F380742

General Info

Members Datasets Scaffolds Average Seq Length
275 201 266 135

Family's Representative Sequence

Representative Sequence 3300050496|nmdc:mga07m45_167899_c1|nmdc:mga07m45_167899_c1_341_778
Length 145
Sequence VRHRRALTIMQFHRGRLIDHVHLRVADLDASKRFYKAALEAVGLAHTLSEGPDHFSADELWVDRATGPVSQVHLAFQAADRAQVDRFHAAALAAGGRDNGAPGERPYHPGYYGAFVFDPDGNNVEAVFHGPSRKSAESVVVTPVA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
4 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
5 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
6 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
7 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
8 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
9 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
86 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
138 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
145 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
146 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
147 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
148 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
149 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
152 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
153 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
154 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
170 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
171 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
172 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
173 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
186 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
190 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
198 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
199 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
200 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
201 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.73
Metatranscriptomes 0
Isolates 3.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.73
Nodule 2.91
Rhizoplane 2.91
Rhizosphere 73.09
Stem 0
Stem Tuber 0
Unclassified 8.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10044705 3300003322 Bacteria 3459
2 rootH1_10269311 3300003323 Bacteria 1913
3 Ga0065704_10626300 3300005289 Bacteria 594
4 Ga0070658_10062932 3300005327 Bacteria 3024
5 Ga0070658_10320595 3300005327 Bacteria 1323
6 Ga0070676_10227035 3300005328 Bacteria 1236
7 Ga0070690_100139642 3300005330 Bacteria 1644
8 Ga0070670_100028593 3300005331 Bacteria 4797
9 Ga0070677_10000682 3300005333 Bacteria 11360
10 Ga0068869_100034316 3300005334 Bacteria 3588
11 Ga0070666_10005985 3300005335 Bacteria 7472
12 Ga0070666_10101397 3300005335 Bacteria 1984
13 Ga0068868_100012860 3300005338 Bacteria 6122
14 Ga0068868_100528900 3300005338 Bacteria 1036
15 Ga0068868_100565259 3300005338 Bacteria 1004
16 Ga0070660_100009325 3300005339 Bacteria 6896
17 Ga0070689_100372002 3300005340 Bacteria 1203
18 Ga0070687_100509615 3300005343 Unclassified 811
19 Ga0070661_100371963 3300005344 Bacteria 1125
20 Ga0070668_100010119 3300005347 Bacteria 6991
21 Ga0070675_100000542 3300005354 Bacteria 25851
22 Ga0070671_100002141 3300005355 Bacteria 15246
23 Ga0070671_100014187 3300005355 Bacteria 6433
24 Ga0070671_100120138 3300005355 Bacteria 2211
25 Ga0070671_100466872 3300005355 Bacteria 1084
26 Ga0070674_100000170 3300005356 Bacteria 30382
27 Ga0070674_101184924 3300005356 Bacteria 677
28 Ga0070673_100000311 3300005364 Bacteria 25555
29 Ga0070673_100044142 3300005364 Bacteria 3450
30 Ga0070673_101862948 3300005364 Bacteria 570
31 Ga0070688_100131852 3300005365 Bacteria 1687
32 Ga0070688_100484925 3300005365 Bacteria 930
33 Ga0070667_100007642 3300005367 Bacteria 8967
34 Ga0070700_100264700 3300005441 Bacteria 1239
35 Ga0070663_100014379 3300005455 Bacteria 5080
36 Ga0070663_100141922 3300005455 Bacteria 1835
37 Ga0070663_100289904 3300005455 Bacteria 1307
38 Ga0070678_100002670 3300005456 Bacteria 9826
39 Ga0070678_100277450 3300005456 Bacteria 1416
40 Ga0070662_100021720 3300005457 Bacteria 4386
41 Ga0068867_100004392 3300005459 Bacteria 9919
42 Ga0068867_100418265 3300005459 Bacteria 1135
43 Ga0070685_10007184 3300005466 Bacteria 5690
44 Ga0070706_100001321 3300005467 Bacteria 26375
45 Ga0070699_100146456 3300005518 Bacteria 2087
46 Ga0070679_101792879 3300005530 Bacteria 562
47 Ga0068853_100009967 3300005539 Bacteria 7672
48 Ga0070672_100007534 3300005543 Bacteria 7394
49 Ga0070686_100731891 3300005544 Bacteria 792
50 Ga0070693_100103051 3300005547 Bacteria 1742
51 Ga0070693_100973832 3300005547 Bacteria 640
52 Ga0070665_100015150 3300005548 Bacteria 7740
53 Ga0070665_100075069 3300005548 Bacteria 3387
54 Ga0068855_100141043 3300005563 Bacteria 2747
55 Ga0070702_100611593 3300005615 Unclassified 818
56 Ga0068852_100045978 3300005616 Bacteria 3717
57 Ga0068852_101296946 3300005616 Bacteria 750
58 Ga0068859_100066920 3300005617 Bacteria 3628
59 Ga0068864_100023359 3300005618 Bacteria 5192
60 Ga0068861_100028192 3300005719 Bacteria 4097
61 Ga0068851_10001538 3300005834 Bacteria 10114
62 Ga0068870_10024215 3300005840 Bacteria 3002
63 Ga0068863_100090539 3300005841 Bacteria 2901
64 Ga0068860_100006251 3300005843 Bacteria 11963
65 Ga0068860_100146732 3300005843 Bacteria 2270
66 Ga0068862_100794494 3300005844 Bacteria 924
67 Ga0075368_10009791 3300006042 Bacteria 3455
68 Ga0075368_10095861 3300006042 Bacteria 1216
69 Ga0075363_100004085 3300006048 Bacteria 6324
70 Ga0075364_10088226 3300006051 Bacteria 2056
71 Ga0075362_10150205 3300006177 Bacteria 1117
72 Ga0075367_10093554 3300006178 Bacteria 1831
73 Ga0075367_10894937 3300006178 Bacteria 566
74 Ga0075369_10071991 3300006186 Bacteria 1522
75 Ga0075366_10002428 3300006195 Bacteria 9556
76 Ga0075366_10004870 3300006195 Bacteria 7242
77 Ga0075366_10050465 3300006195 Bacteria 2470
78 Ga0075366_10172488 3300006195 Bacteria 1312
79 Ga0097621_100006254 3300006237 Bacteria 8450
80 Ga0075370_10020391 3300006353 Bacteria 3622
81 Ga0075370_10057370 3300006353 Bacteria 2213
82 Ga0068871_100005270 3300006358 Bacteria 9052
83 Ga0075428_100190009 3300006844 Bacteria 2221
84 Ga0075431_100619813 3300006847 Bacteria 1064
85 Ga0068865_100010937 3300006881 Bacteria 5663
86 Ga0068865_100429675 3300006881 Bacteria 1088
87 Ga0097620_100066916 3300006931 Bacteria 3628
88 Ga0105241_10597277 3300009174 Bacteria 997
89 Ga0105241_12444297 3300009174 Bacteria 522
90 Ga0105242_12640172 3300009176 Bacteria 552
91 Ga0105248_10090307 3300009177 Bacteria 3449
92 Ga0105238_10443150 3300009551 Bacteria 1295
93 Ga0105249_10089276 3300009553 Bacteria 2880
94 Ga0105249_10376125 3300009553 Bacteria 1445
95 Ga0157374_10013263 3300013296 Bacteria 7191
96 Ga0157374_10413479 3300013296 Bacteria 1347
97 Ga0163162_10099043 3300013306 Bacteria 3005
98 Ga0157372_13367985 3300013307 Bacteria 509
99 Ga0157375_10000362 3300013308 Bacteria 41418
100 Ga0157375_12556550 3300013308 Bacteria 610
101 Ga0163163_10175505 3300014325 Bacteria 2189
102 Ga0157380_12081196 3300014326 Bacteria 630
103 Ga0157377_10068168 3300014745 Bacteria 2050
104 Ga0157377_10296849 3300014745 Bacteria 1065
105 Ga0157376_10004202 3300014969 Bacteria 9991
106 Ga0163161_10047640 3300017792 Bacteria 3094
107 Ga0214542_1015383 3300021321 Bacteria 8011
108 Ga0214543_1000003 3300021327 Bacteria 692327
109 Ga0209051_1002343 3300025303 Bacteria 13718
110 Ga0207697_10038093 3300025315 Bacteria 1971
111 Ga0207656_10008186 3300025321 Bacteria 3838
112 Ga0207682_10000122 3300025893 Bacteria 35790
113 Ga0207680_10046351 3300025903 Bacteria 2569
114 Ga0207645_10000063 3300025907 Bacteria 76658
115 Ga0207645_10126828 3300025907 Bacteria 1659
116 Ga0207643_10027098 3300025908 Bacteria 3176
117 Ga0207705_10042569 3300025909 Bacteria 3260
118 Ga0207705_10107832 3300025909 Bacteria 2055
119 Ga0207684_10008620 3300025910 Bacteria 9060
120 Ga0207657_10164263 3300025919 Bacteria 1802
121 Ga0207652_11603559 3300025921 Bacteria 555
122 Ga0207681_10092224 3300025923 Bacteria 2165
123 Ga0207694_10398497 3300025924 Bacteria 1144
124 Ga0207650_10572226 3300025925 Unclassified 948
125 Ga0207659_10028182 3300025926 Bacteria 3814
126 Ga0207659_10124637 3300025926 Bacteria 1979
127 Ga0207644_10007250 3300025931 Bacteria 7218
128 Ga0207644_10160065 3300025931 Bacteria 1749
129 Ga0207644_10211919 3300025931 Bacteria 1532
130 Ga0207644_10279354 3300025931 Bacteria 1340
131 Ga0207706_10000856 3300025933 Bacteria 31357
132 Ga0207706_10444172 3300025933 Bacteria 1122
133 Ga0207670_10449976 3300025936 Bacteria 1038
134 Ga0207669_10008578 3300025937 Bacteria 4807
135 Ga0207669_10024432 3300025937 Bacteria 3248
136 Ga0207704_10020907 3300025938 Bacteria 3474
137 Ga0207691_10000050 3300025940 Bacteria 94763
138 Ga0207711_10078862 3300025941 Bacteria 2874
139 Ga0207711_10084515 3300025941 Bacteria 2778
140 Ga0207689_10067815 3300025942 Bacteria 2931
141 Ga0207651_10087067 3300025960 Bacteria 2272
142 Ga0207651_10362682 3300025960 Bacteria 1223
143 Ga0207651_10459592 3300025960 Bacteria 1094
144 Ga0207712_10051923 3300025961 Bacteria 2869
145 Ga0207668_10027578 3300025972 Bacteria 3700
146 Ga0207668_11381723 3300025972 Bacteria 635
147 Ga0207640_10051314 3300025981 Bacteria 2681
148 Ga0207658_10012512 3300025986 Bacteria 5795
149 Ga0207677_10062012 3300026023 Bacteria 2592
150 Ga0207677_10500421 3300026023 Bacteria 1051
151 Ga0207677_11337433 3300026023 Bacteria 659
152 Ga0207639_10011464 3300026041 Bacteria 6158
153 Ga0207678_10001056 3300026067 Bacteria 25189
154 Ga0207678_10367613 3300026067 Bacteria 1242
155 Ga0207641_10557233 3300026088 Bacteria 1118
156 Ga0207641_10682594 3300026088 Unclassified 1010
157 Ga0207648_10004317 3300026089 Bacteria 14637
158 Ga0207648_10016800 3300026089 Bacteria 6673
159 Ga0207676_10026524 3300026095 Bacteria 4310
160 Ga0207676_10999883 3300026095 Bacteria 824
161 Ga0207676_11335953 3300026095 Bacteria 712
162 Ga0207675_100038658 3300026118 Bacteria 4452
163 Ga0207683_10000521 3300026121 Bacteria 35599
164 Ga0207683_10303238 3300026121 Bacteria 1461
165 Ga0207698_10022880 3300026142 Bacteria 4356
166 Ga0209813_10040230 3300027866 Bacteria 1420
167 Ga0268265_10251514 3300028380 Bacteria 1565
168 Ga0268264_10021324 3300028381 Bacteria 5290
169 Ga0268264_10121213 3300028381 Bacteria 2305
170 Ga0307517_10037458 3300028786 Bacteria 5415
171 Ga0307517_10067160 3300028786 Bacteria 3287
172 Ga0307515_10023794 3300028794 Bacteria 10711
173 Ga0307515_10083881 3300028794 Bacteria 4101
174 Ga0307512_10211131 3300030522 Bacteria 1032
175 Ga0307513_10000010 3300031456 Bacteria 360812
176 Ga0307513_10002513 3300031456 Bacteria 25362
177 Ga0307509_10003916 3300031507 Bacteria 21998
178 Ga0307509_10006677 3300031507 Bacteria 15393
179 Ga0307509_10194632 3300031507 Bacteria 1873
180 Ga0307508_10000028 3300031616 Bacteria 168639
181 Ga0307508_10044173 3300031616 Bacteria 3987
182 Ga0307508_10068996 3300031616 Bacteria 3105
183 Ga0307516_10534406 3300031730 Bacteria 826
184 Ga0307405_11886837 3300031731 Bacteria 533
185 Ga0307410_10094571 3300031852 Bacteria 2129
186 Ga0307415_100142973 3300032126 Bacteria 1830
187 Ga0307507_10030098 3300033179 Bacteria 5735
188 Ga0307510_10061923 3300033180 Bacteria 3829
189 Ga0307510_10095412 3300033180 Bacteria 2794
190 Ga0307510_10466743 3300033180 Bacteria 703
191 Ga0373953_0029981 3300035117 Bacteria 2107
192 Ga0373954_0030618 3300035118 Bacteria 2482
193 Ga0373931_0785376 3300035691 Bacteria 634
194 Ga0373931_0852441 3300035691 Bacteria 610
195 Ga0373937_0204435 3300036401 Bacteria 1857
196 Ga0395905_0004546 3300037471 Bacteria 14363
197 Ga0439438_081245 3300041405 Bacteria 795
198 Ga0439439_0131826 3300041406 Bacteria 702
199 Ga0451793_1027516 3300041452 Bacteria 710
200 Ga0451793_1409509 3300041452 Unclassified 549
201 Ga0451797_0128487 3300041453 Bacteria 1181
202 Ga0451843_1688711 3300041509 Bacteria 507
203 Ga0439432_147706 3300042006 Bacteria 690
204 Ga0439449_0042128 3300042007 Bacteria 1697
205 Ga0439462_0022250 3300042015 Bacteria 1658
206 Ga0439458_0087734 3300042157 Bacteria 798
207 Ga0439435_0008360 3300042436 Bacteria 2398
208 Ga0439460_0005650 3300042461 Bacteria 3079
209 Ga0453683_0433990 3300044673 Bacteria 849
210 Ga0466965_0020166 3300044683 Bacteria 3203
211 Ga0466964_0167231 3300044706 Bacteria 1033
212 Ga0451576_1023619 3300045051 Bacteria 865
213 Ga0451576_1036882 3300045051 Bacteria 859
214 Ga0466967_0041440 3300045976 Bacteria 3970
215 Ga0495629_0284313 3300046459 Bacteria 1134
216 Ga0495632_0091117 3300046519 Bacteria 1445
217 Ga0495632_0151273 3300046519 Bacteria 1073
218 Ga0495648_0390372 3300046524 Bacteria 625
219 Ga0495642_0415021 3300046528 Bacteria 594
220 Ga0495667_0557392 3300046559 Bacteria 716
221 Ga0495668_0096354 3300046616 Bacteria 1619
222 Ga0495611_0022340 3300046648 Bacteria 2737
223 Ga0495625_0035844 3300046660 Bacteria 3652
224 Ga0495625_0159283 3300046660 Bacteria 1513
225 Ga0495625_0186432 3300046660 Bacteria 1377
226 Ga0495625_0306254 3300046660 Bacteria 1015
227 Ga0495588_0281335 3300046674 Bacteria 877
228 Ga0495669_0112053 3300046684 Bacteria 1274
229 Ga0495660_0008420 3300046810 Bacteria 6037
230 Ga0495685_135657 3300047447 Bacteria 803
231 Ga0495673_0128048 3300047469 Bacteria 1000
232 Ga0495681_0099655 3300047470 Bacteria 1272
233 Ga0496100_1017597 3300048903 Bacteria 652
234 Ga0496108_1464445 3300048911 Bacteria 569
235 Ga0496109_0322177 3300048912 Bacteria 1459
236 Ga0496110_1198987 3300048913 Bacteria 668
237 Ga0501034_0420177 3300049571 Bacteria 1258
238 Ga0501037_1029719 3300049573 Bacteria 535
239 Ga0501039_0273856 3300049575 Bacteria 1327
240 Ga0501069_0095665 3300049585 Bacteria 1682
241 Ga0501070_0118209 3300049586 Bacteria 2190
242 Ga0501199_058596 3300049650 Bacteria 533
243 Ga0501035_0125450 3300049822 Bacteria 2241
244 nmdc:mga03683_699657_c1 3300050489 Bacteria 502
245 nmdc:mga03n38_324130_c1 3300050490 Bacteria 833
246 nmdc:mga0yw44_57559_c1 3300050492 Bacteria 2372
247 nmdc:mga0k408_1288_c1 3300050493 Bacteria 13596
248 nmdc:mga0k408_13507_c1 3300050493 Bacteria 4481
249 nmdc:mga0k408_752781_c1 3300050493 Bacteria 569
250 nmdc:mga0k408_790878_c1 3300050493 Bacteria 553
251 nmdc:mga0k408_90534_c1 3300050493 Bacteria 1796
252 nmdc:mga06z11_304834_c1 3300050494 Bacteria 948
253 nmdc:mga04h51_45650_c1 3300050495 Bacteria 1450
254 nmdc:mga07m45_167899_c1 3300050496 Bacteria 1275
255 nmdc:mga07m45_739885_c1 3300050496 Bacteria 565
256 nmdc:mga09592_308080_c1 3300050508 Bacteria 1373
257 nmdc:mga0qj67_112928_c1 3300050509 Bacteria 2194
258 nmdc:mga0n895_1959903_c1 3300050512 Unclassified 544
259 nmdc:mga0sz30_51433_c1 3300050516 Bacteria 1747
260 Ga0495619_0365026 3300053085 Bacteria 998
261 Ga0500641_0293304 3300053096 Bacteria 670
262 Ga0500650_0004219 3300053098 Bacteria 5162
263 Ga0500650_0082936 3300053098 Bacteria 1499
264 Ga0500555_159776 3300053103 Bacteria 550
265 Ga0500593_000429 3300053117 Bacteria 16647
266 Ga0500616_0058639 3300053153 Bacteria 2002

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005843 Ga0068860_100146732 Ga0068860_1001467321 113
2 3300028381 Ga0268264_10121213 Ga0268264_101212133 113
3 3300005455 Ga0070663_100141922 Ga0070663_1001419221 115
4 3300045051 Ga0451576_1023619 Ga0451576_1023619_122_490 115
5 3300049571 Ga0501034_0420177 Ga0501034_0420177_747_1133 115
6 3300049573 Ga0501037_1029719 Ga0501037_1029719_18_401 115
7 3300049575 Ga0501039_0273856 Ga0501039_0273856_619_1005 115
8 3300049585 Ga0501069_0095665 Ga0501069_0095665_524_907 115
9 3300049586 Ga0501070_0118209 Ga0501070_0118209_1164_1547 115
10 3300049822 Ga0501035_0125450 Ga0501035_0125450_193_576 115
11 3300050512 nmdc:mga0n895_1959903_c1 nmdc:mga0n895_1959903_c1_108_476 115
12 3300009553 Ga0105249_10089276 Ga0105249_100892763 116
13 3300025961 Ga0207712_10051923 Ga0207712_100519233 116
14 3300031852 Ga0307410_10094571 Ga0307410_100945712 116
15 3300032126 Ga0307415_100142973 Ga0307415_1001429733 116
16 3300026095 Ga0207676_10999883 Ga0207676_109998832 117
17 3300042436 Ga0439435_0008360 Ga0439435_0008360_1614_2015 117
18 3300049650 Ga0501199_058596 Ga0501199_058596_12_386 117
19 3300005327 Ga0070658_10320595 Ga0070658_103205951 118
20 3300005339 Ga0070660_100009325 Ga0070660_1000093255 118
21 3300005455 Ga0070663_100289904 Ga0070663_1002899042 118
22 3300005530 Ga0070679_101792879 Ga0070679_1017928792 118
23 3300005563 Ga0068855_100141043 Ga0068855_1001410434 118
24 3300025909 Ga0207705_10042569 Ga0207705_100425692 118
25 3300025919 Ga0207657_10164263 Ga0207657_101642634 118
26 3300025921 Ga0207652_11603559 Ga0207652_116035592 118
27 3300026067 Ga0207678_10367613 Ga0207678_103676132 118
28 3300041452 Ga0451793_1409509 Ga0451793_1409509_171_539 119
29 3300035691 Ga0373931_0785376 Ga0373931_0785376_45_431 122
30 3300044673 Ga0453683_0433990 Ga0453683_0433990_238_624 122
31 3300045051 Ga0451576_1036882 Ga0451576_1036882_372_758 122
32 3300047469 Ga0495673_0128048 Ga0495673_0128048_148_522 122
33 3300009174 Ga0105241_12444297 Ga0105241_124442971 123
34 3300041453 Ga0451797_0128487 Ga0451797_0128487_555_932 124
35 3300050496 nmdc:mga07m45_739885_c1 nmdc:mga07m45_739885_c1_168_545 124
36 3300048912 Ga0496109_0322177 Ga0496109_0322177_605_1009 127
37 iso_pu_bacteria 2599185236 2599723633 128
38 iso_pu_bacteria 2508501122 2509107399 130
39 iso_pu_bacteria 2509276019 2509374610 130
40 iso_pu_bacteria 2558860100 2558863638 130
41 iso_pu_bacteria 2751185821 2753462964 130
42 iso_pu_bacteria 2791355091 2792622182 130
43 iso_pu_bacteria 2791355092 2792628253 130
44 iso_pu_bacteria 2791355094 2792638489 130
45 iso_pu_bacteria 2850079185 2850080322 130
46 3300005344 Ga0070661_100371963 Ga0070661_1003719631 132
47 3300005355 Ga0070671_100014187 Ga0070671_1000141878 132
48 3300005548 Ga0070665_100075069 Ga0070665_1000750694 132
49 3300014745 Ga0157377_10296849 Ga0157377_102968492 132
50 3300025931 Ga0207644_10279354 Ga0207644_102793542 132
51 3300026095 Ga0207676_11335953 Ga0207676_113359532 132
52 3300028786 Ga0307517_10037458 Ga0307517_100374584 132
53 3300046616 Ga0495668_0096354 Ga0495668_0096354_62_460 132
54 3300046648 Ga0495611_0022340 Ga0495611_0022340_2320_2718 132
55 3300046660 Ga0495625_0035844 Ga0495625_0035844_1444_1842 132
56 3300046660 Ga0495625_0306254 Ga0495625_0306254_351_749 132
57 3300046684 Ga0495669_0112053 Ga0495669_0112053_164_562 132
58 3300047447 Ga0495685_135657 Ga0495685_135657_10_408 132
59 3300047470 Ga0495681_0099655 Ga0495681_0099655_570_968 132
60 3300005328 Ga0070676_10227035 Ga0070676_102270352 133
61 3300005330 Ga0070690_100139642 Ga0070690_1001396422 133
62 3300005338 Ga0068868_100565259 Ga0068868_1005652592 133
63 3300005340 Ga0070689_100372002 Ga0070689_1003720022 133
64 3300005356 Ga0070674_101184924 Ga0070674_1011849242 133
65 3300005364 Ga0070673_100044142 Ga0070673_1000441422 133
66 3300005365 Ga0070688_100484925 Ga0070688_1004849252 133
67 3300005441 Ga0070700_100264700 Ga0070700_1002647002 133
68 3300005456 Ga0070678_100277450 Ga0070678_1002774502 133
69 3300005459 Ga0068867_100418265 Ga0068867_1004182652 133
70 3300005544 Ga0070686_100731891 Ga0070686_1007318912 133
71 3300005616 Ga0068852_101296946 Ga0068852_1012969462 133
72 3300006881 Ga0068865_100429675 Ga0068865_1004296752 133
73 3300014326 Ga0157380_12081196 Ga0157380_120811961 133
74 3300025907 Ga0207645_10126828 Ga0207645_101268282 133
75 3300025924 Ga0207694_10398497 Ga0207694_103984972 133
76 3300025926 Ga0207659_10124637 Ga0207659_101246372 133
77 3300025933 Ga0207706_10444172 Ga0207706_104441722 133
78 3300025936 Ga0207670_10449976 Ga0207670_104499762 133
79 3300025937 Ga0207669_10024432 Ga0207669_100244324 133
80 3300025960 Ga0207651_10362682 Ga0207651_103626822 133
81 3300025981 Ga0207640_10051314 Ga0207640_100513142 133
82 3300026023 Ga0207677_10500421 Ga0207677_105004212 133
83 3300026089 Ga0207648_10016800 Ga0207648_100168002 133
84 3300026121 Ga0207683_10303238 Ga0207683_103032382 133
85 3300046519 Ga0495632_0151273 Ga0495632_0151273_508_912 133
86 3300046810 Ga0495660_0008420 Ga0495660_0008420_589_993 133
87 3300005335 Ga0070666_10101397 Ga0070666_101013971 134
88 3300005338 Ga0068868_100528900 Ga0068868_1005289002 134
89 3300005355 Ga0070671_100120138 Ga0070671_1001201381 134
90 3300005355 Ga0070671_100466872 Ga0070671_1004668722 134
91 3300005364 Ga0070673_101862948 Ga0070673_1018629481 134
92 3300005547 Ga0070693_100103051 Ga0070693_1001030513 134
93 3300013296 Ga0157374_10413479 Ga0157374_104134792 134
94 3300013308 Ga0157375_12556550 Ga0157375_125565501 134
95 3300021321 Ga0214542_1015383 Ga0214542_10153837 134
96 3300021327 Ga0214543_1000003 Ga0214543_1000003322 134
97 3300025931 Ga0207644_10160065 Ga0207644_101600653 134
98 3300025931 Ga0207644_10211919 Ga0207644_102119192 134
99 3300025941 Ga0207711_10078862 Ga0207711_100788622 134
100 3300025960 Ga0207651_10459592 Ga0207651_104595922 134
101 3300026023 Ga0207677_11337433 Ga0207677_113374331 134
102 3300031731 Ga0307405_11886837 Ga0307405_118868371 134
103 3300035117 Ga0373953_0029981 Ga0373953_0029981_920_1333 134
104 3300035118 Ga0373954_0030618 Ga0373954_0030618_1105_1518 134
105 3300036401 Ga0373937_0204435 Ga0373937_0204435_688_1101 134
106 3300041405 Ga0439438_081245 Ga0439438_081245_124_534 134
107 3300041406 Ga0439439_0131826 Ga0439439_0131826_104_514 134
108 3300041509 Ga0451843_1688711 Ga0451843_1688711_70_483 134
109 3300042006 Ga0439432_147706 Ga0439432_147706_138_548 134
110 3300042007 Ga0439449_0042128 Ga0439449_0042128_290_700 134
111 3300042015 Ga0439462_0022250 Ga0439462_0022250_549_959 134
112 3300046459 Ga0495629_0284313 Ga0495629_0284313_673_1086 134
113 3300046559 Ga0495667_0557392 Ga0495667_0557392_37_450 134
114 3300048903 Ga0496100_1017597 Ga0496100_1017597_201_614 134
115 3300053085 Ga0495619_0365026 Ga0495619_0365026_64_477 134
116 3300003322 rootL2_10044705 rootL2_100447056 135
117 3300003323 rootH1_10269311 rootH1_102693112 135
118 3300005289 Ga0065704_10626300 Ga0065704_106263001 135
119 3300005327 Ga0070658_10062932 Ga0070658_100629325 135
120 3300005331 Ga0070670_100028593 Ga0070670_10002859310 135
121 3300005333 Ga0070677_10000682 Ga0070677_1000068216 135
122 3300005334 Ga0068869_100034316 Ga0068869_1000343168 135
123 3300005335 Ga0070666_10005985 Ga0070666_100059856 135
124 3300005338 Ga0068868_100012860 Ga0068868_10001286011 135
125 3300005343 Ga0070687_100509615 Ga0070687_1005096152 135
126 3300005347 Ga0070668_100010119 Ga0070668_1000101196 135
127 3300005354 Ga0070675_100000542 Ga0070675_10000054248 135
128 3300005355 Ga0070671_100002141 Ga0070671_1000021418 135
129 3300005356 Ga0070674_100000170 Ga0070674_10000017027 135
130 3300005364 Ga0070673_100000311 Ga0070673_1000003118 135
131 3300005365 Ga0070688_100131852 Ga0070688_1001318522 135
132 3300005367 Ga0070667_100007642 Ga0070667_1000076423 135
133 3300005455 Ga0070663_100014379 Ga0070663_1000143797 135
134 3300005456 Ga0070678_100002670 Ga0070678_1000026706 135
135 3300005457 Ga0070662_100021720 Ga0070662_1000217202 135
136 3300005459 Ga0068867_100004392 Ga0068867_10000439215 135
137 3300005466 Ga0070685_10007184 Ga0070685_100071849 135
138 3300005467 Ga0070706_100001321 Ga0070706_10000132125 135
139 3300005518 Ga0070699_100146456 Ga0070699_1001464564 135
140 3300005539 Ga0068853_100009967 Ga0068853_1000099677 135
141 3300005543 Ga0070672_100007534 Ga0070672_10000753411 135
142 3300005547 Ga0070693_100973832 Ga0070693_1009738321 135
143 3300005548 Ga0070665_100015150 Ga0070665_1000151507 135
144 3300005615 Ga0070702_100611593 Ga0070702_1006115931 135
145 3300005616 Ga0068852_100045978 Ga0068852_1000459783 135
146 3300005617 Ga0068859_100066920 Ga0068859_1000669202 135
147 3300005618 Ga0068864_100023359 Ga0068864_1000233597 135
148 3300005719 Ga0068861_100028192 Ga0068861_1000281925 135
149 3300005834 Ga0068851_10001538 Ga0068851_100015387 135
150 3300005840 Ga0068870_10024215 Ga0068870_100242155 135
151 3300005841 Ga0068863_100090539 Ga0068863_1000905397 135
152 3300005843 Ga0068860_100006251 Ga0068860_10000625123 135
153 3300005844 Ga0068862_100794494 Ga0068862_1007944942 135
154 3300006042 Ga0075368_10009791 Ga0075368_100097913 135
155 3300006042 Ga0075368_10095861 Ga0075368_100958613 135
156 3300006048 Ga0075363_100004085 Ga0075363_1000040852 135
157 3300006051 Ga0075364_10088226 Ga0075364_100882262 135
158 3300006177 Ga0075362_10150205 Ga0075362_101502052 135
159 3300006178 Ga0075367_10093554 Ga0075367_100935542 135
160 3300006178 Ga0075367_10894937 Ga0075367_108949371 135
161 3300006186 Ga0075369_10071991 Ga0075369_100719912 135
162 3300006195 Ga0075366_10002428 Ga0075366_100024287 135
163 3300006195 Ga0075366_10004870 Ga0075366_100048707 135
164 3300006195 Ga0075366_10050465 Ga0075366_100504652 135
165 3300006195 Ga0075366_10172488 Ga0075366_101724883 135
166 3300006237 Ga0097621_100006254 Ga0097621_1000062544 135
167 3300006353 Ga0075370_10020391 Ga0075370_100203916 135
168 3300006353 Ga0075370_10057370 Ga0075370_100573702 135
169 3300006358 Ga0068871_100005270 Ga0068871_10000527015 135
170 3300006844 Ga0075428_100190009 Ga0075428_1001900093 135
171 3300006847 Ga0075431_100619813 Ga0075431_1006198132 135
172 3300006881 Ga0068865_100010937 Ga0068865_1000109377 135
173 3300006931 Ga0097620_100066916 Ga0097620_1000669162 135
174 3300009174 Ga0105241_10597277 Ga0105241_105972772 135
175 3300009176 Ga0105242_12640172 Ga0105242_126401722 135
176 3300009177 Ga0105248_10090307 Ga0105248_100903073 135
177 3300009551 Ga0105238_10443150 Ga0105238_104431502 135
178 3300009553 Ga0105249_10376125 Ga0105249_103761252 135
179 3300013296 Ga0157374_10013263 Ga0157374_1001326310 135
180 3300013306 Ga0163162_10099043 Ga0163162_100990432 135
181 3300013307 Ga0157372_13367985 Ga0157372_133679851 135
182 3300013308 Ga0157375_10000362 Ga0157375_1000036227 135
183 3300014325 Ga0163163_10175505 Ga0163163_101755053 135
184 3300014745 Ga0157377_10068168 Ga0157377_100681682 135
185 3300014969 Ga0157376_10004202 Ga0157376_1000420216 135
186 3300017792 Ga0163161_10047640 Ga0163161_100476406 135
187 3300025303 Ga0209051_1002343 Ga0209051_100234316 135
188 3300025315 Ga0207697_10038093 Ga0207697_100380933 135
189 3300025321 Ga0207656_10008186 Ga0207656_100081867 135
190 3300025893 Ga0207682_10000122 Ga0207682_1000012212 135
191 3300025903 Ga0207680_10046351 Ga0207680_100463516 135
192 3300025907 Ga0207645_10000063 Ga0207645_1000006382 135
193 3300025908 Ga0207643_10027098 Ga0207643_100270985 135
194 3300025909 Ga0207705_10107832 Ga0207705_101078323 135
195 3300025910 Ga0207684_10008620 Ga0207684_1000862010 135
196 3300025923 Ga0207681_10092224 Ga0207681_100922243 135
197 3300025925 Ga0207650_10572226 Ga0207650_105722262 135
198 3300025926 Ga0207659_10028182 Ga0207659_100281824 135
199 3300025931 Ga0207644_10007250 Ga0207644_100072506 135
200 3300025933 Ga0207706_10000856 Ga0207706_1000085632 135
201 3300025937 Ga0207669_10008578 Ga0207669_1000857810 135
202 3300025938 Ga0207704_10020907 Ga0207704_100209072 135
203 3300025940 Ga0207691_10000050 Ga0207691_10000050121 135
204 3300025941 Ga0207711_10084515 Ga0207711_100845155 135
205 3300025942 Ga0207689_10067815 Ga0207689_100678153 135
206 3300025960 Ga0207651_10087067 Ga0207651_100870674 135
207 3300025972 Ga0207668_10027578 Ga0207668_100275784 135
208 3300025972 Ga0207668_11381723 Ga0207668_113817231 135
209 3300025986 Ga0207658_10012512 Ga0207658_1001251210 135
210 3300026023 Ga0207677_10062012 Ga0207677_100620126 135
211 3300026041 Ga0207639_10011464 Ga0207639_100114648 135
212 3300026067 Ga0207678_10001056 Ga0207678_1000105627 135
213 3300026088 Ga0207641_10557233 Ga0207641_105572331 135
214 3300026088 Ga0207641_10682594 Ga0207641_106825942 135
215 3300026089 Ga0207648_10004317 Ga0207648_1000431730 135
216 3300026095 Ga0207676_10026524 Ga0207676_100265246 135
217 3300026118 Ga0207675_100038658 Ga0207675_1000386586 135
218 3300026121 Ga0207683_10000521 Ga0207683_1000052160 135
219 3300026142 Ga0207698_10022880 Ga0207698_100228808 135
220 3300027866 Ga0209813_10040230 Ga0209813_100402302 135
221 3300028380 Ga0268265_10251514 Ga0268265_102515142 135
222 3300028381 Ga0268264_10021324 Ga0268264_100213247 135
223 3300028786 Ga0307517_10067160 Ga0307517_100671603 135
224 3300028794 Ga0307515_10023794 Ga0307515_1002379415 135
225 3300028794 Ga0307515_10083881 Ga0307515_100838813 135
226 3300030522 Ga0307512_10211131 Ga0307512_102111313 135
227 3300031456 Ga0307513_10000010 Ga0307513_10000010201 135
228 3300031456 Ga0307513_10002513 Ga0307513_1000251320 135
229 3300031507 Ga0307509_10003916 Ga0307509_1000391611 135
230 3300031507 Ga0307509_10006677 Ga0307509_100066779 135
231 3300031507 Ga0307509_10194632 Ga0307509_101946324 135
232 3300031616 Ga0307508_10000028 Ga0307508_1000002814 135
233 3300031616 Ga0307508_10044173 Ga0307508_100441736 135
234 3300031616 Ga0307508_10068996 Ga0307508_100689962 135
235 3300031730 Ga0307516_10534406 Ga0307516_105344062 135
236 3300033179 Ga0307507_10030098 Ga0307507_100300986 135
237 3300033180 Ga0307510_10061923 Ga0307510_100619237 135
238 3300033180 Ga0307510_10095412 Ga0307510_100954123 135
239 3300033180 Ga0307510_10466743 Ga0307510_104667432 135
240 3300035691 Ga0373931_0852441 Ga0373931_0852441_180_593 135
241 3300037471 Ga0395905_0004546 Ga0395905_0004546_12988_13398 135
242 3300041452 Ga0451793_1027516 Ga0451793_1027516_141_554 135
243 3300042157 Ga0439458_0087734 Ga0439458_0087734_334_741 135
244 3300042461 Ga0439460_0005650 Ga0439460_0005650_2291_2704 135
245 3300044683 Ga0466965_0020166 Ga0466965_0020166_2138_2560 135
246 3300044706 Ga0466964_0167231 Ga0466964_0167231_500_922 135
247 3300045976 Ga0466967_0041440 Ga0466967_0041440_453_869 135
248 3300046519 Ga0495632_0091117 Ga0495632_0091117_837_1250 135
249 3300046524 Ga0495648_0390372 Ga0495648_0390372_23_436 135
250 3300046528 Ga0495642_0415021 Ga0495642_0415021_101_514 135
251 3300046660 Ga0495625_0159283 Ga0495625_0159283_452_865 135
252 3300046660 Ga0495625_0186432 Ga0495625_0186432_541_954 135
253 3300046674 Ga0495588_0281335 Ga0495588_0281335_391_801 135
254 3300048911 Ga0496108_1464445 Ga0496108_1464445_64_474 135
255 3300048913 Ga0496110_1198987 Ga0496110_1198987_240_653 135
256 3300050489 nmdc:mga03683_699657_c1 nmdc:mga03683_699657_c1_66_485 135
257 3300050490 nmdc:mga03n38_324130_c1 nmdc:mga03n38_324130_c1_246_665 135
258 3300050492 nmdc:mga0yw44_57559_c1 nmdc:mga0yw44_57559_c1_1307_1726 135
259 3300050493 nmdc:mga0k408_1288_c1 nmdc:mga0k408_1288_c1_8930_9340 135
260 3300050493 nmdc:mga0k408_13507_c1 nmdc:mga0k408_13507_c1_3234_3653 135
261 3300050493 nmdc:mga0k408_752781_c1 nmdc:mga0k408_752781_c1_144_557 135
262 3300050493 nmdc:mga0k408_790878_c1 nmdc:mga0k408_790878_c1_10_420 135
263 3300050493 nmdc:mga0k408_90534_c1 nmdc:mga0k408_90534_c1_433_852 135
264 3300050494 nmdc:mga06z11_304834_c1 nmdc:mga06z11_304834_c1_166_585 135
265 3300050495 nmdc:mga04h51_45650_c1 nmdc:mga04h51_45650_c1_305_724 135
266 3300050496 nmdc:mga07m45_167899_c1 nmdc:mga07m45_167899_c1_341_778 135
267 3300050508 nmdc:mga09592_308080_c1 nmdc:mga09592_308080_c1_844_1257 135
268 3300050509 nmdc:mga0qj67_112928_c1 nmdc:mga0qj67_112928_c1_951_1364 135
269 3300050516 nmdc:mga0sz30_51433_c1 nmdc:mga0sz30_51433_c1_492_917 135
270 3300053096 Ga0500641_0293304 Ga0500641_0293304_208_627 135
271 3300053098 Ga0500650_0004219 Ga0500650_0004219_1749_2162 135
272 3300053098 Ga0500650_0082936 Ga0500650_0082936_200_613 135
273 3300053103 Ga0500555_159776 Ga0500555_159776_119_538 135
274 3300053117 Ga0500593_000429 Ga0500593_000429_13293_13712 135
275 3300053153 Ga0500616_0058639 Ga0500616_0058639_556_981 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

17

126

0.89

PF18029

Glyoxalase_6

Glyoxalase-like domain

20

127

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.8729 7 123
4qb5-assembly2.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8279 7 119
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.8205 7 123
4qb5-assembly1.cif.gz_A crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.7892 7 119
4qb5-assembly1.cif.gz_C crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.7879 7 119
ID Description Score Start End Superfamily
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8729 7 123 3.10.180.10
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8205 7 123 3.10.180.10
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8161 64 122 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8054 64 126 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7955 62 120 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A024E6D9-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9742 64 121
AF-A0A7W6HKI9-F1-model_v4 Putative lactoylglutathione lyase 0.9622 66 123 GO:0016829
AF-A0A6L6HQF1-F1-model_v4 VOC family protein 0.9497 5 124
AF-A0A2R5EWJ1-F1-model_v4 Putative glyoxalase 0.9418 65 119
AF-A0A0U1HA84-F1-model_v4 deleted 0.9417 66 135

Feature Viewer

pLDDT pTM Quality
90.52 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map