007534 | 3300005543 | Bacteria | 7394 |
| 49 | Ga0070686_100731891 | 3300005544 | Bacteria | 792 |
| 50 | Ga0070693_100103051 | 3300005547 | Bacteria | 1742 |
| 51 | Ga0070693_100973832 | 3300005547 | Bacteria | 640 |
| 52 | Ga0070665_100015150 | 3300005548 | Bacteria | 7740 |
| 53 | Ga0070665_100075069 | 3300005548 | Bacteria | 3387 |
| 54 | Ga0068855_100141043 | 3300005563 | Bacteria | 2747 |
| 55 | Ga0070702_100611593 | 3300005615 | Unclassified | 818 |
| 56 | Ga0068852_100045978 | 3300005616 | Bacteria | 3717 |
| 57 | Ga0068852_101296946 | 3300005616 | Bacteria | 750 |
| 58 | Ga0068859_100066920 | 3300005617 | Bacteria | 3628 |
| 59 | Ga0068864_100023359 | 3300005618 | Bacteria | 5192 |
| 60 | Ga0068861_100028192 | 3300005719 | Bacteria | 4097 |
| 61 | Ga0068851_10001538 | 3300005834 | Bacteria | 10114 |
| 62 | Ga0068870_10024215 | 3300005840 | Bacteria | 3002 |
| 63 | Ga0068863_100090539 | 3300005841 | Bacteria | 2901 |
| 64 | Ga0068860_100006251 | 3300005843 | Bacteria | 11963 |
| 65 | Ga0068860_100146732 | 3300005843 | Bacteria | 2270 |
| 66 | Ga0068862_100794494 | 3300005844 | Bacteria | 924 |
| 67 | Ga0075368_10009791 | 3300006042 | Bacteria | 3455 |
| 68 | Ga0075368_10095861 | 3300006042 | Bacteria | 1216 |
| 69 | Ga0075363_100004085 | 3300006048 | Bacteria | 6324 |
| 70 | Ga0075364_10088226 | 3300006051 | Bacteria | 2056 |
| 71 | Ga0075362_10150205 | 3300006177 | Bacteria | 1117 |
| 72 | Ga0075367_10093554 | 3300006178 | Bacteria | 1831 |
| 73 | Ga0075367_10894937 | 3300006178 | Bacteria | 566 |
| 74 | Ga0075369_10071991 | 3300006186 | Bacteria | 1522 |
| 75 | Ga0075366_10002428 | 3300006195 | Bacteria | 9556 |
| 76 | Ga0075366_10004870 | 3300006195 | Bacteria | 7242 |
| 77 | Ga0075366_10050465 | 3300006195 | Bacteria | 2470 |
| 78 | Ga0075366_10172488 | 3300006195 | Bacteria | 1312 |
| 79 | Ga0097621_100006254 | 3300006237 | Bacteria | 8450 |
| 80 | Ga0075370_10020391 | 3300006353 | Bacteria | 3622 |
| 81 | Ga0075370_10057370 | 3300006353 | Bacteria | 2213 |
| 82 | Ga0068871_100005270 | 3300006358 | Bacteria | 9052 |
| 83 | Ga0075428_100190009 | 3300006844 | Bacteria | 2221 |
| 84 | Ga0075431_100619813 | 3300006847 | Bacteria | 1064 |
| 85 | Ga0068865_100010937 | 3300006881 | Bacteria | 5663 |
| 86 | Ga0068865_100429675 | 3300006881 | Bacteria | 1088 |
| 87 | Ga0097620_100066916 | 3300006931 | Bacteria | 3628 |
| 88 | Ga0105241_10597277 | 3300009174 | Bacteria | 997 |
| 89 | Ga0105241_12444297 | 3300009174 | Bacteria | 522 |
| 90 | Ga0105242_12640172 | 3300009176 | Bacteria | 552 |
| 91 | Ga0105248_10090307 | 3300009177 | Bacteria | 3449 |
| 92 | Ga0105238_10443150 | 3300009551 | Bacteria | 1295 |
| 93 | Ga0105249_10089276 | 3300009553 | Bacteria | 2880 |
| 94 | Ga0105249_10376125 | 3300009553 | Bacteria | 1445 |
| 95 | Ga0157374_10013263 | 3300013296 | Bacteria | 7191 |
| 96 | Ga0157374_10413479 | 3300013296 | Bacteria | 1347 |
| 97 | Ga0163162_10099043 | 3300013306 | Bacteria | 3005 |
| 98 | Ga0157372_13367985 | 3300013307 | Bacteria | 509 |
| 99 | Ga0157375_10000362 | 3300013308 | Bacteria | 41418 |
| 100 | Ga0157375_12556550 | 3300013308 | Bacteria | 610 |
| 101 | Ga0163163_10175505 | 3300014325 | Bacteria | 2189 |
| 102 | Ga0157380_12081196 | 3300014326 | Bacteria | 630 |
| 103 | Ga0157377_10068168 | 3300014745 | Bacteria | 2050 |
| 104 | Ga0157377_10296849 | 3300014745 | Bacteria | 1065 |
| 105 | Ga0157376_10004202 | 3300014969 | Bacteria | 9991 |
| 106 | Ga0163161_10047640 | 3300017792 | Bacteria | 3094 |
| 107 | Ga0214542_1015383 | 3300021321 | Bacteria | 8011 |
| 108 | Ga0214543_1000003 | 3300021327 | Bacteria | 692327 |
| 109 | Ga0209051_1002343 | 3300025303 | Bacteria | 13718 |
| 110 | Ga0207697_10038093 | 3300025315 | Bacteria | 1971 |
| 111 | Ga0207656_10008186 | 3300025321 | Bacteria | 3838 |
| 112 | Ga0207682_10000122 | 3300025893 | Bacteria | 35790 |
| 113 | Ga0207680_10046351 | 3300025903 | Bacteria | 2569 |
| 114 | Ga0207645_10000063 | 3300025907 | Bacteria | 76658 |
| 115 | Ga0207645_10126828 | 3300025907 | Bacteria | 1659 |
| 116 | Ga0207643_10027098 | 3300025908 | Bacteria | 3176 |
| 117 | Ga0207705_10042569 | 3300025909 | Bacteria | 3260 |
| 118 | Ga0207705_10107832 | 3300025909 | Bacteria | 2055 |
| 119 | Ga0207684_10008620 | 3300025910 | Bacteria | 9060 |
| 120 | Ga0207657_10164263 | 3300025919 | Bacteria | 1802 |
| 121 | Ga0207652_11603559 | 3300025921 | Bacteria | 555 |
| 122 | Ga0207681_10092224 | 3300025923 | Bacteria | 2165 |
| 123 | Ga0207694_10398497 | 3300025924 | Bacteria | 1144 |
| 124 | Ga0207650_10572226 | 3300025925 | Unclassified | 948 |
| 125 | Ga0207659_10028182 | 3300025926 | Bacteria | 3814 |
| 126 | Ga0207659_10124637 | 3300025926 | Bacteria | 1979 |
| 127 | Ga0207644_10007250 | 3300025931 | Bacteria | 7218 |
| 128 | Ga0207644_10160065 | 3300025931 | Bacteria | 1749 |
| 129 | Ga0207644_10211919 | 3300025931 | Bacteria | 1532 |
| 130 | Ga0207644_10279354 | 3300025931 | Bacteria | 1340 |
| 131 | Ga0207706_10000856 | 3300025933 | Bacteria | 31357 |
| 132 | Ga0207706_10444172 | 3300025933 | Bacteria | 1122 |
| 133 | Ga0207670_10449976 | 3300025936 | Bacteria | 1038 |
| 134 | Ga0207669_10008578 | 3300025937 | Bacteria | 4807 |
| 135 | Ga0207669_10024432 | 3300025937 | Bacteria | 3248 |
| 136 | Ga0207704_10020907 | 3300025938 | Bacteria | 3474 |
| 137 | Ga0207691_10000050 | 3300025940 | Bacteria | 94763 |
| 138 | Ga0207711_10078862 | 3300025941 | Bacteria | 2874 |
| 139 | Ga0207711_10084515 | 3300025941 | Bacteria | 2778 |
| 140 | Ga0207689_10067815 | 3300025942 | Bacteria | 2931 |
| 141 | Ga0207651_10087067 | 3300025960 | Bacteria | 2272 |
| 142 | Ga0207651_10362682 | 3300025960 | Bacteria | 1223 |
| 143 | Ga0207651_10459592 | 3300025960 | Bacteria | 1094 |
| 144 | Ga0207712_10051923 | 3300025961 | Bacteria | 2869 |
| 145 | Ga0207668_10027578 | 3300025972 | Bacteria | 3700 |
| 146 | Ga0207668_11381723 | 3300025972 | Bacteria | 635 |
| 147 | Ga0207640_10051314 | 3300025981 | Bacteria | 2681 |
| 148 | Ga0207658_10012512 | 3300025986 | Bacteria | 5795 |
| 149 | Ga0207677_10062012 | 3300026023 | Bacteria | 2592 |
| 150 | Ga0207677_10500421 | 3300026023 | Bacteria | 1051 |
| 151 | Ga0207677_11337433 | 3300026023 | Bacteria | 659 |
| 152 | Ga0207639_10011464 | 3300026041 | Bacteria | 6158 |
| 153 | Ga0207678_10001056 | 3300026067 | Bacteria | 25189 |
| 154 | Ga0207678_10367613 | 3300026067 | Bacteria | 1242 |
| 155 | Ga0207641_10557233 | 3300026088 | Bacteria | 1118 |
| 156 | Ga0207641_10682594 | 3300026088 | Unclassified | 1010 |
| 157 | Ga0207648_10004317 | 3300026089 | Bacteria | 14637 |
| 158 | Ga0207648_10016800 | 3300026089 | Bacteria | 6673 |
| 159 | Ga0207676_10026524 | 3300026095 | Bacteria | 4310 |
| 160 | Ga0207676_10999883 | 3300026095 | Bacteria | 824 |
| 161 | Ga0207676_11335953 | 3300026095 | Bacteria | 712 |
| 162 | Ga0207675_100038658 | 3300026118 | Bacteria | 4452 |
| 163 | Ga0207683_10000521 | 3300026121 | Bacteria | 35599 |
| 164 | Ga0207683_10303238 | 3300026121 | Bacteria | 1461 |
| 165 | Ga0207698_10022880 | 3300026142 | Bacteria | 4356 |
| 166 | Ga0209813_10040230 | 3300027866 | Bacteria | 1420 |
| 167 | Ga0268265_10251514 | 3300028380 | Bacteria | 1565 |
| 168 | Ga0268264_10021324 | 3300028381 | Bacteria | 5290 |
| 169 | Ga0268264_10121213 | 3300028381 | Bacteria | 2305 |
| 170 | Ga0307517_10037458 | 3300028786 | Bacteria | 5415 |
| 171 | Ga0307517_10067160 | 3300028786 | Bacteria | 3287 |
| 172 | Ga0307515_10023794 | 3300028794 | Bacteria | 10711 |
| 173 | Ga0307515_10083881 | 3300028794 | Bacteria | 4101 |
| 174 | Ga0307512_10211131 | 3300030522 | Bacteria | 1032 |
| 175 | Ga0307513_10000010 | 3300031456 | Bacteria | 360812 |
| 176 | Ga0307513_10002513 | 3300031456 | Bacteria | 25362 |
| 177 | Ga0307509_10003916 | 3300031507 | Bacteria | 21998 |
| 178 | Ga0307509_10006677 | 3300031507 | Bacteria | 15393 |
| 179 | Ga0307509_10194632 | 3300031507 | Bacteria | 1873 |
| 180 | Ga0307508_10000028 | 3300031616 | Bacteria | 168639 |
| 181 | Ga0307508_10044173 | 3300031616 | Bacteria | 3987 |
| 182 | Ga0307508_10068996 | 3300031616 | Bacteria | 3105 |
| 183 | Ga0307516_10534406 | 3300031730 | Bacteria | 826 |
| 184 | Ga0307405_11886837 | 3300031731 | Bacteria | 533 |
| 185 | Ga0307410_10094571 | 3300031852 | Bacteria | 2129 |
| 186 | Ga0307415_100142973 | 3300032126 | Bacteria | 1830 |
| 187 | Ga0307507_10030098 | 3300033179 | Bacteria | 5735 |
| 188 | Ga0307510_10061923 | 3300033180 | Bacteria | 3829 |
| 189 | Ga0307510_10095412 | 3300033180 | Bacteria | 2794 |
| 190 | Ga0307510_10466743 | 3300033180 | Bacteria | 703 |
| 191 | Ga0373953_0029981 | 3300035117 | Bacteria | 2107 |
| 192 | Ga0373954_0030618 | 3300035118 | Bacteria | 2482 |
| 193 | Ga0373931_0785376 | 3300035691 | Bacteria | 634 |
| 194 | Ga0373931_0852441 | 3300035691 | Bacteria | 610 |
| 195 | Ga0373937_0204435 | 3300036401 | Bacteria | 1857 |
| 196 | Ga0395905_0004546 | 3300037471 | Bacteria | 14363 |
| 197 | Ga0439438_081245 | 3300041405 | Bacteria | 795 |
| 198 | Ga0439439_0131826 | 3300041406 | Bacteria | 702 |
| 199 | Ga0451793_1027516 | 3300041452 | Bacteria | 710 |
| 200 | Ga0451793_1409509 | 3300041452 | Unclassified | 549 |
| 201 | Ga0451797_0128487 | 3300041453 | Bacteria | 1181 |
| 202 | Ga0451843_1688711 | 3300041509 | Bacteria | 507 |
| 203 | Ga0439432_147706 | 3300042006 | Bacteria | 690 |
| 204 | Ga0439449_0042128 | 3300042007 | Bacteria | 1697 |
| 205 | Ga0439462_0022250 | 3300042015 | Bacteria | 1658 |
| 206 | Ga0439458_0087734 | 3300042157 | Bacteria | 798 |
| 207 | Ga0439435_0008360 | 3300042436 | Bacteria | 2398 |
| 208 | Ga0439460_0005650 | 3300042461 | Bacteria | 3079 |
| 209 | Ga0453683_0433990 | 3300044673 | Bacteria | 849 |
| 210 | Ga0466965_0020166 | 3300044683 | Bacteria | 3203 |
| 211 | Ga0466964_0167231 | 3300044706 | Bacteria | 1033 |
| 212 | Ga0451576_1023619 | 3300045051 | Bacteria | 865 |
| 213 | Ga0451576_1036882 | 3300045051 | Bacteria | 859 |
| 214 | Ga0466967_0041440 | 3300045976 | Bacteria | 3970 |
| 215 | Ga0495629_0284313 | 3300046459 | Bacteria | 1134 |
| 216 | Ga0495632_0091117 | 3300046519 | Bacteria | 1445 |
| 217 | Ga0495632_0151273 | 3300046519 | Bacteria | 1073 |
| 218 | Ga0495648_0390372 | 3300046524 | Bacteria | 625 |
| 219 | Ga0495642_0415021 | 3300046528 | Bacteria | 594 |
| 220 | Ga0495667_0557392 | 3300046559 | Bacteria | 716 |
| 221 | Ga0495668_0096354 | 3300046616 | Bacteria | 1619 |
| 222 | Ga0495611_0022340 | 3300046648 | Bacteria | 2737 |
| 223 | Ga0495625_0035844 | 3300046660 | Bacteria | 3652 |
| 224 | Ga0495625_0159283 | 3300046660 | Bacteria | 1513 |
| 225 | Ga0495625_0186432 | 3300046660 | Bacteria | 1377 |
| 226 | Ga0495625_0306254 | 3300046660 | Bacteria | 1015 |
| 227 | Ga0495588_0281335 | 3300046674 | Bacteria | 877 |
| 228 | Ga0495669_0112053 | 3300046684 | Bacteria | 1274 |
| 229 | Ga0495660_0008420 | 3300046810 | Bacteria | 6037 |
| 230 | Ga0495685_135657 | 3300047447 | Bacteria | 803 |
| 231 | Ga0495673_0128048 | 3300047469 | Bacteria | 1000 |
| 232 | Ga0495681_0099655 | 3300047470 | Bacteria | 1272 |
| 233 | Ga0496100_1017597 | 3300048903 | Bacteria | 652 |
| 234 | Ga0496108_1464445 | 3300048911 | Bacteria | 569 |
| 235 | Ga0496109_0322177 | 3300048912 | Bacteria | 1459 |
| 236 | Ga0496110_1198987 | 3300048913 | Bacteria | 668 |
| 237 | Ga0501034_0420177 | 3300049571 | Bacteria | 1258 |
| 238 | Ga0501037_1029719 | 3300049573 | Bacteria | 535 |
| 239 | Ga0501039_0273856 | 3300049575 | Bacteria | 1327 |
| 240 | Ga0501069_0095665 | 3300049585 | Bacteria | 1682 |
| 241 | Ga0501070_0118209 | 3300049586 | Bacteria | 2190 |
| 242 | Ga0501199_058596 | 3300049650 | Bacteria | 533 |
| 243 | Ga0501035_0125450 | 3300049822 | Bacteria | 2241 |
| 244 | nmdc:mga03683_699657_c1 | 3300050489 | Bacteria | 502 |
| 245 | nmdc:mga03n38_324130_c1 | 3300050490 | Bacteria | 833 |
| 246 | nmdc:mga0yw44_57559_c1 | 3300050492 | Bacteria | 2372 |
| 247 | nmdc:mga0k408_1288_c1 | 3300050493 | Bacteria | 13596 |
| 248 | nmdc:mga0k408_13507_c1 | 3300050493 | Bacteria | 4481 |
| 249 | nmdc:mga0k408_752781_c1 | 3300050493 | Bacteria | 569 |
| 250 | nmdc:mga0k408_790878_c1 | 3300050493 | Bacteria | 553 |
| 251 | nmdc:mga0k408_90534_c1 | 3300050493 | Bacteria | 1796 |
| 252 | nmdc:mga06z11_304834_c1 | 3300050494 | Bacteria | 948 |
| 253 | nmdc:mga04h51_45650_c1 | 3300050495 | Bacteria | 1450 |
| 254 | nmdc:mga07m45_167899_c1 | 3300050496 | Bacteria | 1275 |
| 255 | nmdc:mga07m45_739885_c1 | 3300050496 | Bacteria | 565 |
| 256 | nmdc:mga09592_308080_c1 | 3300050508 | Bacteria | 1373 |
| 257 | nmdc:mga0qj67_112928_c1 | 3300050509 | Bacteria | 2194 |
| 258 | nmdc:mga0n895_1959903_c1 | 3300050512 | Unclassified | 544 |
| 259 | nmdc:mga0sz30_51433_c1 | 3300050516 | Bacteria | 1747 |
| 260 | Ga0495619_0365026 | 3300053085 | Bacteria | 998 |
| 261 | Ga0500641_0293304 | 3300053096 | Bacteria | 670 |
| 262 | Ga0500650_0004219 | 3300053098 | Bacteria | 5162 |
| 263 | Ga0500650_0082936 | 3300053098 | Bacteria | 1499 |
| 264 | Ga0500555_159776 | 3300053103 | Bacteria | 550 |
| 265 | Ga0500593_000429 | 3300053117 | Bacteria | 16647 |
| 266 | Ga0500616_0058639 | 3300053153 | Bacteria | 2002 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005843 | Ga0068860_100146732 | Ga0068860_1001467321 | 113 |
| 2 | 3300028381 | Ga0268264_10121213 | Ga0268264_101212133 | 113 |
| 3 | 3300005455 | Ga0070663_100141922 | Ga0070663_1001419221 | 115 |
| 4 | 3300045051 | Ga0451576_1023619 | Ga0451576_1023619_122_490 | 115 |
| 5 | 3300049571 | Ga0501034_0420177 | Ga0501034_0420177_747_1133 | 115 |
| 6 | 3300049573 | Ga0501037_1029719 | Ga0501037_1029719_18_401 | 115 |
| 7 | 3300049575 | Ga0501039_0273856 | Ga0501039_0273856_619_1005 | 115 |
| 8 | 3300049585 | Ga0501069_0095665 | Ga0501069_0095665_524_907 | 115 |
| 9 | 3300049586 | Ga0501070_0118209 | Ga0501070_0118209_1164_1547 | 115 |
| 10 | 3300049822 | Ga0501035_0125450 | Ga0501035_0125450_193_576 | 115 |
| 11 | 3300050512 | nmdc:mga0n895_1959903_c1 | nmdc:mga0n895_1959903_c1_108_476 | 115 |
| 12 | 3300009553 | Ga0105249_10089276 | Ga0105249_100892763 | 116 |
| 13 | 3300025961 | Ga0207712_10051923 | Ga0207712_100519233 | 116 |
| 14 | 3300031852 | Ga0307410_10094571 | Ga0307410_100945712 | 116 |
| 15 | 3300032126 | Ga0307415_100142973 | Ga0307415_1001429733 | 116 |
| 16 | 3300026095 | Ga0207676_10999883 | Ga0207676_109998832 | 117 |
| 17 | 3300042436 | Ga0439435_0008360 | Ga0439435_0008360_1614_2015 | 117 |
| 18 | 3300049650 | Ga0501199_058596 | Ga0501199_058596_12_386 | 117 |
| 19 | 3300005327 | Ga0070658_10320595 | Ga0070658_103205951 | 118 |
| 20 | 3300005339 | Ga0070660_100009325 | Ga0070660_1000093255 | 118 |
| 21 | 3300005455 | Ga0070663_100289904 | Ga0070663_1002899042 | 118 |
| 22 | 3300005530 | Ga0070679_101792879 | Ga0070679_1017928792 | 118 |
| 23 | 3300005563 | Ga0068855_100141043 | Ga0068855_1001410434 | 118 |
| 24 | 3300025909 | Ga0207705_10042569 | Ga0207705_100425692 | 118 |
| 25 | 3300025919 | Ga0207657_10164263 | Ga0207657_101642634 | 118 |
| 26 | 3300025921 | Ga0207652_11603559 | Ga0207652_116035592 | 118 |
| 27 | 3300026067 | Ga0207678_10367613 | Ga0207678_103676132 | 118 |
| 28 | 3300041452 | Ga0451793_1409509 | Ga0451793_1409509_171_539 | 119 |
| 29 | 3300035691 | Ga0373931_0785376 | Ga0373931_0785376_45_431 | 122 |
| 30 | 3300044673 | Ga0453683_0433990 | Ga0453683_0433990_238_624 | 122 |
| 31 | 3300045051 | Ga0451576_1036882 | Ga0451576_1036882_372_758 | 122 |
| 32 | 3300047469 | Ga0495673_0128048 | Ga0495673_0128048_148_522 | 122 |
| 33 | 3300009174 | Ga0105241_12444297 | Ga0105241_124442971 | 123 |
| 34 | 3300041453 | Ga0451797_0128487 | Ga0451797_0128487_555_932 | 124 |
| 35 | 3300050496 | nmdc:mga07m45_739885_c1 | nmdc:mga07m45_739885_c1_168_545 | 124 |
| 36 | 3300048912 | Ga0496109_0322177 | Ga0496109_0322177_605_1009 | 127 |
| 37 | iso_pu_bacteria | 2599185236 | 2599723633 | 128 |
| 38 | iso_pu_bacteria | 2508501122 | 2509107399 | 130 |
| 39 | iso_pu_bacteria | 2509276019 | 2509374610 | 130 |
| 40 | iso_pu_bacteria | 2558860100 | 2558863638 | 130 |
| 41 | iso_pu_bacteria | 2751185821 | 2753462964 | 130 |
| 42 | iso_pu_bacteria | 2791355091 | 2792622182 | 130 |
| 43 | iso_pu_bacteria | 2791355092 | 2792628253 | 130 |
| 44 | iso_pu_bacteria | 2791355094 | 2792638489 | 130 |
| 45 | iso_pu_bacteria | 2850079185 | 2850080322 | 130 |
| 46 | 3300005344 | Ga0070661_100371963 | Ga0070661_1003719631 | 132 |
| 47 | 3300005355 | Ga0070671_100014187 | Ga0070671_1000141878 | 132 |
| 48 | 3300005548 | Ga0070665_100075069 | Ga0070665_1000750694 | 132 |
| 49 | 3300014745 | Ga0157377_10296849 | Ga0157377_102968492 | 132 |
| 50 | 3300025931 | Ga0207644_10279354 | Ga0207644_102793542 | 132 |
| 51 | 3300026095 | Ga0207676_11335953 | Ga0207676_113359532 | 132 |
| 52 | 3300028786 | Ga0307517_10037458 | Ga0307517_100374584 | 132 |
| 53 | 3300046616 | Ga0495668_0096354 | Ga0495668_0096354_62_460 | 132 |
| 54 | 3300046648 | Ga0495611_0022340 | Ga0495611_0022340_2320_2718 | 132 |
| 55 | 3300046660 | Ga0495625_0035844 | Ga0495625_0035844_1444_1842 | 132 |
| 56 | 3300046660 | Ga0495625_0306254 | Ga0495625_0306254_351_749 | 132 |
| 57 | 3300046684 | Ga0495669_0112053 | Ga0495669_0112053_164_562 | 132 |
| 58 | 3300047447 | Ga0495685_135657 | Ga0495685_135657_10_408 | 132 |
| 59 | 3300047470 | Ga0495681_0099655 | Ga0495681_0099655_570_968 | 132 |
| 60 | 3300005328 | Ga0070676_10227035 | Ga0070676_102270352 | 133 |
| 61 | 3300005330 | Ga0070690_100139642 | Ga0070690_1001396422 | 133 |
| 62 | 3300005338 | Ga0068868_100565259 | Ga0068868_1005652592 | 133 |
| 63 | 3300005340 | Ga0070689_100372002 | Ga0070689_1003720022 | 133 |
| 64 | 3300005356 | Ga0070674_101184924 | Ga0070674_1011849242 | 133 |
| 65 | 3300005364 | Ga0070673_100044142 | Ga0070673_1000441422 | 133 |
| 66 | 3300005365 | Ga0070688_100484925 | Ga0070688_1004849252 | 133 |
| 67 | 3300005441 | Ga0070700_100264700 | Ga0070700_1002647002 | 133 |
| 68 | 3300005456 | Ga0070678_100277450 | Ga0070678_1002774502 | 133 |
| 69 | 3300005459 | Ga0068867_100418265 | Ga0068867_1004182652 | 133 |
| 70 | 3300005544 | Ga0070686_100731891 | Ga0070686_1007318912 | 133 |
| 71 | 3300005616 | Ga0068852_101296946 | Ga0068852_1012969462 | 133 |
| 72 | 3300006881 | Ga0068865_100429675 | Ga0068865_1004296752 | 133 |
| 73 | 3300014326 | Ga0157380_12081196 | Ga0157380_120811961 | 133 |
| 74 | 3300025907 | Ga0207645_10126828 | Ga0207645_101268282 | 133 |
| 75 | 3300025924 | Ga0207694_10398497 | Ga0207694_103984972 | 133 |
| 76 | 3300025926 | Ga0207659_10124637 | Ga0207659_101246372 | 133 |
| 77 | 3300025933 | Ga0207706_10444172 | Ga0207706_104441722 | 133 |
| 78 | 3300025936 | Ga0207670_10449976 | Ga0207670_104499762 | 133 |
| 79 | 3300025937 | Ga0207669_10024432 | Ga0207669_100244324 | 133 |
| 80 | 3300025960 | Ga0207651_10362682 | Ga0207651_103626822 | 133 |
| 81 | 3300025981 | Ga0207640_10051314 | Ga0207640_100513142 | 133 |
| 82 | 3300026023 | Ga0207677_10500421 | Ga0207677_105004212 | 133 |
| 83 | 3300026089 | Ga0207648_10016800 | Ga0207648_100168002 | 133 |
| 84 | 3300026121 | Ga0207683_10303238 | Ga0207683_103032382 | 133 |
| 85 | 3300046519 | Ga0495632_0151273 | Ga0495632_0151273_508_912 | 133 |
| 86 | 3300046810 | Ga0495660_0008420 | Ga0495660_0008420_589_993 | 133 |
| 87 | 3300005335 | Ga0070666_10101397 | Ga0070666_101013971 | 134 |
| 88 | 3300005338 | Ga0068868_100528900 | Ga0068868_1005289002 | 134 |
| 89 | 3300005355 | Ga0070671_100120138 | Ga0070671_1001201381 | 134 |
| 90 | 3300005355 | Ga0070671_100466872 | Ga0070671_1004668722 | 134 |
| 91 | 3300005364 | Ga0070673_101862948 | Ga0070673_1018629481 | 134 |
| 92 | 3300005547 | Ga0070693_100103051 | Ga0070693_1001030513 | 134 |
| 93 | 3300013296 | Ga0157374_10413479 | Ga0157374_104134792 | 134 |
| 94 | 3300013308 | Ga0157375_12556550 | Ga0157375_125565501 | 134 |
| 95 | 3300021321 | Ga0214542_1015383 | Ga0214542_10153837 | 134 |
| 96 | 3300021327 | Ga0214543_1000003 | Ga0214543_1000003322 | 134 |
| 97 | 3300025931 | Ga0207644_10160065 | Ga0207644_101600653 | 134 |
| 98 | 3300025931 | Ga0207644_10211919 | Ga0207644_102119192 | 134 |
| 99 | 3300025941 | Ga0207711_10078862 | Ga0207711_100788622 | 134 |
| 100 | 3300025960 | Ga0207651_10459592 | Ga0207651_104595922 | 134 |
| 101 | 3300026023 | Ga0207677_11337433 | Ga0207677_113374331 | 134 |
| 102 | 3300031731 | Ga0307405_11886837 | Ga0307405_118868371 | 134 |
| 103 | 3300035117 | Ga0373953_0029981 | Ga0373953_0029981_920_1333 | 134 |
| 104 | 3300035118 | Ga0373954_0030618 | Ga0373954_0030618_1105_1518 | 134 |
| 105 | 3300036401 | Ga0373937_0204435 | Ga0373937_0204435_688_1101 | 134 |
| 106 | 3300041405 | Ga0439438_081245 | Ga0439438_081245_124_534 | 134 |
| 107 | 3300041406 | Ga0439439_0131826 | Ga0439439_0131826_104_514 | 134 |
| 108 | 3300041509 | Ga0451843_1688711 | Ga0451843_1688711_70_483 | 134 |
| 109 | 3300042006 | Ga0439432_147706 | Ga0439432_147706_138_548 | 134 |
| 110 | 3300042007 | Ga0439449_0042128 | Ga0439449_0042128_290_700 | 134 |
| 111 | 3300042015 | Ga0439462_0022250 | Ga0439462_0022250_549_959 | 134 |
| 112 | 3300046459 | Ga0495629_0284313 | Ga0495629_0284313_673_1086 | 134 |
| 113 | 3300046559 | Ga0495667_0557392 | Ga0495667_0557392_37_450 | 134 |
| 114 | 3300048903 | Ga0496100_1017597 | Ga0496100_1017597_201_614 | 134 |
| 115 | 3300053085 | Ga0495619_0365026 | Ga0495619_0365026_64_477 | 134 |
| 116 | 3300003322 | rootL2_10044705 | rootL2_100447056 | 135 |
| 117 | 3300003323 | rootH1_10269311 | rootH1_102693112 | 135 |
| 118 | 3300005289 | Ga0065704_10626300 | Ga0065704_106263001 | 135 |
| 119 | 3300005327 | Ga0070658_10062932 | Ga0070658_100629325 | 135 |
| 120 | 3300005331 | Ga0070670_100028593 | Ga0070670_10002859310 | 135 |
| 121 | 3300005333 | Ga0070677_10000682 | Ga0070677_1000068216 | 135 |
| 122 | 3300005334 | Ga0068869_100034316 | Ga0068869_1000343168 | 135 |
| 123 | 3300005335 | Ga0070666_10005985 | Ga0070666_100059856 | 135 |
| 124 | 3300005338 | Ga0068868_100012860 | Ga0068868_10001286011 | 135 |
| 125 | 3300005343 | Ga0070687_100509615 | Ga0070687_1005096152 | 135 |
| 126 | 3300005347 | Ga0070668_100010119 | Ga0070668_1000101196 | 135 |
| 127 | 3300005354 | Ga0070675_100000542 | Ga0070675_10000054248 | 135 |
| 128 | 3300005355 | Ga0070671_100002141 | Ga0070671_1000021418 | 135 |
| 129 | 3300005356 | Ga0070674_100000170 | Ga0070674_10000017027 | 135 |
| 130 | 3300005364 | Ga0070673_100000311 | Ga0070673_1000003118 | 135 |
| 131 | 3300005365 | Ga0070688_100131852 | Ga0070688_1001318522 | 135 |
| 132 | 3300005367 | Ga0070667_100007642 | Ga0070667_1000076423 | 135 |
| 133 | 3300005455 | Ga0070663_100014379 | Ga0070663_1000143797 | 135 |
| 134 | 3300005456 | Ga0070678_100002670 | Ga0070678_1000026706 | 135 |
| 135 | 3300005457 | Ga0070662_100021720 | Ga0070662_1000217202 | 135 |
| 136 | 3300005459 | Ga0068867_100004392 | Ga0068867_10000439215 | 135 |
| 137 | 3300005466 | Ga0070685_10007184 | Ga0070685_100071849 | 135 |
| 138 | 3300005467 | Ga0070706_100001321 | Ga0070706_10000132125 | 135 |
| 139 | 3300005518 | Ga0070699_100146456 | Ga0070699_1001464564 | 135 |
| 140 | 3300005539 | Ga0068853_100009967 | Ga0068853_1000099677 | 135 |
| 141 | 3300005543 | Ga0070672_100007534 | Ga0070672_10000753411 | 135 |
| 142 | 3300005547 | Ga0070693_100973832 | Ga0070693_1009738321 | 135 |
| 143 | 3300005548 | Ga0070665_100015150 | Ga0070665_1000151507 | 135 |
| 144 | 3300005615 | Ga0070702_100611593 | Ga0070702_1006115931 | 135 |
| 145 | 3300005616 | Ga0068852_100045978 | Ga0068852_1000459783 | 135 |
| 146 | 3300005617 | Ga0068859_100066920 | Ga0068859_1000669202 | 135 |
| 147 | 3300005618 | Ga0068864_100023359 | Ga0068864_1000233597 | 135 |
| 148 | 3300005719 | Ga0068861_100028192 | Ga0068861_1000281925 | 135 |
| 149 | 3300005834 | Ga0068851_10001538 | Ga0068851_100015387 | 135 |
| 150 | 3300005840 | Ga0068870_10024215 | Ga0068870_100242155 | 135 |
| 151 | 3300005841 | Ga0068863_100090539 | Ga0068863_1000905397 | 135 |
| 152 | 3300005843 | Ga0068860_100006251 | Ga0068860_10000625123 | 135 |
| 153 | 3300005844 | Ga0068862_100794494 | Ga0068862_1007944942 | 135 |
| 154 | 3300006042 | Ga0075368_10009791 | Ga0075368_100097913 | 135 |
| 155 | 3300006042 | Ga0075368_10095861 | Ga0075368_100958613 | 135 |
| 156 | 3300006048 | Ga0075363_100004085 | Ga0075363_1000040852 | 135 |
| 157 | 3300006051 | Ga0075364_10088226 | Ga0075364_100882262 | 135 |
| 158 | 3300006177 | Ga0075362_10150205 | Ga0075362_101502052 | 135 |
| 159 | 3300006178 | Ga0075367_10093554 | Ga0075367_100935542 | 135 |
| 160 | 3300006178 | Ga0075367_10894937 | Ga0075367_108949371 | 135 |
| 161 | 3300006186 | Ga0075369_10071991 | Ga0075369_100719912 | 135 |
| 162 | 3300006195 | Ga0075366_10002428 | Ga0075366_100024287 | 135 |
| 163 | 3300006195 | Ga0075366_10004870 | Ga0075366_100048707 | 135 |
| 164 | 3300006195 | Ga0075366_10050465 | Ga0075366_100504652 | 135 |
| 165 | 3300006195 | Ga0075366_10172488 | Ga0075366_101724883 | 135 |
| 166 | 3300006237 | Ga0097621_100006254 | Ga0097621_1000062544 | 135 |
| 167 | 3300006353 | Ga0075370_10020391 | Ga0075370_100203916 | 135 |
| 168 | 3300006353 | Ga0075370_10057370 | Ga0075370_100573702 | 135 |
| 169 | 3300006358 | Ga0068871_100005270 | Ga0068871_10000527015 | 135 |
| 170 | 3300006844 | Ga0075428_100190009 | Ga0075428_1001900093 | 135 |
| 171 | 3300006847 | Ga0075431_100619813 | Ga0075431_1006198132 | 135 |
| 172 | 3300006881 | Ga0068865_100010937 | Ga0068865_1000109377 | 135 |
| 173 | 3300006931 | Ga0097620_100066916 | Ga0097620_1000669162 | 135 |
| 174 | 3300009174 | Ga0105241_10597277 | Ga0105241_105972772 | 135 |
| 175 | 3300009176 | Ga0105242_12640172 | Ga0105242_126401722 | 135 |
| 176 | 3300009177 | Ga0105248_10090307 | Ga0105248_100903073 | 135 |
| 177 | 3300009551 | Ga0105238_10443150 | Ga0105238_104431502 | 135 |
| 178 | 3300009553 | Ga0105249_10376125 | Ga0105249_103761252 | 135 |
| 179 | 3300013296 | Ga0157374_10013263 | Ga0157374_1001326310 | 135 |
| 180 | 3300013306 | Ga0163162_10099043 | Ga0163162_100990432 | 135 |
| 181 | 3300013307 | Ga0157372_13367985 | Ga0157372_133679851 | 135 |
| 182 | 3300013308 | Ga0157375_10000362 | Ga0157375_1000036227 | 135 |
| 183 | 3300014325 | Ga0163163_10175505 | Ga0163163_101755053 | 135 |
| 184 | 3300014745 | Ga0157377_10068168 | Ga0157377_100681682 | 135 |
| 185 | 3300014969 | Ga0157376_10004202 | Ga0157376_1000420216 | 135 |
| 186 | 3300017792 | Ga0163161_10047640 | Ga0163161_100476406 | 135 |
| 187 | 3300025303 | Ga0209051_1002343 | Ga0209051_100234316 | 135 |
| 188 | 3300025315 | Ga0207697_10038093 | Ga0207697_100380933 | 135 |
| 189 | 3300025321 | Ga0207656_10008186 | Ga0207656_100081867 | 135 |
| 190 | 3300025893 | Ga0207682_10000122 | Ga0207682_1000012212 | 135 |
| 191 | 3300025903 | Ga0207680_10046351 | Ga0207680_100463516 | 135 |
| 192 | 3300025907 | Ga0207645_10000063 | Ga0207645_1000006382 | 135 |
| 193 | 3300025908 | Ga0207643_10027098 | Ga0207643_100270985 | 135 |
| 194 | 3300025909 | Ga0207705_10107832 | Ga0207705_101078323 | 135 |
| 195 | 3300025910 | Ga0207684_10008620 | Ga0207684_1000862010 | 135 |
| 196 | 3300025923 | Ga0207681_10092224 | Ga0207681_100922243 | 135 |
| 197 | 3300025925 | Ga0207650_10572226 | Ga0207650_105722262 | 135 |
| 198 | 3300025926 | Ga0207659_10028182 | Ga0207659_100281824 | 135 |
| 199 | 3300025931 | Ga0207644_10007250 | Ga0207644_100072506 | 135 |
| 200 | 3300025933 | Ga0207706_10000856 | Ga0207706_1000085632 | 135 |
| 201 | 3300025937 | Ga0207669_10008578 | Ga0207669_1000857810 | 135 |
| 202 | 3300025938 | Ga0207704_10020907 | Ga0207704_100209072 | 135 |
| 203 | 3300025940 | Ga0207691_10000050 | Ga0207691_10000050121 | 135 |
| 204 | 3300025941 | Ga0207711_10084515 | Ga0207711_100845155 | 135 |
| 205 | 3300025942 | Ga0207689_10067815 | Ga0207689_100678153 | 135 |
| 206 | 3300025960 | Ga0207651_10087067 | Ga0207651_100870674 | 135 |
| 207 | 3300025972 | Ga0207668_10027578 | Ga0207668_100275784 | 135 |
| 208 | 3300025972 | Ga0207668_11381723 | Ga0207668_113817231 | 135 |
| 209 | 3300025986 | Ga0207658_10012512 | Ga0207658_1001251210 | 135 |
| 210 | 3300026023 | Ga0207677_10062012 | Ga0207677_100620126 | 135 |
| 211 | 3300026041 | Ga0207639_10011464 | Ga0207639_100114648 | 135 |
| 212 | 3300026067 | Ga0207678_10001056 | Ga0207678_1000105627 | 135 |
| 213 | 3300026088 | Ga0207641_10557233 | Ga0207641_105572331 | 135 |
| 214 | 3300026088 | Ga0207641_10682594 | Ga0207641_106825942 | 135 |
| 215 | 3300026089 | Ga0207648_10004317 | Ga0207648_1000431730 | 135 |
| 216 | 3300026095 | Ga0207676_10026524 | Ga0207676_100265246 | 135 |
| 217 | 3300026118 | Ga0207675_100038658 | Ga0207675_1000386586 | 135 |
| 218 | 3300026121 | Ga0207683_10000521 | Ga0207683_1000052160 | 135 |
| 219 | 3300026142 | Ga0207698_10022880 | Ga0207698_100228808 | 135 |
| 220 | 3300027866 | Ga0209813_10040230 | Ga0209813_100402302 | 135 |
| 221 | 3300028380 | Ga0268265_10251514 | Ga0268265_102515142 | 135 |
| 222 | 3300028381 | Ga0268264_10021324 | Ga0268264_100213247 | 135 |
| 223 | 3300028786 | Ga0307517_10067160 | Ga0307517_100671603 | 135 |
| 224 | 3300028794 | Ga0307515_10023794 | Ga0307515_1002379415 | 135 |
| 225 | 3300028794 | Ga0307515_10083881 | Ga0307515_100838813 | 135 |
| 226 | 3300030522 | Ga0307512_10211131 | Ga0307512_102111313 | 135 |
| 227 | 3300031456 | Ga0307513_10000010 | Ga0307513_10000010201 | 135 |
| 228 | 3300031456 | Ga0307513_10002513 | Ga0307513_1000251320 | 135 |
| 229 | 3300031507 | Ga0307509_10003916 | Ga0307509_1000391611 | 135 |
| 230 | 3300031507 | Ga0307509_10006677 | Ga0307509_100066779 | 135 |
| 231 | 3300031507 | Ga0307509_10194632 | Ga0307509_101946324 | 135 |
| 232 | 3300031616 | Ga0307508_10000028 | Ga0307508_1000002814 | 135 |
| 233 | 3300031616 | Ga0307508_10044173 | Ga0307508_100441736 | 135 |
| 234 | 3300031616 | Ga0307508_10068996 | Ga0307508_100689962 | 135 |
| 235 | 3300031730 | Ga0307516_10534406 | Ga0307516_105344062 | 135 |
| 236 | 3300033179 | Ga0307507_10030098 | Ga0307507_100300986 | 135 |
| 237 | 3300033180 | Ga0307510_10061923 | Ga0307510_100619237 | 135 |
| 238 | 3300033180 | Ga0307510_10095412 | Ga0307510_100954123 | 135 |
| 239 | 3300033180 | Ga0307510_10466743 | Ga0307510_104667432 | 135 |
| 240 | 3300035691 | Ga0373931_0852441 | Ga0373931_0852441_180_593 | 135 |
| 241 | 3300037471 | Ga0395905_0004546 | Ga0395905_0004546_12988_13398 | 135 |
| 242 | 3300041452 | Ga0451793_1027516 | Ga0451793_1027516_141_554 | 135 |
| 243 | 3300042157 | Ga0439458_0087734 | Ga0439458_0087734_334_741 | 135 |
| 244 | 3300042461 | Ga0439460_0005650 | Ga0439460_0005650_2291_2704 | 135 |
| 245 | 3300044683 | Ga0466965_0020166 | Ga0466965_0020166_2138_2560 | 135 |
| 246 | 3300044706 | Ga0466964_0167231 | Ga0466964_0167231_500_922 | 135 |
| 247 | 3300045976 | Ga0466967_0041440 | Ga0466967_0041440_453_869 | 135 |
| 248 | 3300046519 | Ga0495632_0091117 | Ga0495632_0091117_837_1250 | 135 |
| 249 | 3300046524 | Ga0495648_0390372 | Ga0495648_0390372_23_436 | 135 |
| 250 | 3300046528 | Ga0495642_0415021 | Ga0495642_0415021_101_514 | 135 |
| 251 | 3300046660 | Ga0495625_0159283 | Ga0495625_0159283_452_865 | 135 |
| 252 | 3300046660 | Ga0495625_0186432 | Ga0495625_0186432_541_954 | 135 |
| 253 | 3300046674 | Ga0495588_0281335 | Ga0495588_0281335_391_801 | 135 |
| 254 | 3300048911 | Ga0496108_1464445 | Ga0496108_1464445_64_474 | 135 |
| 255 | 3300048913 | Ga0496110_1198987 | Ga0496110_1198987_240_653 | 135 |
| 256 | 3300050489 | nmdc:mga03683_699657_c1 | nmdc:mga03683_699657_c1_66_485 | 135 |
| 257 | 3300050490 | nmdc:mga03n38_324130_c1 | nmdc:mga03n38_324130_c1_246_665 | 135 |
| 258 | 3300050492 | nmdc:mga0yw44_57559_c1 | nmdc:mga0yw44_57559_c1_1307_1726 | 135 |
| 259 | 3300050493 | nmdc:mga0k408_1288_c1 | nmdc:mga0k408_1288_c1_8930_9340 | 135 |
| 260 | 3300050493 | nmdc:mga0k408_13507_c1 | nmdc:mga0k408_13507_c1_3234_3653 | 135 |
| 261 | 3300050493 | nmdc:mga0k408_752781_c1 | nmdc:mga0k408_752781_c1_144_557 | 135 |
| 262 | 3300050493 | nmdc:mga0k408_790878_c1 | nmdc:mga0k408_790878_c1_10_420 | 135 |
| 263 | 3300050493 | nmdc:mga0k408_90534_c1 | nmdc:mga0k408_90534_c1_433_852 | 135 |
| 264 | 3300050494 | nmdc:mga06z11_304834_c1 | nmdc:mga06z11_304834_c1_166_585 | 135 |
| 265 | 3300050495 | nmdc:mga04h51_45650_c1 | nmdc:mga04h51_45650_c1_305_724 | 135 |
| 266 | 3300050496 | nmdc:mga07m45_167899_c1 | nmdc:mga07m45_167899_c1_341_778 | 135 |
| 267 | 3300050508 | nmdc:mga09592_308080_c1 | nmdc:mga09592_308080_c1_844_1257 | 135 |
| 268 | 3300050509 | nmdc:mga0qj67_112928_c1 | nmdc:mga0qj67_112928_c1_951_1364 | 135 |
| 269 | 3300050516 | nmdc:mga0sz30_51433_c1 | nmdc:mga0sz30_51433_c1_492_917 | 135 |
| 270 | 3300053096 | Ga0500641_0293304 | Ga0500641_0293304_208_627 | 135 |
| 271 | 3300053098 | Ga0500650_0004219 | Ga0500650_0004219_1749_2162 | 135 |
| 272 | 3300053098 | Ga0500650_0082936 | Ga0500650_0082936_200_613 | 135 |
| 273 | 3300053103 | Ga0500555_159776 | Ga0500555_159776_119_538 | 135 |
| 274 | 3300053117 | Ga0500593_000429 | Ga0500593_000429_13293_13712 | 135 |
| 275 | 3300053153 | Ga0500616_0058639 | Ga0500616_0058639_556_981 | 135 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4z04-assembly1.cif.gz_A-2 | crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione | 0.8729 | 7 | 123 |
| 4qb5-assembly2.cif.gz_B | crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 | 0.8279 | 7 | 119 |
| 4z04-assembly1.cif.gz_A-2 | crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione | 0.8205 | 7 | 123 |
| 4qb5-assembly1.cif.gz_A | crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 | 0.7892 | 7 | 119 |
| 4qb5-assembly1.cif.gz_C | crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 | 0.7879 | 7 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4z04A00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8729 | 7 | 123 | 3.10.180.10 |
| 4z04A00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8205 | 7 | 123 | 3.10.180.10 |
| 2kjzB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8161 | 64 | 122 | 3.30.720.110 |
| af_P9WKQ3_98_165_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8054 | 64 | 126 | 3.30.720.110 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.7955 | 62 | 120 | 3.30.720.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A024E6D9-F1-model_v4 | Glyoxalase/bleomycin resistance protein/dioxygenase | 0.9742 | 64 | 121 |
|
| AF-A0A7W6HKI9-F1-model_v4 | Putative lactoylglutathione lyase | 0.9622 | 66 | 123 |
GO:0016829
|
| AF-A0A6L6HQF1-F1-model_v4 | VOC family protein | 0.9497 | 5 | 124 |
|
| AF-A0A2R5EWJ1-F1-model_v4 | Putative glyoxalase | 0.9418 | 65 | 119 |
|
| AF-A0A0U1HA84-F1-model_v4 | deleted | 0.9417 | 66 | 135 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar