F380706

General Info

Members Datasets Scaffolds Average Seq Length
275 174 240 312

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0027464|Ga0501037_0027464_2623_3639
Length 338
Sequence MSRMTARRGASAIGTVALVAGAASAGALIWGTLIERRWYALRQVSAPVLPSGSRPIRVLHLSDLHMAPWQRDKQEWIRSLAAYAPDLIVDTGDNLGHERGFDGVKHALDAFKGVPGVFVNGSNDYYGPIPKNPMRYFSGPSTLHAKPSNLDTGELTGYFANELGWLDLNNHAGALTVNGTRLELFGVDDPHRNFDRLDTVTGELDELRASDETDDGWRDGGRDSRPAATVAIGVAHAPYRRILDSFVTNGASMIFAGHTHGGQVCVPGFGALVTNCDLPRGQAKGLSTWTHALRVAYLNVSAGLGTSIYSPVRFACRPEASLVTLVPHDTPFDGANVR

Samples

Sample ID Description Type Environment
1 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
2 2582580736 Prauserella sp. Am3 Isolate Unclassified
3 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
4 2643221549 Agromyces sp. Root1464 Isolate Unclassified
5 2643221572 Leifsonia sp. Root60 Isolate Unclassified
6 2643221616 Leifsonia sp. Root227 Isolate Unclassified
7 2643221619 Agromyces sp. Root81 Isolate Unclassified
8 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
9 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
10 2643221649 Leifsonia sp. Root4 Isolate Unclassified
11 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
12 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
13 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
14 2808606372 Agromyces sp. 23-23 Isolate Unclassified
15 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
16 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
17 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
18 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
19 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
20 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
21 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
22 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
23 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
24 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
25 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
26 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
27 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
28 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
29 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
30 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
31 2928153084 Leifsonia sp. 563 Isolate Unclassified
32 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
33 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
34 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
35 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
36 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
37 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
38 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
39 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
40 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
41 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
42 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
43 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
44 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
45 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
112 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
129 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
135 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
138 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
141 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
142 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
166 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
167 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
168 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
169 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
170 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
173 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
174 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.18
Metatranscriptomes 1.09
Isolates 12.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.36
Nodule 0
Rhizoplane 1.45
Rhizosphere 70.91
Stem 0
Stem Tuber 0.36
Unclassified 14.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10017743 3300002067 Bacteria 2200
2 JGI25165J46597_1000148 3300003214 Bacteria 116003
3 rootH2_10033049 3300003320 Bacteria 3030
4 rootL2_10011039 3300003322 Bacteria 14496
5 Ga0006562J51391_1027147 3300003578 Bacteria 3676
6 Ga0006562J51391_1027151 3300003578 Bacteria 1600
7 Ga0055539_1000103 3300003752 Bacteria 96081
8 Ga0055533_1000020 3300003756 Bacteria 353998
9 Ga0055525_1000235 3300003759 Bacteria 57710
10 Ga0055527_1000003 3300003760 Bacteria 705001
11 Ga0055542_1000066 3300003762 Bacteria 154802
12 Ga0055529_1000006 3300003763 Bacteria 416978
13 Ga0070658_10010239 3300005327 Bacteria 7519
14 Ga0070658_10414757 3300005327 Bacteria 1158
15 Ga0068868_100051492 3300005338 Bacteria 3240
16 Ga0070660_100045710 3300005339 Bacteria 3353
17 Ga0070659_100000468 3300005366 Bacteria 29797
18 Ga0070667_100019700 3300005367 Bacteria 5596
19 Ga0070667_100075126 3300005367 Bacteria 2885
20 Ga0070714_100335512 3300005435 Bacteria 1417
21 Ga0070663_100105259 3300005455 Bacteria 2112
22 Ga0070672_100137886 3300005543 Bacteria 2010
23 Ga0068855_100033650 3300005563 Bacteria 6115
24 Ga0068855_100180903 3300005563 Bacteria 2383
25 Ga0068856_100072070 3300005614 Bacteria 3421
26 Ga0068856_100497812 3300005614 Bacteria 1239
27 Ga0068852_100008145 3300005616 Bacteria 7697
28 Ga0068852_100031456 3300005616 Bacteria 4379
29 Ga0068852_100249720 3300005616 Bacteria 1699
30 Ga0068864_100158533 3300005618 Bacteria 2056
31 Ga0068851_10000001 3300005834 Bacteria 495512
32 Ga0068858_100000016 3300005842 Bacteria 193130
33 Ga0105244_10098007 3300009036 Bacteria 1436
34 Ga0105240_10021811 3300009093 Bacteria 8511
35 Ga0105240_10410941 3300009093 Bacteria 1522
36 Ga0105245_10008524 3300009098 Bacteria 8943
37 Ga0105245_10020653 3300009098 Bacteria 5775
38 Ga0105241_10000615 3300009174 Bacteria 26776
39 Ga0105248_10000366 3300009177 Bacteria 52614
40 Ga0105248_10028025 3300009177 Bacteria 6274
41 Ga0105237_10013055 3300009545 Bacteria 8722
42 Ga0105237_10218636 3300009545 Bacteria 1905
43 Ga0105238_10002701 3300009551 Bacteria 17645
44 Ga0105238_10040810 3300009551 Bacteria 4701
45 Ga0105239_10070284 3300010375 Bacteria 3845
46 Ga0105239_10076243 3300010375 Bacteria 3687
47 Ga0157371_10138252 3300013102 Bacteria 1735
48 Ga0157370_10339201 3300013104 Bacteria 1385
49 Ga0157369_10079219 3300013105 Bacteria 3519
50 Ga0157369_10442079 3300013105 Bacteria 1347
51 Ga0157374_10021634 3300013296 Bacteria 5727
52 Ga0157374_10282153 3300013296 Bacteria 1640
53 Ga0163163_10159391 3300014325 Bacteria 2301
54 Ga0157380_10012969 3300014326 Bacteria 6058
55 Ga0157379_10023468 3300014968 Bacteria 5475
56 Ga0206353_11064217 3300020082 Bacteria 2305
57 Ga0209566_100043 3300025225 Bacteria 266609
58 Ga0209674_100001 3300025226 Bacteria 4013750
59 Ga0209672_100003 3300025228 Bacteria 1560476
60 Ga0209147_101011 3300025229 Bacteria 12064
61 Ga0209563_100001 3300025230 Bacteria 4013775
62 Ga0209563_103221 3300025230 Bacteria 3436
63 Ga0207427_100039 3300025231 Bacteria 291576
64 Ga0209437_100397 3300025233 Bacteria 40909
65 Ga0209258_105492 3300025242 Bacteria 2133
66 Ga0209677_100001 3300025253 Bacteria 4013787
67 Ga0209677_100788 3300025253 Bacteria 15939
68 Ga0209148_1000004 3300025254 Bacteria 1844481
69 Ga0209148_1001296 3300025254 Bacteria 13504
70 Ga0209148_1009261 3300025254 Bacteria 1928
71 Ga0209233_1000014 3300025261 Bacteria 996641
72 Ga0209455_1000046 3300025272 Bacteria 382681
73 Ga0209455_1008813 3300025272 Bacteria 2704
74 Ga0207656_10000005 3300025321 Bacteria 490514
75 Ga0207680_10112661 3300025903 Bacteria 1767
76 Ga0207647_10128130 3300025904 Bacteria 1493
77 Ga0207647_10156028 3300025904 Bacteria 1333
78 Ga0207705_10015318 3300025909 Bacteria 5502
79 Ga0207705_10314788 3300025909 Bacteria 1202
80 Ga0207654_10000001 3300025911 Bacteria 1816198
81 Ga0207695_10003316 3300025913 Bacteria 22816
82 Ga0207671_10000016 3300025914 Bacteria 435413
83 Ga0207671_10032196 3300025914 Bacteria 3903
84 Ga0207657_10007209 3300025919 Bacteria 11416
85 Ga0207694_10000022 3300025924 Bacteria 288900
86 Ga0207694_10133974 3300025924 Bacteria 1988
87 Ga0207659_10307725 3300025926 Bacteria 1304
88 Ga0207687_10014599 3300025927 Bacteria 5142
89 Ga0207687_10021343 3300025927 Bacteria 4301
90 Ga0207690_10007391 3300025932 Bacteria 6522
91 Ga0207711_10002007 3300025941 Bacteria 18405
92 Ga0207711_10011641 3300025941 Bacteria 7308
93 Ga0207667_10002729 3300025949 Bacteria 21826
94 Ga0207667_10019698 3300025949 Bacteria 7521
95 Ga0207640_10098384 3300025981 Bacteria 2045
96 Ga0207658_10054688 3300025986 Bacteria 2954
97 Ga0207677_10047019 3300026023 Bacteria 2895
98 Ga0207703_10000075 3300026035 Bacteria 118422
99 Ga0207641_10043940 3300026088 Bacteria 3755
100 Ga0207641_10131153 3300026088 Bacteria 2251
101 Ga0207676_10104986 3300026095 Bacteria 2351
102 Ga0207674_10062481 3300026116 Bacteria 3762
103 Ga0207674_10181651 3300026116 Bacteria 2055
104 Ga0207683_10513089 3300026121 Bacteria 1108
105 Ga0207698_10001420 3300026142 Bacteria 13905
106 Ga0207698_10001474 3300026142 Bacteria 13682
107 Ga0207698_10044394 3300026142 Bacteria 3339
108 Ga0316576_10071181 3300031727 Bacteria 2565
109 Ga0316576_10190957 3300031727 Bacteria 1544
110 Ga0307518_10077502 3300031838 Bacteria 2402
111 Ga0307416_100246997 3300032002 Bacteria 1734
112 Ga0316584_0032876 3300036712 Bacteria 3839
113 Ga0395899_0005572 3300037312 Bacteria 9762
114 Ga0395899_0024273 3300037312 Bacteria 4585
115 Ga0395899_0076888 3300037312 Bacteria 2436
116 Ga0395899_0305821 3300037312 Bacteria 1075
117 Ga0395900_0002826 3300037418 Bacteria 18949
118 Ga0395900_0012009 3300037418 Bacteria 8854
119 Ga0395898_0001288 3300037466 Bacteria 36834
120 Ga0395898_0001580 3300037466 Bacteria 31136
121 Ga0395898_0053802 3300037466 Bacteria 3930
122 Ga0395901_0005472 3300038443 Bacteria 12859
123 Ga0395901_0039309 3300038443 Bacteria 4896
124 Ga0395901_0174494 3300038443 Bacteria 2255
125 Ga0395901_0350012 3300038443 Bacteria 1525
126 Ga0466972_0045310 3300044658 Bacteria 2132
127 Ga0466972_0081002 3300044658 Bacteria 1546
128 Ga0466965_0000006 3300044683 Bacteria 158069
129 Ga0466966_0038287 3300044684 Bacteria 3091
130 Ga0466966_0042538 3300044684 Bacteria 2915
131 Ga0466966_0049997 3300044684 Bacteria 2661
132 Ga0466966_0092193 3300044684 Bacteria 1880
133 Ga0466961_0024967 3300044693 Bacteria 3846
134 Ga0466961_0039363 3300044693 Bacteria 3031
135 Ga0466961_0207647 3300044693 Bacteria 1210
136 Ga0466964_0181405 3300044706 Bacteria 999
137 Ga0466968_0042789 3300044735 Bacteria 1916
138 Ga0466970_0003948 3300044765 Bacteria 7267
139 Ga0466970_0010228 3300044765 Bacteria 4756
140 Ga0466970_0078293 3300044765 Bacteria 1783
141 Ga0466960_0003113 3300044901 Bacteria 6353
142 Ga0466960_0007975 3300044901 Bacteria 4324
143 Ga0466960_0011966 3300044901 Bacteria 3649
144 Ga0466959_0023351 3300045049 Bacteria 4576
145 Ga0466959_0025158 3300045049 Bacteria 4409
146 Ga0466959_0128674 3300045049 Bacteria 1796
147 Ga0495650_0000508 3300046471 Bacteria 58152
148 Ga0495656_0183265 3300046615 Bacteria 1030
149 Ga0495686_0031085 3300047472 Bacteria 3465
150 Ga0495686_0182561 3300047472 Bacteria 1215
151 Ga0496104_0170767 3300048907 Bacteria 2085
152 Ga0496107_0057894 3300048910 Bacteria 2802
153 Ga0496107_0127196 3300048910 Bacteria 1880
154 Ga0496114_0037560 3300048917 Bacteria 4005
155 Ga0496116_0147778 3300048919 Bacteria 1311
156 Ga0496117_0021344 3300048920 Bacteria 5243
157 Ga0496117_0026735 3300048920 Bacteria 4509
158 Ga0496117_0034597 3300048920 Bacteria 3804
159 Ga0496118_0013155 3300048921 Bacteria 7852
160 Ga0496118_0034492 3300048921 Bacteria 4127
161 Ga0496119_0000600 3300048922 Bacteria 48758
162 Ga0496119_0002891 3300048922 Bacteria 18335
163 Ga0496119_0269528 3300048922 Bacteria 851
164 Ga0496120_0000257 3300048923 Bacteria 88760
165 Ga0496120_0017662 3300048923 Bacteria 4614
166 Ga0496120_0090444 3300048923 Bacteria 1636
167 Ga0496121_0000025 3300048924 Bacteria 453467
168 Ga0496122_0000846 3300048925 Bacteria 57849
169 Ga0496123_0001986 3300048926 Bacteria 26463
170 Ga0496125_0080938 3300048928 Bacteria 2484
171 Ga0496126_0000565 3300048929 Bacteria 70942
172 Ga0496126_0162335 3300048929 Bacteria 1908
173 Ga0501031_0009917 3300049568 Bacteria 6202
174 Ga0501031_0122682 3300049568 Bacteria 1697
175 Ga0501031_0234957 3300049568 Bacteria 1192
176 Ga0501032_0006823 3300049569 Bacteria 8378
177 Ga0501032_0009694 3300049569 Bacteria 6973
178 Ga0501032_0022715 3300049569 Bacteria 4347
179 Ga0501033_0016793 3300049570 Bacteria 5536
180 Ga0501033_0046316 3300049570 Bacteria 3233
181 Ga0501034_0008953 3300049571 Bacteria 10522
182 Ga0501034_0041428 3300049571 Bacteria 4659
183 Ga0501034_0083988 3300049571 Bacteria 3186
184 Ga0501034_0110050 3300049571 Bacteria 2746
185 Ga0501034_0204324 3300049571 Bacteria 1932
186 Ga0501036_0008771 3300049572 Bacteria 8299
187 Ga0501037_0004457 3300049573 Bacteria 10171
188 Ga0501037_0012581 3300049573 Bacteria 6235
189 Ga0501037_0027464 3300049573 Bacteria 4204
190 Ga0501037_0103150 3300049573 Bacteria 2057
191 Ga0501038_0006045 3300049574 Bacteria 11205
192 Ga0501038_0124340 3300049574 Bacteria 2124
193 Ga0501038_0135117 3300049574 Bacteria 2021
194 Ga0501039_0031193 3300049575 Bacteria 4108
195 Ga0501039_0127545 3300049575 Bacteria 1996
196 Ga0501039_0390205 3300049575 Bacteria 1093
197 Ga0501042_0383010 3300049578 Bacteria 1018
198 Ga0501043_0015385 3300049579 Bacteria 5991
199 Ga0501043_0027521 3300049579 Bacteria 4462
200 Ga0501043_0063088 3300049579 Bacteria 2910
201 Ga0501046_0001605 3300049580 Bacteria 21628
202 Ga0501046_0004664 3300049580 Bacteria 12374
203 Ga0501046_0059314 3300049580 Bacteria 2998
204 Ga0501046_0128139 3300049580 Bacteria 1926
205 Ga0501047_0020967 3300049581 Bacteria 6278
206 Ga0501047_0031083 3300049581 Bacteria 5149
207 Ga0501047_0062600 3300049581 Bacteria 3588
208 Ga0501047_0302920 3300049581 Bacteria 1440
209 Ga0501048_0037685 3300049582 Bacteria 3472
210 Ga0501070_0001295 3300049586 Bacteria 22448
211 Ga0501070_0003796 3300049586 Bacteria 13054
212 Ga0501070_0044136 3300049586 Bacteria 3710
213 Ga0501070_0282370 3300049586 Bacteria 1354
214 Ga0501071_0000114 3300049587 Bacteria 31703
215 Ga0501072_0632368 3300049588 Bacteria 843
216 Ga0501080_0071654 3300049742 Bacteria 3223
217 Ga0501080_0534307 3300049742 Bacteria 1045
218 Ga0501035_0034293 3300049822 Bacteria 4612
219 Ga0501035_0041871 3300049822 Bacteria 4133
220 Ga0501035_0048295 3300049822 Bacteria 3817
221 Ga0501035_0053416 3300049822 Bacteria 3613
222 Ga0501044_0002700 3300049823 Bacteria 20166
223 Ga0501044_0007081 3300049823 Bacteria 12344
224 Ga0501044_0009579 3300049823 Bacteria 10544
225 Ga0501044_0023428 3300049823 Bacteria 6566
226 Ga0501044_0031938 3300049823 Bacteria 5536
227 Ga0501044_0397142 3300049823 Bacteria 1292
228 Ga0501045_0005368 3300049824 Bacteria 8881
229 nmdc:mga06r32_209847_c1 3300050510 Bacteria 1935
230 Ga0500635_0048465 3300053080 Bacteria 1447
231 Ga0500643_000444 3300053087 Bacteria 30955
232 Ga0500651_0000383 3300053093 Bacteria 24162
233 Ga0500556_0000001 3300053104 Bacteria 1135060
234 Ga0500568_0000003 3300053139 Bacteria 863587
235 Ga0500568_0000091 3300053139 Bacteria 85759
236 Ga0500568_0000252 3300053139 Bacteria 45616
237 Ga0500590_021217 3300053148 Bacteria 3373
238 Ga0500616_0002993 3300053153 Bacteria 13361
239 Ga0500620_002141 3300053155 Bacteria 3882
240 Ga0466962_0147258 3300061719 Bacteria 1142

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049578 Ga0501042_0383010 Ga0501042_0383010_80_844 244
2 3300049582 Ga0501048_0037685 Ga0501048_0037685_2587_3351 244
3 3300049588 Ga0501072_0632368 Ga0501072_0632368_13_777 244
4 3300044684 Ga0466966_0092193 Ga0466966_0092193_44_793 249
5 3300048925 Ga0496122_0000846 Ga0496122_0000846_7178_7960 255
6 iso_pu_bacteria 2839986021 2839986678 261
7 3300026121 Ga0207683_10513089 Ga0207683_105130892 265
8 3300048922 Ga0496119_0269528 Ga0496119_0269528_40_837 265
9 3300044706 Ga0466964_0181405 Ga0466964_0181405_180_983 267
10 3300037466 Ga0395898_0053802 Ga0395898_0053802_245_1129 272
11 3300038443 Ga0395901_0039309 Ga0395901_0039309_1407_2291 272
12 3300044693 Ga0466961_0039363 Ga0466961_0039363_428_1312 272
13 3300049742 Ga0501080_0534307 Ga0501080_0534307_12_860 272
14 iso_pu_bacteria 2866612099 2866616453 281
15 3300036712 Ga0316584_0032876 Ga0316584_0032876_935_1801 283
16 iso_pu_bacteria 2582580736 2583151901 286
17 3300037418 Ga0395900_0012009 Ga0395900_0012009_3910_4908 288
18 3300037466 Ga0395898_0001580 Ga0395898_0001580_27301_28299 288
19 3300038443 Ga0395901_0005472 Ga0395901_0005472_4047_5045 288
20 iso_pu_bacteria 2868088558 2868091526 288
21 3300050510 nmdc:mga06r32_209847_c1 nmdc:mga06r32_209847_c1_894_1784 289
22 3300031727 Ga0316576_10071181 Ga0316576_100711812 291
23 3300049586 Ga0501070_0003796 Ga0501070_0003796_7605_8585 292
24 3300031727 Ga0316576_10190957 Ga0316576_101909572 293
25 3300044765 Ga0466970_0010228 Ga0466970_0010228_3517_4443 293
26 3300044901 Ga0466960_0007975 Ga0466960_0007975_2859_3785 293
27 3300049571 Ga0501034_0083988 Ga0501034_0083988_518_1498 293
28 3300049587 Ga0501071_0000114 Ga0501071_0000114_29623_30603 293
29 3300037312 Ga0395899_0305821 Ga0395899_0305821_97_1044 294
30 3300038443 Ga0395901_0350012 Ga0395901_0350012_334_1281 294
31 3300048928 Ga0496125_0080938 Ga0496125_0080938_246_1223 294
32 3300044901 Ga0466960_0011966 Ga0466960_0011966_226_1173 296
33 3300048920 Ga0496117_0021344 Ga0496117_0021344_2810_3763 296
34 3300048921 Ga0496118_0034492 Ga0496118_0034492_1597_2550 296
35 3300048922 Ga0496119_0002891 Ga0496119_0002891_6305_7258 296
36 3300048923 Ga0496120_0000257 Ga0496120_0000257_37504_38457 296
37 iso_pu_bacteria 2899359706 2899362349 296
38 3300048923 Ga0496120_0090444 Ga0496120_0090444_532_1485 297
39 3300005563 Ga0068855_100033650 Ga0068855_1000336506 298
40 3300005616 Ga0068852_100008145 Ga0068852_1000081458 298
41 3300005834 Ga0068851_10000001 Ga0068851_1000000150 298
42 3300009093 Ga0105240_10021811 Ga0105240_100218112 298
43 3300009545 Ga0105237_10013055 Ga0105237_100130556 298
44 3300009551 Ga0105238_10002701 Ga0105238_100027018 298
45 3300025254 Ga0209148_1009261 Ga0209148_10092612 298
46 3300025321 Ga0207656_10000005 Ga0207656_10000005439 298
47 3300025914 Ga0207671_10000016 Ga0207671_1000001619 298
48 3300025914 Ga0207671_10032196 Ga0207671_100321963 298
49 3300025924 Ga0207694_10000022 Ga0207694_1000002211 298
50 3300026116 Ga0207674_10062481 Ga0207674_100624812 298
51 3300026116 Ga0207674_10181651 Ga0207674_101816512 298
52 3300026142 Ga0207698_10001474 Ga0207698_100014747 298
53 3300048923 Ga0496120_0017662 Ga0496120_0017662_2080_3033 298
54 3300003320 rootH2_10033049 rootH2_100330492 299
55 3300005327 Ga0070658_10414757 Ga0070658_104147571 299
56 3300025909 Ga0207705_10314788 Ga0207705_103147882 299
57 3300048924 Ga0496121_0000025 Ga0496121_0000025_335395_336348 299
58 3300049823 Ga0501044_0397142 Ga0501044_0397142_159_1115 299
59 iso_pu_bacteria 2554235227 2555228986 300
60 iso_pu_bacteria 2654587600 2655033468 300
61 3300009174 Ga0105241_10000615 Ga0105241_100006154 301
62 3300025911 Ga0207654_10000001 Ga0207654_10000001999 301
63 3300037312 Ga0395899_0024273 Ga0395899_0024273_2142_3068 301
64 3300048926 Ga0496123_0001986 Ga0496123_0001986_17604_18524 301
65 3300049568 Ga0501031_0234957 Ga0501031_0234957_29_982 301
66 3300049573 Ga0501037_0004457 Ga0501037_0004457_845_1798 301
67 3300049579 Ga0501043_0063088 Ga0501043_0063088_1554_2507 301
68 3300049581 Ga0501047_0020967 Ga0501047_0020967_3087_4040 301
69 3300049822 Ga0501035_0053416 Ga0501035_0053416_2484_3437 301
70 3300049823 Ga0501044_0007081 Ga0501044_0007081_7287_8240 301
71 3300053155 Ga0500620_002141 Ga0500620_002141_1148_2107 301
72 iso_pu_bacteria 2883821847 2883822565 301
73 3300037418 Ga0395900_0002826 Ga0395900_0002826_15777_16775 302
74 3300048929 Ga0496126_0000565 Ga0496126_0000565_2588_3499 302
75 3300049579 Ga0501043_0027521 Ga0501043_0027521_2874_3818 302
76 iso_pu_bacteria 8002811521 8002814227 302
77 3300044684 Ga0466966_0049997 Ga0466966_0049997_958_1956 303
78 3300044901 Ga0466960_0003113 Ga0466960_0003113_3926_4843 303
79 3300003322 rootL2_10011039 rootL2_1001103913 304
80 3300031838 Ga0307518_10077502 Ga0307518_100775023 304
81 iso_pu_bacteria 2919051321 2919053425 304
82 iso_pu_bacteria 2946024296 2946026981 304
83 3300044693 Ga0466961_0207647 Ga0466961_0207647_229_1155 305
84 3300045049 Ga0466959_0128674 Ga0466959_0128674_548_1474 305
85 3300049568 Ga0501031_0009917 Ga0501031_0009917_871_1818 305
86 3300049569 Ga0501032_0009694 Ga0501032_0009694_1849_2796 305
87 3300049570 Ga0501033_0046316 Ga0501033_0046316_380_1327 305
88 3300049571 Ga0501034_0008953 Ga0501034_0008953_5398_6345 305
89 3300049572 Ga0501036_0008771 Ga0501036_0008771_4178_5125 305
90 3300049573 Ga0501037_0012581 Ga0501037_0012581_785_1732 305
91 3300049574 Ga0501038_0006045 Ga0501038_0006045_7602_8549 305
92 3300049575 Ga0501039_0031193 Ga0501039_0031193_722_1669 305
93 3300049579 Ga0501043_0015385 Ga0501043_0015385_4934_5881 305
94 3300049580 Ga0501046_0001605 Ga0501046_0001605_1630_2577 305
95 3300049581 Ga0501047_0031083 Ga0501047_0031083_374_1321 305
96 3300049822 Ga0501035_0041871 Ga0501035_0041871_148_1095 305
97 3300049823 Ga0501044_0031938 Ga0501044_0031938_3846_4793 305
98 3300049824 Ga0501045_0005368 Ga0501045_0005368_3649_4596 305
99 3300005543 Ga0070672_100137886 Ga0070672_1001378863 306
100 3300005618 Ga0068864_100158533 Ga0068864_1001585333 306
101 3300009098 Ga0105245_10008524 Ga0105245_100085242 306
102 3300009177 Ga0105248_10028025 Ga0105248_100280255 306
103 3300014325 Ga0163163_10159391 Ga0163163_101593912 306
104 3300025927 Ga0207687_10021343 Ga0207687_100213432 306
105 3300025941 Ga0207711_10011641 Ga0207711_100116417 306
106 3300026088 Ga0207641_10131153 Ga0207641_101311533 306
107 3300026095 Ga0207676_10104986 Ga0207676_101049863 306
108 3300046471 Ga0495650_0000508 Ga0495650_0000508_44545_45498 306
109 iso_pu_bacteria 2643221635 2644197955 306
110 3300047472 Ga0495686_0031085 Ga0495686_0031085_501_1469 307
111 3300048922 Ga0496119_0000600 Ga0496119_0000600_12514_13464 307
112 3300053104 Ga0500556_0000001 Ga0500556_0000001_1132266_1133234 307
113 3300053139 Ga0500568_0000003 Ga0500568_0000003_492738_493706 307
114 iso_pu_bacteria 2862993130 2862994542 307
115 3300005616 Ga0068852_100031456 Ga0068852_1000314562 308
116 3300009177 Ga0105248_10000366 Ga0105248_1000036637 308
117 3300009545 Ga0105237_10218636 Ga0105237_102186362 308
118 3300013296 Ga0157374_10021634 Ga0157374_100216342 308
119 3300025903 Ga0207680_10112661 Ga0207680_101126612 308
120 3300025941 Ga0207711_10002007 Ga0207711_1000200711 308
121 3300026142 Ga0207698_10001420 Ga0207698_100014204 308
122 3300005842 Ga0068858_100000016 Ga0068858_100000016109 309
123 3300026035 Ga0207703_10000075 Ga0207703_1000007545 309
124 3300053087 Ga0500643_000444 Ga0500643_000444_22841_23809 309
125 3300003752 Ga0055539_1000103 Ga0055539_100010343 311
126 3300003756 Ga0055533_1000020 Ga0055533_1000020289 311
127 3300003759 Ga0055525_1000235 Ga0055525_100023547 311
128 3300005614 Ga0068856_100072070 Ga0068856_1000720702 311
129 3300013104 Ga0157370_10339201 Ga0157370_103392012 311
130 3300013105 Ga0157369_10442079 Ga0157369_104420792 311
131 3300020082 Ga0206353_11064217 Ga0206353_110642172 311
132 3300025225 Ga0209566_100043 Ga0209566_100043199 311
133 3300025226 Ga0209674_100001 Ga0209674_1000013611 311
134 3300025230 Ga0209563_100001 Ga0209563_1000013611 311
135 3300025253 Ga0209677_100001 Ga0209677_1000013611 311
136 3300025253 Ga0209677_100788 Ga0209677_1007889 311
137 3300037312 Ga0395899_0005572 Ga0395899_0005572_8353_9288 311
138 3300038443 Ga0395901_0174494 Ga0395901_0174494_1175_2110 311
139 3300044658 Ga0466972_0045310 Ga0466972_0045310_1060_1995 311
140 3300044684 Ga0466966_0038287 Ga0466966_0038287_1992_2927 311
141 3300044693 Ga0466961_0024967 Ga0466961_0024967_869_1804 311
142 3300044765 Ga0466970_0003948 Ga0466970_0003948_348_1283 311
143 3300045049 Ga0466959_0025158 Ga0466959_0025158_172_1107 311
144 3300047472 Ga0495686_0182561 Ga0495686_0182561_187_1122 311
145 iso_pu_bacteria 2852643534 2852646396 311
146 3300048919 Ga0496116_0147778 Ga0496116_0147778_160_1098 312
147 3300053139 Ga0500568_0000091 Ga0500568_0000091_58715_59662 313
148 iso_pu_bacteria 2939660829 2939664265 313
149 3300005327 Ga0070658_10010239 Ga0070658_100102397 314
150 3300005338 Ga0068868_100051492 Ga0068868_1000514923 314
151 3300005339 Ga0070660_100045710 Ga0070660_1000457103 314
152 3300005366 Ga0070659_100000468 Ga0070659_10000046818 314
153 3300005367 Ga0070667_100019700 Ga0070667_1000197004 314
154 3300005563 Ga0068855_100180903 Ga0068855_1001809032 314
155 3300005614 Ga0068856_100497812 Ga0068856_1004978122 314
156 3300005616 Ga0068852_100249720 Ga0068852_1002497203 314
157 3300009093 Ga0105240_10410941 Ga0105240_104109412 314
158 3300009098 Ga0105245_10020653 Ga0105245_100206535 314
159 3300009551 Ga0105238_10040810 Ga0105238_100408106 314
160 3300010375 Ga0105239_10070284 Ga0105239_100702842 314
161 3300010375 Ga0105239_10076243 Ga0105239_100762432 314
162 3300013296 Ga0157374_10282153 Ga0157374_102821532 314
163 3300014968 Ga0157379_10023468 Ga0157379_100234682 314
164 3300025254 Ga0209148_1001296 Ga0209148_100129611 314
165 3300025909 Ga0207705_10015318 Ga0207705_100153183 314
166 3300025913 Ga0207695_10003316 Ga0207695_100033167 314
167 3300025919 Ga0207657_10007209 Ga0207657_100072096 314
168 3300025924 Ga0207694_10133974 Ga0207694_101339742 314
169 3300025927 Ga0207687_10014599 Ga0207687_100145993 314
170 3300025932 Ga0207690_10007391 Ga0207690_100073913 314
171 3300025949 Ga0207667_10002729 Ga0207667_1000272920 314
172 3300025949 Ga0207667_10019698 Ga0207667_100196987 314
173 3300025981 Ga0207640_10098384 Ga0207640_100983842 314
174 3300026023 Ga0207677_10047019 Ga0207677_100470192 314
175 3300026142 Ga0207698_10044394 Ga0207698_100443942 314
176 3300044765 Ga0466970_0078293 Ga0466970_0078293_57_1037 314
177 3300046615 Ga0495656_0183265 Ga0495656_0183265_16_969 314
178 3300048920 Ga0496117_0026735 Ga0496117_0026735_2642_3586 314
179 3300048921 Ga0496118_0013155 Ga0496118_0013155_4214_5158 314
180 3300049570 Ga0501033_0016793 Ga0501033_0016793_3519_4475 314
181 3300049571 Ga0501034_0041428 Ga0501034_0041428_322_1278 314
182 3300049573 Ga0501037_0103150 Ga0501037_0103150_787_1743 314
183 3300049580 Ga0501046_0004664 Ga0501046_0004664_10429_11385 314
184 3300049581 Ga0501047_0302920 Ga0501047_0302920_311_1267 314
185 3300049586 Ga0501070_0282370 Ga0501070_0282370_90_1046 314
186 3300049823 Ga0501044_0009579 Ga0501044_0009579_4297_5253 314
187 3300053080 Ga0500635_0048465 Ga0500635_0048465_240_1193 314
188 3300053153 Ga0500616_0002993 Ga0500616_0002993_4173_5141 314
189 iso_pu_bacteria 2857729791 2857732846 314
190 iso_pu_bacteria 2928121344 2928123924 314
191 3300005367 Ga0070667_100075126 Ga0070667_1000751264 315
192 3300025986 Ga0207658_10054688 Ga0207658_100546884 315
193 3300026088 Ga0207641_10043940 Ga0207641_100439405 315
194 3300044683 Ga0466965_0000006 Ga0466965_0000006_84086_85045 315
195 3300049568 Ga0501031_0122682 Ga0501031_0122682_294_1253 315
196 3300049569 Ga0501032_0006823 Ga0501032_0006823_4790_5749 315
197 3300049569 Ga0501032_0022715 Ga0501032_0022715_227_1186 315
198 3300049571 Ga0501034_0110050 Ga0501034_0110050_1510_2469 315
199 3300049571 Ga0501034_0204324 Ga0501034_0204324_931_1890 315
200 3300049574 Ga0501038_0135117 Ga0501038_0135117_159_1118 315
201 3300049575 Ga0501039_0390205 Ga0501039_0390205_10_969 315
202 3300053093 Ga0500651_0000383 Ga0500651_0000383_16811_17770 315
203 3300053139 Ga0500568_0000252 Ga0500568_0000252_15995_16954 315
204 3300053148 Ga0500590_021217 Ga0500590_021217_2223_3182 315
205 3300037312 Ga0395899_0076888 Ga0395899_0076888_53_1009 318
206 3300037466 Ga0395898_0001288 Ga0395898_0001288_19946_20902 318
207 3300044658 Ga0466972_0081002 Ga0466972_0081002_363_1328 318
208 3300044735 Ga0466968_0042789 Ga0466968_0042789_611_1576 318
209 iso_pu_bacteria 2919443155 2919443611 318
210 3300032002 Ga0307416_100246997 Ga0307416_1002469973 319
211 iso_pu_bacteria 2643221649 2644278727 319
212 iso_pu_bacteria 2643221549 2643768319 320
213 iso_pu_bacteria 2643221572 2643877874 320
214 iso_pu_bacteria 2643221619 2644111747 320
215 iso_pu_bacteria 2643221669 2644384929 320
216 iso_pu_bacteria 2721755702 2723641223 320
217 iso_pu_bacteria 2808606372 2808903072 320
218 iso_pu_bacteria 2895660088 2895662745 320
219 iso_pu_bacteria 2935409751 2935410635 320
220 iso_pu_bacteria 2585428094 2587863920 321
221 iso_pu_bacteria 2844841374 2844841411 321
222 3300049573 Ga0501037_0027464 Ga0501037_0027464_2623_3639 322
223 3300049574 Ga0501038_0124340 Ga0501038_0124340_980_1987 322
224 3300049575 Ga0501039_0127545 Ga0501039_0127545_810_1817 322
225 3300049580 Ga0501046_0059314 Ga0501046_0059314_1550_2557 322
226 3300049580 Ga0501046_0128139 Ga0501046_0128139_369_1385 322
227 3300049581 Ga0501047_0062600 Ga0501047_0062600_1878_2885 322
228 3300049742 Ga0501080_0071654 Ga0501080_0071654_1980_2996 322
229 3300049822 Ga0501035_0034293 Ga0501035_0034293_557_1573 322
230 3300049822 Ga0501035_0048295 Ga0501035_0048295_976_1983 322
231 3300049823 Ga0501044_0002700 Ga0501044_0002700_15617_16627 322
232 3300049823 Ga0501044_0023428 Ga0501044_0023428_2597_3604 322
233 iso_pu_bacteria 2919055335 2919057053 322
234 iso_pu_bacteria 2919523602 2919527110 322
235 iso_pu_bacteria 2928153084 2928154814 322
236 3300005455 Ga0070663_100105259 Ga0070663_1001052592 323
237 3300009036 Ga0105244_10098007 Ga0105244_100980072 323
238 3300014326 Ga0157380_10012969 Ga0157380_100129694 323
239 3300025926 Ga0207659_10307725 Ga0207659_103077252 323
240 3300049586 Ga0501070_0044136 Ga0501070_0044136_406_1416 323
241 iso_pu_bacteria 2643221616 2644094871 323
242 iso_pu_bacteria 2884763398 2884764312 323
243 3300048910 Ga0496107_0127196 Ga0496107_0127196_343_1320 325
244 3300048917 Ga0496114_0037560 Ga0496114_0037560_1105_2082 325
245 3300002067 JGI24735J21928_10017743 JGI24735J21928_100177432 326
246 3300003214 JGI25165J46597_1000148 JGI25165J46597_100014860 326
247 3300003578 Ga0006562J51391_1027147 Ga0006562J51391_10271472 326
248 3300003578 Ga0006562J51391_1027151 Ga0006562J51391_10271511 326
249 3300003760 Ga0055527_1000003 Ga0055527_100000354 326
250 3300003762 Ga0055542_1000066 Ga0055542_100006683 326
251 3300003763 Ga0055529_1000006 Ga0055529_100000654 326
252 3300005435 Ga0070714_100335512 Ga0070714_1003355122 326
253 3300013102 Ga0157371_10138252 Ga0157371_101382522 326
254 3300013105 Ga0157369_10079219 Ga0157369_100792192 326
255 3300025228 Ga0209672_100003 Ga0209672_100003893 326
256 3300025229 Ga0209147_101011 Ga0209147_1010116 326
257 3300025230 Ga0209563_103221 Ga0209563_1032213 326
258 3300025231 Ga0207427_100039 Ga0207427_100039218 326
259 3300025233 Ga0209437_100397 Ga0209437_10039729 326
260 3300025242 Ga0209258_105492 Ga0209258_1054922 326
261 3300025254 Ga0209148_1000004 Ga0209148_10000041188 326
262 3300025261 Ga0209233_1000014 Ga0209233_1000014300 326
263 3300025272 Ga0209455_1000046 Ga0209455_1000046207 326
264 3300025272 Ga0209455_1008813 Ga0209455_10088134 326
265 3300025904 Ga0207647_10128130 Ga0207647_101281302 326
266 3300025904 Ga0207647_10156028 Ga0207647_101560282 326
267 3300044684 Ga0466966_0042538 Ga0466966_0042538_191_1171 326
268 3300045049 Ga0466959_0023351 Ga0466959_0023351_3493_4473 326
269 3300048907 Ga0496104_0170767 Ga0496104_0170767_988_1971 326
270 3300048910 Ga0496107_0057894 Ga0496107_0057894_1715_2698 326
271 3300048920 Ga0496117_0034597 Ga0496117_0034597_1575_2555 326
272 3300048929 Ga0496126_0162335 Ga0496126_0162335_455_1438 326
273 3300049586 Ga0501070_0001295 Ga0501070_0001295_16793_17776 326
274 3300061719 Ga0466962_0147258 Ga0466962_0147258_148_1128 326
275 iso_pu_bacteria 2643221632 2644181074 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

56

262

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3av0-assembly1.cif.gz_A crystal structure of mre11-rad50 bound to atp s 0.6055 52 297
1uf3-assembly1.cif.gz_C crystal structure of tt1561 of thermus thermophilus hb8 0.5891 50 303
7aoi-assembly1.cif.gz_XO trypanosoma brucei mitochondrial ribosome large subunit assembly intermediate 0.5812 49 116
2hyo-assembly1.cif.gz_A-2 crystal structure of rv0805 n97a mutant 0.5581 52 300
4mz8-assembly1.cif.gz_B crystal structure of the inosine 5'-monophosphate dehydrogenase, with an internal deletion of cbs domain from campylobacter jejuni complexed with inhibitor compound c91 0.549 181 257
ID Description Score Start End Superfamily
af_I6X827_50_260_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9011 52 284 3.60.21.10
af_I6X827_50_260_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8928 52 284 3.60.21.10
af_Q09320_248_456_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7135 52 297 3.60.21.10
af_Q22704_214_405_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7076 52 260 3.60.21.10
af_Q09320_248_456_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7075 52 297 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A4Y9QZD1-F1-model_v4 Metallophosphoesterase 0.9626 35 325 GO:0008758
GO:0009245
GO:0016020
AF-A0A1Q3ZZT9-F1-model_v4 Metallophosphatase 0.9555 7 324 GO:0008758
GO:0009245
GO:0016020
AF-W1VAL7-F1-model_v4 Metallophosphoesterase 0.954 36 192 GO:0016787
AF-A0A3N2IL59-F1-model_v4 Putative MPP superfamily phosphohydrolase 0.9522 17 323 GO:0008758
GO:0009245
GO:0016020
AF-A0A0D0IHP2-F1-model_v4 Metallophosphatase 0.9489 1 324 GO:0008758
GO:0009245
GO:0016020

Feature Viewer

pLDDT pTM Quality
84.87 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map