F380706
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 275 | 174 | 240 | 312 |
Family's Representative Sequence
| Representative Sequence | 3300049573|Ga0501037_0027464|Ga0501037_0027464_2623_3639 |
| Length | 338 |
| Sequence | MSRMTARRGASAIGTVALVAGAASAGALIWGTLIERRWYALRQVSAPVLPSGSRPIRVLHLSDLHMAPWQRDKQEWIRSLAAYAPDLIVDTGDNLGHERGFDGVKHALDAFKGVPGVFVNGSNDYYGPIPKNPMRYFSGPSTLHAKPSNLDTGELTGYFANELGWLDLNNHAGALTVNGTRLELFGVDDPHRNFDRLDTVTGELDELRASDETDDGWRDGGRDSRPAATVAIGVAHAPYRRILDSFVTNGASMIFAGHTHGGQVCVPGFGALVTNCDLPRGQAKGLSTWTHALRVAYLNVSAGLGTSIYSPVRFACRPEASLVTLVPHDTPFDGANVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 2 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 3 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 4 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 5 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 6 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 7 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 8 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 9 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 10 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 11 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 12 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 13 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 14 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 15 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 16 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 17 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 18 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 19 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 20 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 21 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 22 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 23 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 24 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 25 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 26 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 27 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 28 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 29 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 30 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 31 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 32 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 33 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 34 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 35 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 36 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 37 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 38 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 39 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 40 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 44 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 45 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 46 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 112 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 113 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 114 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 115 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 116 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 117 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 118 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 119 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 120 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 121 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 122 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 123 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 124 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 125 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 126 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 127 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 128 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 132 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 133 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 134 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 135 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 136 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 137 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 138 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 139 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 140 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 141 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 142 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 143 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 144 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 166 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 167 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 168 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 169 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 170 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 171 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 172 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 173 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 174 | 8002811521 | Leucobacter chinensis NC76-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.18 |
| Metatranscriptomes | 1.09 |
| Isolates | 12.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.36 |
| Nodule | 0 |
| Rhizoplane | 1.45 |
| Rhizosphere | 70.91 |
| Stem | 0 |
| Stem Tuber | 0.36 |
| Unclassified | 14.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10017743 | 3300002067 | Bacteria | 2200 |
| 2 | JGI25165J46597_1000148 | 3300003214 | Bacteria | 116003 |
| 3 | rootH2_10033049 | 3300003320 | Bacteria | 3030 |
| 4 | rootL2_10011039 | 3300003322 | Bacteria | 14496 |
| 5 | Ga0006562J51391_1027147 | 3300003578 | Bacteria | 3676 |
| 6 | Ga0006562J51391_1027151 | 3300003578 | Bacteria | 1600 |
| 7 | Ga0055539_1000103 | 3300003752 | Bacteria | 96081 |
| 8 | Ga0055533_1000020 | 3300003756 | Bacteria | 353998 |
| 9 | Ga0055525_1000235 | 3300003759 | Bacteria | 57710 |
| 10 | Ga0055527_1000003 | 3300003760 | Bacteria | 705001 |
| 11 | Ga0055542_1000066 | 3300003762 | Bacteria | 154802 |
| 12 | Ga0055529_1000006 | 3300003763 | Bacteria | 416978 |
| 13 | Ga0070658_10010239 | 3300005327 | Bacteria | 7519 |
| 14 | Ga0070658_10414757 | 3300005327 | Bacteria | 1158 |
| 15 | Ga0068868_100051492 | 3300005338 | Bacteria | 3240 |
| 16 | Ga0070660_100045710 | 3300005339 | Bacteria | 3353 |
| 17 | Ga0070659_100000468 | 3300005366 | Bacteria | 29797 |
| 18 | Ga0070667_100019700 | 3300005367 | Bacteria | 5596 |
| 19 | Ga0070667_100075126 | 3300005367 | Bacteria | 2885 |
| 20 | Ga0070714_100335512 | 3300005435 | Bacteria | 1417 |
| 21 | Ga0070663_100105259 | 3300005455 | Bacteria | 2112 |
| 22 | Ga0070672_100137886 | 3300005543 | Bacteria | 2010 |
| 23 | Ga0068855_100033650 | 3300005563 | Bacteria | 6115 |
| 24 | Ga0068855_100180903 | 3300005563 | Bacteria | 2383 |
| 25 | Ga0068856_100072070 | 3300005614 | Bacteria | 3421 |
| 26 | Ga0068856_100497812 | 3300005614 | Bacteria | 1239 |
| 27 | Ga0068852_100008145 | 3300005616 | Bacteria | 7697 |
| 28 | Ga0068852_100031456 | 3300005616 | Bacteria | 4379 |
| 29 | Ga0068852_100249720 | 3300005616 | Bacteria | 1699 |
| 30 | Ga0068864_100158533 | 3300005618 | Bacteria | 2056 |
| 31 | Ga0068851_10000001 | 3300005834 | Bacteria | 495512 |
| 32 | Ga0068858_100000016 | 3300005842 | Bacteria | 193130 |
| 33 | Ga0105244_10098007 | 3300009036 | Bacteria | 1436 |
| 34 | Ga0105240_10021811 | 3300009093 | Bacteria | 8511 |
| 35 | Ga0105240_10410941 | 3300009093 | Bacteria | 1522 |
| 36 | Ga0105245_10008524 | 3300009098 | Bacteria | 8943 |
| 37 | Ga0105245_10020653 | 3300009098 | Bacteria | 5775 |
| 38 | Ga0105241_10000615 | 3300009174 | Bacteria | 26776 |
| 39 | Ga0105248_10000366 | 3300009177 | Bacteria | 52614 |
| 40 | Ga0105248_10028025 | 3300009177 | Bacteria | 6274 |
| 41 | Ga0105237_10013055 | 3300009545 | Bacteria | 8722 |
| 42 | Ga0105237_10218636 | 3300009545 | Bacteria | 1905 |
| 43 | Ga0105238_10002701 | 3300009551 | Bacteria | 17645 |
| 44 | Ga0105238_10040810 | 3300009551 | Bacteria | 4701 |
| 45 | Ga0105239_10070284 | 3300010375 | Bacteria | 3845 |
| 46 | Ga0105239_10076243 | 3300010375 | Bacteria | 3687 |
| 47 | Ga0157371_10138252 | 3300013102 | Bacteria | 1735 |
| 48 | Ga0157370_10339201 | 3300013104 | Bacteria | 1385 |
| 49 | Ga0157369_10079219 | 3300013105 | Bacteria | 3519 |
| 50 | Ga0157369_10442079 | 3300013105 | Bacteria | 1347 |
| 51 | Ga0157374_10021634 | 3300013296 | Bacteria | 5727 |
| 52 | Ga0157374_10282153 | 3300013296 | Bacteria | 1640 |
| 53 | Ga0163163_10159391 | 3300014325 | Bacteria | 2301 |
| 54 | Ga0157380_10012969 | 3300014326 | Bacteria | 6058 |
| 55 | Ga0157379_10023468 | 3300014968 | Bacteria | 5475 |
| 56 | Ga0206353_11064217 | 3300020082 | Bacteria | 2305 |
| 57 | Ga0209566_100043 | 3300025225 | Bacteria | 266609 |
| 58 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 59 | Ga0209672_100003 | 3300025228 | Bacteria | 1560476 |
| 60 | Ga0209147_101011 | 3300025229 | Bacteria | 12064 |
| 61 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 62 | Ga0209563_103221 | 3300025230 | Bacteria | 3436 |
| 63 | Ga0207427_100039 | 3300025231 | Bacteria | 291576 |
| 64 | Ga0209437_100397 | 3300025233 | Bacteria | 40909 |
| 65 | Ga0209258_105492 | 3300025242 | Bacteria | 2133 |
| 66 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 67 | Ga0209677_100788 | 3300025253 | Bacteria | 15939 |
| 68 | Ga0209148_1000004 | 3300025254 | Bacteria | 1844481 |
| 69 | Ga0209148_1001296 | 3300025254 | Bacteria | 13504 |
| 70 | Ga0209148_1009261 | 3300025254 | Bacteria | 1928 |
| 71 | Ga0209233_1000014 | 3300025261 | Bacteria | 996641 |
| 72 | Ga0209455_1000046 | 3300025272 | Bacteria | 382681 |
| 73 | Ga0209455_1008813 | 3300025272 | Bacteria | 2704 |
| 74 | Ga0207656_10000005 | 3300025321 | Bacteria | 490514 |
| 75 | Ga0207680_10112661 | 3300025903 | Bacteria | 1767 |
| 76 | Ga0207647_10128130 | 3300025904 | Bacteria | 1493 |
| 77 | Ga0207647_10156028 | 3300025904 | Bacteria | 1333 |
| 78 | Ga0207705_10015318 | 3300025909 | Bacteria | 5502 |
| 79 | Ga0207705_10314788 | 3300025909 | Bacteria | 1202 |
| 80 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 81 | Ga0207695_10003316 | 3300025913 | Bacteria | 22816 |
| 82 | Ga0207671_10000016 | 3300025914 | Bacteria | 435413 |
| 83 | Ga0207671_10032196 | 3300025914 | Bacteria | 3903 |
| 84 | Ga0207657_10007209 | 3300025919 | Bacteria | 11416 |
| 85 | Ga0207694_10000022 | 3300025924 | Bacteria | 288900 |
| 86 | Ga0207694_10133974 | 3300025924 | Bacteria | 1988 |
| 87 | Ga0207659_10307725 | 3300025926 | Bacteria | 1304 |
| 88 | Ga0207687_10014599 | 3300025927 | Bacteria | 5142 |
| 89 | Ga0207687_10021343 | 3300025927 | Bacteria | 4301 |
| 90 | Ga0207690_10007391 | 3300025932 | Bacteria | 6522 |
| 91 | Ga0207711_10002007 | 3300025941 | Bacteria | 18405 |
| 92 | Ga0207711_10011641 | 3300025941 | Bacteria | 7308 |
| 93 | Ga0207667_10002729 | 3300025949 | Bacteria | 21826 |
| 94 | Ga0207667_10019698 | 3300025949 | Bacteria | 7521 |
| 95 | Ga0207640_10098384 | 3300025981 | Bacteria | 2045 |
| 96 | Ga0207658_10054688 | 3300025986 | Bacteria | 2954 |
| 97 | Ga0207677_10047019 | 3300026023 | Bacteria | 2895 |
| 98 | Ga0207703_10000075 | 3300026035 | Bacteria | 118422 |
| 99 | Ga0207641_10043940 | 3300026088 | Bacteria | 3755 |
| 100 | Ga0207641_10131153 | 3300026088 | Bacteria | 2251 |
| 101 | Ga0207676_10104986 | 3300026095 | Bacteria | 2351 |
| 102 | Ga0207674_10062481 | 3300026116 | Bacteria | 3762 |
| 103 | Ga0207674_10181651 | 3300026116 | Bacteria | 2055 |
| 104 | Ga0207683_10513089 | 3300026121 | Bacteria | 1108 |
| 105 | Ga0207698_10001420 | 3300026142 | Bacteria | 13905 |
| 106 | Ga0207698_10001474 | 3300026142 | Bacteria | 13682 |
| 107 | Ga0207698_10044394 | 3300026142 | Bacteria | 3339 |
| 108 | Ga0316576_10071181 | 3300031727 | Bacteria | 2565 |
| 109 | Ga0316576_10190957 | 3300031727 | Bacteria | 1544 |
| 110 | Ga0307518_10077502 | 3300031838 | Bacteria | 2402 |
| 111 | Ga0307416_100246997 | 3300032002 | Bacteria | 1734 |
| 112 | Ga0316584_0032876 | 3300036712 | Bacteria | 3839 |
| 113 | Ga0395899_0005572 | 3300037312 | Bacteria | 9762 |
| 114 | Ga0395899_0024273 | 3300037312 | Bacteria | 4585 |
| 115 | Ga0395899_0076888 | 3300037312 | Bacteria | 2436 |
| 116 | Ga0395899_0305821 | 3300037312 | Bacteria | 1075 |
| 117 | Ga0395900_0002826 | 3300037418 | Bacteria | 18949 |
| 118 | Ga0395900_0012009 | 3300037418 | Bacteria | 8854 |
| 119 | Ga0395898_0001288 | 3300037466 | Bacteria | 36834 |
| 120 | Ga0395898_0001580 | 3300037466 | Bacteria | 31136 |
| 121 | Ga0395898_0053802 | 3300037466 | Bacteria | 3930 |
| 122 | Ga0395901_0005472 | 3300038443 | Bacteria | 12859 |
| 123 | Ga0395901_0039309 | 3300038443 | Bacteria | 4896 |
| 124 | Ga0395901_0174494 | 3300038443 | Bacteria | 2255 |
| 125 | Ga0395901_0350012 | 3300038443 | Bacteria | 1525 |
| 126 | Ga0466972_0045310 | 3300044658 | Bacteria | 2132 |
| 127 | Ga0466972_0081002 | 3300044658 | Bacteria | 1546 |
| 128 | Ga0466965_0000006 | 3300044683 | Bacteria | 158069 |
| 129 | Ga0466966_0038287 | 3300044684 | Bacteria | 3091 |
| 130 | Ga0466966_0042538 | 3300044684 | Bacteria | 2915 |
| 131 | Ga0466966_0049997 | 3300044684 | Bacteria | 2661 |
| 132 | Ga0466966_0092193 | 3300044684 | Bacteria | 1880 |
| 133 | Ga0466961_0024967 | 3300044693 | Bacteria | 3846 |
| 134 | Ga0466961_0039363 | 3300044693 | Bacteria | 3031 |
| 135 | Ga0466961_0207647 | 3300044693 | Bacteria | 1210 |
| 136 | Ga0466964_0181405 | 3300044706 | Bacteria | 999 |
| 137 | Ga0466968_0042789 | 3300044735 | Bacteria | 1916 |
| 138 | Ga0466970_0003948 | 3300044765 | Bacteria | 7267 |
| 139 | Ga0466970_0010228 | 3300044765 | Bacteria | 4756 |
| 140 | Ga0466970_0078293 | 3300044765 | Bacteria | 1783 |
| 141 | Ga0466960_0003113 | 3300044901 | Bacteria | 6353 |
| 142 | Ga0466960_0007975 | 3300044901 | Bacteria | 4324 |
| 143 | Ga0466960_0011966 | 3300044901 | Bacteria | 3649 |
| 144 | Ga0466959_0023351 | 3300045049 | Bacteria | 4576 |
| 145 | Ga0466959_0025158 | 3300045049 | Bacteria | 4409 |
| 146 | Ga0466959_0128674 | 3300045049 | Bacteria | 1796 |
| 147 | Ga0495650_0000508 | 3300046471 | Bacteria | 58152 |
| 148 | Ga0495656_0183265 | 3300046615 | Bacteria | 1030 |
| 149 | Ga0495686_0031085 | 3300047472 | Bacteria | 3465 |
| 150 | Ga0495686_0182561 | 3300047472 | Bacteria | 1215 |
| 151 | Ga0496104_0170767 | 3300048907 | Bacteria | 2085 |
| 152 | Ga0496107_0057894 | 3300048910 | Bacteria | 2802 |
| 153 | Ga0496107_0127196 | 3300048910 | Bacteria | 1880 |
| 154 | Ga0496114_0037560 | 3300048917 | Bacteria | 4005 |
| 155 | Ga0496116_0147778 | 3300048919 | Bacteria | 1311 |
| 156 | Ga0496117_0021344 | 3300048920 | Bacteria | 5243 |
| 157 | Ga0496117_0026735 | 3300048920 | Bacteria | 4509 |
| 158 | Ga0496117_0034597 | 3300048920 | Bacteria | 3804 |
| 159 | Ga0496118_0013155 | 3300048921 | Bacteria | 7852 |
| 160 | Ga0496118_0034492 | 3300048921 | Bacteria | 4127 |
| 161 | Ga0496119_0000600 | 3300048922 | Bacteria | 48758 |
| 162 | Ga0496119_0002891 | 3300048922 | Bacteria | 18335 |
| 163 | Ga0496119_0269528 | 3300048922 | Bacteria | 851 |
| 164 | Ga0496120_0000257 | 3300048923 | Bacteria | 88760 |
| 165 | Ga0496120_0017662 | 3300048923 | Bacteria | 4614 |
| 166 | Ga0496120_0090444 | 3300048923 | Bacteria | 1636 |
| 167 | Ga0496121_0000025 | 3300048924 | Bacteria | 453467 |
| 168 | Ga0496122_0000846 | 3300048925 | Bacteria | 57849 |
| 169 | Ga0496123_0001986 | 3300048926 | Bacteria | 26463 |
| 170 | Ga0496125_0080938 | 3300048928 | Bacteria | 2484 |
| 171 | Ga0496126_0000565 | 3300048929 | Bacteria | 70942 |
| 172 | Ga0496126_0162335 | 3300048929 | Bacteria | 1908 |
| 173 | Ga0501031_0009917 | 3300049568 | Bacteria | 6202 |
| 174 | Ga0501031_0122682 | 3300049568 | Bacteria | 1697 |
| 175 | Ga0501031_0234957 | 3300049568 | Bacteria | 1192 |
| 176 | Ga0501032_0006823 | 3300049569 | Bacteria | 8378 |
| 177 | Ga0501032_0009694 | 3300049569 | Bacteria | 6973 |
| 178 | Ga0501032_0022715 | 3300049569 | Bacteria | 4347 |
| 179 | Ga0501033_0016793 | 3300049570 | Bacteria | 5536 |
| 180 | Ga0501033_0046316 | 3300049570 | Bacteria | 3233 |
| 181 | Ga0501034_0008953 | 3300049571 | Bacteria | 10522 |
| 182 | Ga0501034_0041428 | 3300049571 | Bacteria | 4659 |
| 183 | Ga0501034_0083988 | 3300049571 | Bacteria | 3186 |
| 184 | Ga0501034_0110050 | 3300049571 | Bacteria | 2746 |
| 185 | Ga0501034_0204324 | 3300049571 | Bacteria | 1932 |
| 186 | Ga0501036_0008771 | 3300049572 | Bacteria | 8299 |
| 187 | Ga0501037_0004457 | 3300049573 | Bacteria | 10171 |
| 188 | Ga0501037_0012581 | 3300049573 | Bacteria | 6235 |
| 189 | Ga0501037_0027464 | 3300049573 | Bacteria | 4204 |
| 190 | Ga0501037_0103150 | 3300049573 | Bacteria | 2057 |
| 191 | Ga0501038_0006045 | 3300049574 | Bacteria | 11205 |
| 192 | Ga0501038_0124340 | 3300049574 | Bacteria | 2124 |
| 193 | Ga0501038_0135117 | 3300049574 | Bacteria | 2021 |
| 194 | Ga0501039_0031193 | 3300049575 | Bacteria | 4108 |
| 195 | Ga0501039_0127545 | 3300049575 | Bacteria | 1996 |
| 196 | Ga0501039_0390205 | 3300049575 | Bacteria | 1093 |
| 197 | Ga0501042_0383010 | 3300049578 | Bacteria | 1018 |
| 198 | Ga0501043_0015385 | 3300049579 | Bacteria | 5991 |
| 199 | Ga0501043_0027521 | 3300049579 | Bacteria | 4462 |
| 200 | Ga0501043_0063088 | 3300049579 | Bacteria | 2910 |
| 201 | Ga0501046_0001605 | 3300049580 | Bacteria | 21628 |
| 202 | Ga0501046_0004664 | 3300049580 | Bacteria | 12374 |
| 203 | Ga0501046_0059314 | 3300049580 | Bacteria | 2998 |
| 204 | Ga0501046_0128139 | 3300049580 | Bacteria | 1926 |
| 205 | Ga0501047_0020967 | 3300049581 | Bacteria | 6278 |
| 206 | Ga0501047_0031083 | 3300049581 | Bacteria | 5149 |
| 207 | Ga0501047_0062600 | 3300049581 | Bacteria | 3588 |
| 208 | Ga0501047_0302920 | 3300049581 | Bacteria | 1440 |
| 209 | Ga0501048_0037685 | 3300049582 | Bacteria | 3472 |
| 210 | Ga0501070_0001295 | 3300049586 | Bacteria | 22448 |
| 211 | Ga0501070_0003796 | 3300049586 | Bacteria | 13054 |
| 212 | Ga0501070_0044136 | 3300049586 | Bacteria | 3710 |
| 213 | Ga0501070_0282370 | 3300049586 | Bacteria | 1354 |
| 214 | Ga0501071_0000114 | 3300049587 | Bacteria | 31703 |
| 215 | Ga0501072_0632368 | 3300049588 | Bacteria | 843 |
| 216 | Ga0501080_0071654 | 3300049742 | Bacteria | 3223 |
| 217 | Ga0501080_0534307 | 3300049742 | Bacteria | 1045 |
| 218 | Ga0501035_0034293 | 3300049822 | Bacteria | 4612 |
| 219 | Ga0501035_0041871 | 3300049822 | Bacteria | 4133 |
| 220 | Ga0501035_0048295 | 3300049822 | Bacteria | 3817 |
| 221 | Ga0501035_0053416 | 3300049822 | Bacteria | 3613 |
| 222 | Ga0501044_0002700 | 3300049823 | Bacteria | 20166 |
| 223 | Ga0501044_0007081 | 3300049823 | Bacteria | 12344 |
| 224 | Ga0501044_0009579 | 3300049823 | Bacteria | 10544 |
| 225 | Ga0501044_0023428 | 3300049823 | Bacteria | 6566 |
| 226 | Ga0501044_0031938 | 3300049823 | Bacteria | 5536 |
| 227 | Ga0501044_0397142 | 3300049823 | Bacteria | 1292 |
| 228 | Ga0501045_0005368 | 3300049824 | Bacteria | 8881 |
| 229 | nmdc:mga06r32_209847_c1 | 3300050510 | Bacteria | 1935 |
| 230 | Ga0500635_0048465 | 3300053080 | Bacteria | 1447 |
| 231 | Ga0500643_000444 | 3300053087 | Bacteria | 30955 |
| 232 | Ga0500651_0000383 | 3300053093 | Bacteria | 24162 |
| 233 | Ga0500556_0000001 | 3300053104 | Bacteria | 1135060 |
| 234 | Ga0500568_0000003 | 3300053139 | Bacteria | 863587 |
| 235 | Ga0500568_0000091 | 3300053139 | Bacteria | 85759 |
| 236 | Ga0500568_0000252 | 3300053139 | Bacteria | 45616 |
| 237 | Ga0500590_021217 | 3300053148 | Bacteria | 3373 |
| 238 | Ga0500616_0002993 | 3300053153 | Bacteria | 13361 |
| 239 | Ga0500620_002141 | 3300053155 | Bacteria | 3882 |
| 240 | Ga0466962_0147258 | 3300061719 | Bacteria | 1142 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049578 | Ga0501042_0383010 | Ga0501042_0383010_80_844 | 244 |
| 2 | 3300049582 | Ga0501048_0037685 | Ga0501048_0037685_2587_3351 | 244 |
| 3 | 3300049588 | Ga0501072_0632368 | Ga0501072_0632368_13_777 | 244 |
| 4 | 3300044684 | Ga0466966_0092193 | Ga0466966_0092193_44_793 | 249 |
| 5 | 3300048925 | Ga0496122_0000846 | Ga0496122_0000846_7178_7960 | 255 |
| 6 | iso_pu_bacteria | 2839986021 | 2839986678 | 261 |
| 7 | 3300026121 | Ga0207683_10513089 | Ga0207683_105130892 | 265 |
| 8 | 3300048922 | Ga0496119_0269528 | Ga0496119_0269528_40_837 | 265 |
| 9 | 3300044706 | Ga0466964_0181405 | Ga0466964_0181405_180_983 | 267 |
| 10 | 3300037466 | Ga0395898_0053802 | Ga0395898_0053802_245_1129 | 272 |
| 11 | 3300038443 | Ga0395901_0039309 | Ga0395901_0039309_1407_2291 | 272 |
| 12 | 3300044693 | Ga0466961_0039363 | Ga0466961_0039363_428_1312 | 272 |
| 13 | 3300049742 | Ga0501080_0534307 | Ga0501080_0534307_12_860 | 272 |
| 14 | iso_pu_bacteria | 2866612099 | 2866616453 | 281 |
| 15 | 3300036712 | Ga0316584_0032876 | Ga0316584_0032876_935_1801 | 283 |
| 16 | iso_pu_bacteria | 2582580736 | 2583151901 | 286 |
| 17 | 3300037418 | Ga0395900_0012009 | Ga0395900_0012009_3910_4908 | 288 |
| 18 | 3300037466 | Ga0395898_0001580 | Ga0395898_0001580_27301_28299 | 288 |
| 19 | 3300038443 | Ga0395901_0005472 | Ga0395901_0005472_4047_5045 | 288 |
| 20 | iso_pu_bacteria | 2868088558 | 2868091526 | 288 |
| 21 | 3300050510 | nmdc:mga06r32_209847_c1 | nmdc:mga06r32_209847_c1_894_1784 | 289 |
| 22 | 3300031727 | Ga0316576_10071181 | Ga0316576_100711812 | 291 |
| 23 | 3300049586 | Ga0501070_0003796 | Ga0501070_0003796_7605_8585 | 292 |
| 24 | 3300031727 | Ga0316576_10190957 | Ga0316576_101909572 | 293 |
| 25 | 3300044765 | Ga0466970_0010228 | Ga0466970_0010228_3517_4443 | 293 |
| 26 | 3300044901 | Ga0466960_0007975 | Ga0466960_0007975_2859_3785 | 293 |
| 27 | 3300049571 | Ga0501034_0083988 | Ga0501034_0083988_518_1498 | 293 |
| 28 | 3300049587 | Ga0501071_0000114 | Ga0501071_0000114_29623_30603 | 293 |
| 29 | 3300037312 | Ga0395899_0305821 | Ga0395899_0305821_97_1044 | 294 |
| 30 | 3300038443 | Ga0395901_0350012 | Ga0395901_0350012_334_1281 | 294 |
| 31 | 3300048928 | Ga0496125_0080938 | Ga0496125_0080938_246_1223 | 294 |
| 32 | 3300044901 | Ga0466960_0011966 | Ga0466960_0011966_226_1173 | 296 |
| 33 | 3300048920 | Ga0496117_0021344 | Ga0496117_0021344_2810_3763 | 296 |
| 34 | 3300048921 | Ga0496118_0034492 | Ga0496118_0034492_1597_2550 | 296 |
| 35 | 3300048922 | Ga0496119_0002891 | Ga0496119_0002891_6305_7258 | 296 |
| 36 | 3300048923 | Ga0496120_0000257 | Ga0496120_0000257_37504_38457 | 296 |
| 37 | iso_pu_bacteria | 2899359706 | 2899362349 | 296 |
| 38 | 3300048923 | Ga0496120_0090444 | Ga0496120_0090444_532_1485 | 297 |
| 39 | 3300005563 | Ga0068855_100033650 | Ga0068855_1000336506 | 298 |
| 40 | 3300005616 | Ga0068852_100008145 | Ga0068852_1000081458 | 298 |
| 41 | 3300005834 | Ga0068851_10000001 | Ga0068851_1000000150 | 298 |
| 42 | 3300009093 | Ga0105240_10021811 | Ga0105240_100218112 | 298 |
| 43 | 3300009545 | Ga0105237_10013055 | Ga0105237_100130556 | 298 |
| 44 | 3300009551 | Ga0105238_10002701 | Ga0105238_100027018 | 298 |
| 45 | 3300025254 | Ga0209148_1009261 | Ga0209148_10092612 | 298 |
| 46 | 3300025321 | Ga0207656_10000005 | Ga0207656_10000005439 | 298 |
| 47 | 3300025914 | Ga0207671_10000016 | Ga0207671_1000001619 | 298 |
| 48 | 3300025914 | Ga0207671_10032196 | Ga0207671_100321963 | 298 |
| 49 | 3300025924 | Ga0207694_10000022 | Ga0207694_1000002211 | 298 |
| 50 | 3300026116 | Ga0207674_10062481 | Ga0207674_100624812 | 298 |
| 51 | 3300026116 | Ga0207674_10181651 | Ga0207674_101816512 | 298 |
| 52 | 3300026142 | Ga0207698_10001474 | Ga0207698_100014747 | 298 |
| 53 | 3300048923 | Ga0496120_0017662 | Ga0496120_0017662_2080_3033 | 298 |
| 54 | 3300003320 | rootH2_10033049 | rootH2_100330492 | 299 |
| 55 | 3300005327 | Ga0070658_10414757 | Ga0070658_104147571 | 299 |
| 56 | 3300025909 | Ga0207705_10314788 | Ga0207705_103147882 | 299 |
| 57 | 3300048924 | Ga0496121_0000025 | Ga0496121_0000025_335395_336348 | 299 |
| 58 | 3300049823 | Ga0501044_0397142 | Ga0501044_0397142_159_1115 | 299 |
| 59 | iso_pu_bacteria | 2554235227 | 2555228986 | 300 |
| 60 | iso_pu_bacteria | 2654587600 | 2655033468 | 300 |
| 61 | 3300009174 | Ga0105241_10000615 | Ga0105241_100006154 | 301 |
| 62 | 3300025911 | Ga0207654_10000001 | Ga0207654_10000001999 | 301 |
| 63 | 3300037312 | Ga0395899_0024273 | Ga0395899_0024273_2142_3068 | 301 |
| 64 | 3300048926 | Ga0496123_0001986 | Ga0496123_0001986_17604_18524 | 301 |
| 65 | 3300049568 | Ga0501031_0234957 | Ga0501031_0234957_29_982 | 301 |
| 66 | 3300049573 | Ga0501037_0004457 | Ga0501037_0004457_845_1798 | 301 |
| 67 | 3300049579 | Ga0501043_0063088 | Ga0501043_0063088_1554_2507 | 301 |
| 68 | 3300049581 | Ga0501047_0020967 | Ga0501047_0020967_3087_4040 | 301 |
| 69 | 3300049822 | Ga0501035_0053416 | Ga0501035_0053416_2484_3437 | 301 |
| 70 | 3300049823 | Ga0501044_0007081 | Ga0501044_0007081_7287_8240 | 301 |
| 71 | 3300053155 | Ga0500620_002141 | Ga0500620_002141_1148_2107 | 301 |
| 72 | iso_pu_bacteria | 2883821847 | 2883822565 | 301 |
| 73 | 3300037418 | Ga0395900_0002826 | Ga0395900_0002826_15777_16775 | 302 |
| 74 | 3300048929 | Ga0496126_0000565 | Ga0496126_0000565_2588_3499 | 302 |
| 75 | 3300049579 | Ga0501043_0027521 | Ga0501043_0027521_2874_3818 | 302 |
| 76 | iso_pu_bacteria | 8002811521 | 8002814227 | 302 |
| 77 | 3300044684 | Ga0466966_0049997 | Ga0466966_0049997_958_1956 | 303 |
| 78 | 3300044901 | Ga0466960_0003113 | Ga0466960_0003113_3926_4843 | 303 |
| 79 | 3300003322 | rootL2_10011039 | rootL2_1001103913 | 304 |
| 80 | 3300031838 | Ga0307518_10077502 | Ga0307518_100775023 | 304 |
| 81 | iso_pu_bacteria | 2919051321 | 2919053425 | 304 |
| 82 | iso_pu_bacteria | 2946024296 | 2946026981 | 304 |
| 83 | 3300044693 | Ga0466961_0207647 | Ga0466961_0207647_229_1155 | 305 |
| 84 | 3300045049 | Ga0466959_0128674 | Ga0466959_0128674_548_1474 | 305 |
| 85 | 3300049568 | Ga0501031_0009917 | Ga0501031_0009917_871_1818 | 305 |
| 86 | 3300049569 | Ga0501032_0009694 | Ga0501032_0009694_1849_2796 | 305 |
| 87 | 3300049570 | Ga0501033_0046316 | Ga0501033_0046316_380_1327 | 305 |
| 88 | 3300049571 | Ga0501034_0008953 | Ga0501034_0008953_5398_6345 | 305 |
| 89 | 3300049572 | Ga0501036_0008771 | Ga0501036_0008771_4178_5125 | 305 |
| 90 | 3300049573 | Ga0501037_0012581 | Ga0501037_0012581_785_1732 | 305 |
| 91 | 3300049574 | Ga0501038_0006045 | Ga0501038_0006045_7602_8549 | 305 |
| 92 | 3300049575 | Ga0501039_0031193 | Ga0501039_0031193_722_1669 | 305 |
| 93 | 3300049579 | Ga0501043_0015385 | Ga0501043_0015385_4934_5881 | 305 |
| 94 | 3300049580 | Ga0501046_0001605 | Ga0501046_0001605_1630_2577 | 305 |
| 95 | 3300049581 | Ga0501047_0031083 | Ga0501047_0031083_374_1321 | 305 |
| 96 | 3300049822 | Ga0501035_0041871 | Ga0501035_0041871_148_1095 | 305 |
| 97 | 3300049823 | Ga0501044_0031938 | Ga0501044_0031938_3846_4793 | 305 |
| 98 | 3300049824 | Ga0501045_0005368 | Ga0501045_0005368_3649_4596 | 305 |
| 99 | 3300005543 | Ga0070672_100137886 | Ga0070672_1001378863 | 306 |
| 100 | 3300005618 | Ga0068864_100158533 | Ga0068864_1001585333 | 306 |
| 101 | 3300009098 | Ga0105245_10008524 | Ga0105245_100085242 | 306 |
| 102 | 3300009177 | Ga0105248_10028025 | Ga0105248_100280255 | 306 |
| 103 | 3300014325 | Ga0163163_10159391 | Ga0163163_101593912 | 306 |
| 104 | 3300025927 | Ga0207687_10021343 | Ga0207687_100213432 | 306 |
| 105 | 3300025941 | Ga0207711_10011641 | Ga0207711_100116417 | 306 |
| 106 | 3300026088 | Ga0207641_10131153 | Ga0207641_101311533 | 306 |
| 107 | 3300026095 | Ga0207676_10104986 | Ga0207676_101049863 | 306 |
| 108 | 3300046471 | Ga0495650_0000508 | Ga0495650_0000508_44545_45498 | 306 |
| 109 | iso_pu_bacteria | 2643221635 | 2644197955 | 306 |
| 110 | 3300047472 | Ga0495686_0031085 | Ga0495686_0031085_501_1469 | 307 |
| 111 | 3300048922 | Ga0496119_0000600 | Ga0496119_0000600_12514_13464 | 307 |
| 112 | 3300053104 | Ga0500556_0000001 | Ga0500556_0000001_1132266_1133234 | 307 |
| 113 | 3300053139 | Ga0500568_0000003 | Ga0500568_0000003_492738_493706 | 307 |
| 114 | iso_pu_bacteria | 2862993130 | 2862994542 | 307 |
| 115 | 3300005616 | Ga0068852_100031456 | Ga0068852_1000314562 | 308 |
| 116 | 3300009177 | Ga0105248_10000366 | Ga0105248_1000036637 | 308 |
| 117 | 3300009545 | Ga0105237_10218636 | Ga0105237_102186362 | 308 |
| 118 | 3300013296 | Ga0157374_10021634 | Ga0157374_100216342 | 308 |
| 119 | 3300025903 | Ga0207680_10112661 | Ga0207680_101126612 | 308 |
| 120 | 3300025941 | Ga0207711_10002007 | Ga0207711_1000200711 | 308 |
| 121 | 3300026142 | Ga0207698_10001420 | Ga0207698_100014204 | 308 |
| 122 | 3300005842 | Ga0068858_100000016 | Ga0068858_100000016109 | 309 |
| 123 | 3300026035 | Ga0207703_10000075 | Ga0207703_1000007545 | 309 |
| 124 | 3300053087 | Ga0500643_000444 | Ga0500643_000444_22841_23809 | 309 |
| 125 | 3300003752 | Ga0055539_1000103 | Ga0055539_100010343 | 311 |
| 126 | 3300003756 | Ga0055533_1000020 | Ga0055533_1000020289 | 311 |
| 127 | 3300003759 | Ga0055525_1000235 | Ga0055525_100023547 | 311 |
| 128 | 3300005614 | Ga0068856_100072070 | Ga0068856_1000720702 | 311 |
| 129 | 3300013104 | Ga0157370_10339201 | Ga0157370_103392012 | 311 |
| 130 | 3300013105 | Ga0157369_10442079 | Ga0157369_104420792 | 311 |
| 131 | 3300020082 | Ga0206353_11064217 | Ga0206353_110642172 | 311 |
| 132 | 3300025225 | Ga0209566_100043 | Ga0209566_100043199 | 311 |
| 133 | 3300025226 | Ga0209674_100001 | Ga0209674_1000013611 | 311 |
| 134 | 3300025230 | Ga0209563_100001 | Ga0209563_1000013611 | 311 |
| 135 | 3300025253 | Ga0209677_100001 | Ga0209677_1000013611 | 311 |
| 136 | 3300025253 | Ga0209677_100788 | Ga0209677_1007889 | 311 |
| 137 | 3300037312 | Ga0395899_0005572 | Ga0395899_0005572_8353_9288 | 311 |
| 138 | 3300038443 | Ga0395901_0174494 | Ga0395901_0174494_1175_2110 | 311 |
| 139 | 3300044658 | Ga0466972_0045310 | Ga0466972_0045310_1060_1995 | 311 |
| 140 | 3300044684 | Ga0466966_0038287 | Ga0466966_0038287_1992_2927 | 311 |
| 141 | 3300044693 | Ga0466961_0024967 | Ga0466961_0024967_869_1804 | 311 |
| 142 | 3300044765 | Ga0466970_0003948 | Ga0466970_0003948_348_1283 | 311 |
| 143 | 3300045049 | Ga0466959_0025158 | Ga0466959_0025158_172_1107 | 311 |
| 144 | 3300047472 | Ga0495686_0182561 | Ga0495686_0182561_187_1122 | 311 |
| 145 | iso_pu_bacteria | 2852643534 | 2852646396 | 311 |
| 146 | 3300048919 | Ga0496116_0147778 | Ga0496116_0147778_160_1098 | 312 |
| 147 | 3300053139 | Ga0500568_0000091 | Ga0500568_0000091_58715_59662 | 313 |
| 148 | iso_pu_bacteria | 2939660829 | 2939664265 | 313 |
| 149 | 3300005327 | Ga0070658_10010239 | Ga0070658_100102397 | 314 |
| 150 | 3300005338 | Ga0068868_100051492 | Ga0068868_1000514923 | 314 |
| 151 | 3300005339 | Ga0070660_100045710 | Ga0070660_1000457103 | 314 |
| 152 | 3300005366 | Ga0070659_100000468 | Ga0070659_10000046818 | 314 |
| 153 | 3300005367 | Ga0070667_100019700 | Ga0070667_1000197004 | 314 |
| 154 | 3300005563 | Ga0068855_100180903 | Ga0068855_1001809032 | 314 |
| 155 | 3300005614 | Ga0068856_100497812 | Ga0068856_1004978122 | 314 |
| 156 | 3300005616 | Ga0068852_100249720 | Ga0068852_1002497203 | 314 |
| 157 | 3300009093 | Ga0105240_10410941 | Ga0105240_104109412 | 314 |
| 158 | 3300009098 | Ga0105245_10020653 | Ga0105245_100206535 | 314 |
| 159 | 3300009551 | Ga0105238_10040810 | Ga0105238_100408106 | 314 |
| 160 | 3300010375 | Ga0105239_10070284 | Ga0105239_100702842 | 314 |
| 161 | 3300010375 | Ga0105239_10076243 | Ga0105239_100762432 | 314 |
| 162 | 3300013296 | Ga0157374_10282153 | Ga0157374_102821532 | 314 |
| 163 | 3300014968 | Ga0157379_10023468 | Ga0157379_100234682 | 314 |
| 164 | 3300025254 | Ga0209148_1001296 | Ga0209148_100129611 | 314 |
| 165 | 3300025909 | Ga0207705_10015318 | Ga0207705_100153183 | 314 |
| 166 | 3300025913 | Ga0207695_10003316 | Ga0207695_100033167 | 314 |
| 167 | 3300025919 | Ga0207657_10007209 | Ga0207657_100072096 | 314 |
| 168 | 3300025924 | Ga0207694_10133974 | Ga0207694_101339742 | 314 |
| 169 | 3300025927 | Ga0207687_10014599 | Ga0207687_100145993 | 314 |
| 170 | 3300025932 | Ga0207690_10007391 | Ga0207690_100073913 | 314 |
| 171 | 3300025949 | Ga0207667_10002729 | Ga0207667_1000272920 | 314 |
| 172 | 3300025949 | Ga0207667_10019698 | Ga0207667_100196987 | 314 |
| 173 | 3300025981 | Ga0207640_10098384 | Ga0207640_100983842 | 314 |
| 174 | 3300026023 | Ga0207677_10047019 | Ga0207677_100470192 | 314 |
| 175 | 3300026142 | Ga0207698_10044394 | Ga0207698_100443942 | 314 |
| 176 | 3300044765 | Ga0466970_0078293 | Ga0466970_0078293_57_1037 | 314 |
| 177 | 3300046615 | Ga0495656_0183265 | Ga0495656_0183265_16_969 | 314 |
| 178 | 3300048920 | Ga0496117_0026735 | Ga0496117_0026735_2642_3586 | 314 |
| 179 | 3300048921 | Ga0496118_0013155 | Ga0496118_0013155_4214_5158 | 314 |
| 180 | 3300049570 | Ga0501033_0016793 | Ga0501033_0016793_3519_4475 | 314 |
| 181 | 3300049571 | Ga0501034_0041428 | Ga0501034_0041428_322_1278 | 314 |
| 182 | 3300049573 | Ga0501037_0103150 | Ga0501037_0103150_787_1743 | 314 |
| 183 | 3300049580 | Ga0501046_0004664 | Ga0501046_0004664_10429_11385 | 314 |
| 184 | 3300049581 | Ga0501047_0302920 | Ga0501047_0302920_311_1267 | 314 |
| 185 | 3300049586 | Ga0501070_0282370 | Ga0501070_0282370_90_1046 | 314 |
| 186 | 3300049823 | Ga0501044_0009579 | Ga0501044_0009579_4297_5253 | 314 |
| 187 | 3300053080 | Ga0500635_0048465 | Ga0500635_0048465_240_1193 | 314 |
| 188 | 3300053153 | Ga0500616_0002993 | Ga0500616_0002993_4173_5141 | 314 |
| 189 | iso_pu_bacteria | 2857729791 | 2857732846 | 314 |
| 190 | iso_pu_bacteria | 2928121344 | 2928123924 | 314 |
| 191 | 3300005367 | Ga0070667_100075126 | Ga0070667_1000751264 | 315 |
| 192 | 3300025986 | Ga0207658_10054688 | Ga0207658_100546884 | 315 |
| 193 | 3300026088 | Ga0207641_10043940 | Ga0207641_100439405 | 315 |
| 194 | 3300044683 | Ga0466965_0000006 | Ga0466965_0000006_84086_85045 | 315 |
| 195 | 3300049568 | Ga0501031_0122682 | Ga0501031_0122682_294_1253 | 315 |
| 196 | 3300049569 | Ga0501032_0006823 | Ga0501032_0006823_4790_5749 | 315 |
| 197 | 3300049569 | Ga0501032_0022715 | Ga0501032_0022715_227_1186 | 315 |
| 198 | 3300049571 | Ga0501034_0110050 | Ga0501034_0110050_1510_2469 | 315 |
| 199 | 3300049571 | Ga0501034_0204324 | Ga0501034_0204324_931_1890 | 315 |
| 200 | 3300049574 | Ga0501038_0135117 | Ga0501038_0135117_159_1118 | 315 |
| 201 | 3300049575 | Ga0501039_0390205 | Ga0501039_0390205_10_969 | 315 |
| 202 | 3300053093 | Ga0500651_0000383 | Ga0500651_0000383_16811_17770 | 315 |
| 203 | 3300053139 | Ga0500568_0000252 | Ga0500568_0000252_15995_16954 | 315 |
| 204 | 3300053148 | Ga0500590_021217 | Ga0500590_021217_2223_3182 | 315 |
| 205 | 3300037312 | Ga0395899_0076888 | Ga0395899_0076888_53_1009 | 318 |
| 206 | 3300037466 | Ga0395898_0001288 | Ga0395898_0001288_19946_20902 | 318 |
| 207 | 3300044658 | Ga0466972_0081002 | Ga0466972_0081002_363_1328 | 318 |
| 208 | 3300044735 | Ga0466968_0042789 | Ga0466968_0042789_611_1576 | 318 |
| 209 | iso_pu_bacteria | 2919443155 | 2919443611 | 318 |
| 210 | 3300032002 | Ga0307416_100246997 | Ga0307416_1002469973 | 319 |
| 211 | iso_pu_bacteria | 2643221649 | 2644278727 | 319 |
| 212 | iso_pu_bacteria | 2643221549 | 2643768319 | 320 |
| 213 | iso_pu_bacteria | 2643221572 | 2643877874 | 320 |
| 214 | iso_pu_bacteria | 2643221619 | 2644111747 | 320 |
| 215 | iso_pu_bacteria | 2643221669 | 2644384929 | 320 |
| 216 | iso_pu_bacteria | 2721755702 | 2723641223 | 320 |
| 217 | iso_pu_bacteria | 2808606372 | 2808903072 | 320 |
| 218 | iso_pu_bacteria | 2895660088 | 2895662745 | 320 |
| 219 | iso_pu_bacteria | 2935409751 | 2935410635 | 320 |
| 220 | iso_pu_bacteria | 2585428094 | 2587863920 | 321 |
| 221 | iso_pu_bacteria | 2844841374 | 2844841411 | 321 |
| 222 | 3300049573 | Ga0501037_0027464 | Ga0501037_0027464_2623_3639 | 322 |
| 223 | 3300049574 | Ga0501038_0124340 | Ga0501038_0124340_980_1987 | 322 |
| 224 | 3300049575 | Ga0501039_0127545 | Ga0501039_0127545_810_1817 | 322 |
| 225 | 3300049580 | Ga0501046_0059314 | Ga0501046_0059314_1550_2557 | 322 |
| 226 | 3300049580 | Ga0501046_0128139 | Ga0501046_0128139_369_1385 | 322 |
| 227 | 3300049581 | Ga0501047_0062600 | Ga0501047_0062600_1878_2885 | 322 |
| 228 | 3300049742 | Ga0501080_0071654 | Ga0501080_0071654_1980_2996 | 322 |
| 229 | 3300049822 | Ga0501035_0034293 | Ga0501035_0034293_557_1573 | 322 |
| 230 | 3300049822 | Ga0501035_0048295 | Ga0501035_0048295_976_1983 | 322 |
| 231 | 3300049823 | Ga0501044_0002700 | Ga0501044_0002700_15617_16627 | 322 |
| 232 | 3300049823 | Ga0501044_0023428 | Ga0501044_0023428_2597_3604 | 322 |
| 233 | iso_pu_bacteria | 2919055335 | 2919057053 | 322 |
| 234 | iso_pu_bacteria | 2919523602 | 2919527110 | 322 |
| 235 | iso_pu_bacteria | 2928153084 | 2928154814 | 322 |
| 236 | 3300005455 | Ga0070663_100105259 | Ga0070663_1001052592 | 323 |
| 237 | 3300009036 | Ga0105244_10098007 | Ga0105244_100980072 | 323 |
| 238 | 3300014326 | Ga0157380_10012969 | Ga0157380_100129694 | 323 |
| 239 | 3300025926 | Ga0207659_10307725 | Ga0207659_103077252 | 323 |
| 240 | 3300049586 | Ga0501070_0044136 | Ga0501070_0044136_406_1416 | 323 |
| 241 | iso_pu_bacteria | 2643221616 | 2644094871 | 323 |
| 242 | iso_pu_bacteria | 2884763398 | 2884764312 | 323 |
| 243 | 3300048910 | Ga0496107_0127196 | Ga0496107_0127196_343_1320 | 325 |
| 244 | 3300048917 | Ga0496114_0037560 | Ga0496114_0037560_1105_2082 | 325 |
| 245 | 3300002067 | JGI24735J21928_10017743 | JGI24735J21928_100177432 | 326 |
| 246 | 3300003214 | JGI25165J46597_1000148 | JGI25165J46597_100014860 | 326 |
| 247 | 3300003578 | Ga0006562J51391_1027147 | Ga0006562J51391_10271472 | 326 |
| 248 | 3300003578 | Ga0006562J51391_1027151 | Ga0006562J51391_10271511 | 326 |
| 249 | 3300003760 | Ga0055527_1000003 | Ga0055527_100000354 | 326 |
| 250 | 3300003762 | Ga0055542_1000066 | Ga0055542_100006683 | 326 |
| 251 | 3300003763 | Ga0055529_1000006 | Ga0055529_100000654 | 326 |
| 252 | 3300005435 | Ga0070714_100335512 | Ga0070714_1003355122 | 326 |
| 253 | 3300013102 | Ga0157371_10138252 | Ga0157371_101382522 | 326 |
| 254 | 3300013105 | Ga0157369_10079219 | Ga0157369_100792192 | 326 |
| 255 | 3300025228 | Ga0209672_100003 | Ga0209672_100003893 | 326 |
| 256 | 3300025229 | Ga0209147_101011 | Ga0209147_1010116 | 326 |
| 257 | 3300025230 | Ga0209563_103221 | Ga0209563_1032213 | 326 |
| 258 | 3300025231 | Ga0207427_100039 | Ga0207427_100039218 | 326 |
| 259 | 3300025233 | Ga0209437_100397 | Ga0209437_10039729 | 326 |
| 260 | 3300025242 | Ga0209258_105492 | Ga0209258_1054922 | 326 |
| 261 | 3300025254 | Ga0209148_1000004 | Ga0209148_10000041188 | 326 |
| 262 | 3300025261 | Ga0209233_1000014 | Ga0209233_1000014300 | 326 |
| 263 | 3300025272 | Ga0209455_1000046 | Ga0209455_1000046207 | 326 |
| 264 | 3300025272 | Ga0209455_1008813 | Ga0209455_10088134 | 326 |
| 265 | 3300025904 | Ga0207647_10128130 | Ga0207647_101281302 | 326 |
| 266 | 3300025904 | Ga0207647_10156028 | Ga0207647_101560282 | 326 |
| 267 | 3300044684 | Ga0466966_0042538 | Ga0466966_0042538_191_1171 | 326 |
| 268 | 3300045049 | Ga0466959_0023351 | Ga0466959_0023351_3493_4473 | 326 |
| 269 | 3300048907 | Ga0496104_0170767 | Ga0496104_0170767_988_1971 | 326 |
| 270 | 3300048910 | Ga0496107_0057894 | Ga0496107_0057894_1715_2698 | 326 |
| 271 | 3300048920 | Ga0496117_0034597 | Ga0496117_0034597_1575_2555 | 326 |
| 272 | 3300048929 | Ga0496126_0162335 | Ga0496126_0162335_455_1438 | 326 |
| 273 | 3300049586 | Ga0501070_0001295 | Ga0501070_0001295_16793_17776 | 326 |
| 274 | 3300061719 | Ga0466962_0147258 | Ga0466962_0147258_148_1128 | 326 |
| 275 | iso_pu_bacteria | 2643221632 | 2644181074 | 326 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3av0-assembly1.cif.gz_A | crystal structure of mre11-rad50 bound to atp s | 0.6055 | 52 | 297 |
| 1uf3-assembly1.cif.gz_C | crystal structure of tt1561 of thermus thermophilus hb8 | 0.5891 | 50 | 303 |
| 7aoi-assembly1.cif.gz_XO | trypanosoma brucei mitochondrial ribosome large subunit assembly intermediate | 0.5812 | 49 | 116 |
| 2hyo-assembly1.cif.gz_A-2 | crystal structure of rv0805 n97a mutant | 0.5581 | 52 | 300 |
| 4mz8-assembly1.cif.gz_B | crystal structure of the inosine 5'-monophosphate dehydrogenase, with an internal deletion of cbs domain from campylobacter jejuni complexed with inhibitor compound c91 | 0.549 | 181 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6X827_50_260_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.9011 | 52 | 284 | 3.60.21.10 |
| af_I6X827_50_260_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8928 | 52 | 284 | 3.60.21.10 |
| af_Q09320_248_456_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.7135 | 52 | 297 | 3.60.21.10 |
| af_Q22704_214_405_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.7076 | 52 | 260 | 3.60.21.10 |
| af_Q09320_248_456_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.7075 | 52 | 297 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Y9QZD1-F1-model_v4 | Metallophosphoesterase | 0.9626 | 35 | 325 |
GO:0008758
GO:0009245 GO:0016020 |
| AF-A0A1Q3ZZT9-F1-model_v4 | Metallophosphatase | 0.9555 | 7 | 324 |
GO:0008758
GO:0009245 GO:0016020 |
| AF-W1VAL7-F1-model_v4 | Metallophosphoesterase | 0.954 | 36 | 192 |
GO:0016787
|
| AF-A0A3N2IL59-F1-model_v4 | Putative MPP superfamily phosphohydrolase | 0.9522 | 17 | 323 |
GO:0008758
GO:0009245 GO:0016020 |
| AF-A0A0D0IHP2-F1-model_v4 | Metallophosphatase | 0.9489 | 1 | 324 |
GO:0008758
GO:0009245 GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar