F380701

General Info

Members Datasets Scaffolds Average Seq Length
275 207 550 112

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0893140|Ga0501031_0893140_107_502
Length 131
Sequence VPVSSTHVFRFVIPTEVNQSLMAFDDALAQRIRELFDGQPDVTERRMFGGIAFLVGGNMCCGVLGDDLIVRLDPEQAEELLVSMRGVREFDVTGRQMRGWLFVGAGAIAEDAELATWVDRAETFASSLPPK

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
104 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
106 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
107 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
118 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
119 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
120 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
125 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
135 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 1.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.45
Nodule 0
Rhizoplane 8.36
Rhizosphere 90.18
Stem 0
Stem Tuber 0
Unclassified 5.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0893140 3300049568 Bacteria 569
2 JGI25407J50210_10021911 3300003373 Bacteria 1661
3 Ga0070676_10501991 3300005328 Bacteria 861
4 Ga0070676_10724695 3300005328 Bacteria 728
5 Ga0070680_100976318 3300005336 Bacteria 731
6 Ga0070682_100353784 3300005337 Bacteria 1096
7 Ga0068868_100035161 3300005338 Bacteria 3872
8 Ga0070660_100809784 3300005339 Bacteria 788
9 Ga0070691_10049275 3300005341 Bacteria 2006
10 Ga0070668_100011314 3300005347 Bacteria 6647
11 Ga0070668_100111792 3300005347 Bacteria 2175
12 Ga0070671_100710467 3300005355 Bacteria 872
13 Ga0070674_100129840 3300005356 Bacteria 1877
14 Ga0070709_10772718 3300005434 Bacteria 752
15 Ga0070710_10485528 3300005437 Bacteria 843
16 Ga0070711_100009858 3300005439 Bacteria 5891
17 Ga0070700_100027208 3300005441 Bacteria 3388
18 Ga0070694_100372343 3300005444 Bacteria 1112
19 Ga0070708_100930463 3300005445 Bacteria 816
20 Ga0070678_100094304 3300005456 Bacteria 2304
21 Ga0070662_100007353 3300005457 Bacteria 7135
22 Ga0070685_10056489 3300005466 Bacteria 2282
23 Ga0070707_100536518 3300005468 Bacteria 1132
24 Ga0070698_100443618 3300005471 Bacteria 1233
25 Ga0070679_100079565 3300005530 Bacteria 3267
26 Ga0070686_100473220 3300005544 Bacteria 967
27 Ga0070686_101394374 3300005544 Bacteria 588
28 Ga0070695_100423714 3300005545 Bacteria 1014
29 Ga0070696_100128999 3300005546 Bacteria 1838
30 Ga0070704_100039450 3300005549 Bacteria 3242
31 Ga0068855_100074509 3300005563 Bacteria 3942
32 Ga0068854_100096660 3300005578 Bacteria 2207
33 Ga0068861_100008041 3300005719 Bacteria 7258
34 Ga0068851_10530881 3300005834 Bacteria 709
35 Ga0081538_10000243 3300005981 Bacteria 61726
36 Ga0081538_10002886 3300005981 Bacteria 16414
37 Ga0081538_10019175 3300005981 Bacteria 5099
38 Ga0081538_10027522 3300005981 Bacteria 3939
39 Ga0075363_100358829 3300006048 Bacteria 852
40 Ga0070715_10048490 3300006163 Bacteria 1816
41 Ga0070712_100058567 3300006175 Bacteria 2710
42 Ga0075367_10032683 3300006178 Bacteria 2995
43 Ga0075428_100409859 3300006844 Bacteria 1452
44 Ga0075430_100403632 3300006846 Unclassified 1128
45 Ga0075430_101764590 3300006846 Bacteria 508
46 Ga0075431_100603002 3300006847 Bacteria 1082
47 Ga0075431_101392539 3300006847 Bacteria 661
48 Ga0075434_100128371 3300006871 Bacteria 2553
49 Ga0075434_100845593 3300006871 Bacteria 931
50 Ga0068865_100341020 3300006881 Bacteria 1211
51 Ga0075435_100744403 3300007076 Bacteria 853
52 Ga0105250_10575375 3300009092 Bacteria 519
53 Ga0111539_10199296 3300009094 Bacteria 2335
54 Ga0111539_11085645 3300009094 Unclassified 930
55 Ga0111539_12076505 3300009094 Bacteria 659
56 Ga0105245_10001984 3300009098 Bacteria 18590
57 Ga0105245_10025582 3300009098 Bacteria 5191
58 Ga0105245_12173415 3300009098 Bacteria 609
59 Ga0114129_10338827 3300009147 Bacteria 1995
60 Ga0114129_12147602 3300009147 Unclassified 673
61 Ga0114129_12264594 3300009147 Bacteria 653
62 Ga0114129_13378612 3300009147 Bacteria 514
63 Ga0105242_10255678 3300009176 Bacteria 1580
64 Ga0105249_10012450 3300009553 Bacteria 7499
65 Ga0105249_10215492 3300009553 Bacteria 1887
66 Ga0105249_10748037 3300009553 Bacteria 1040
67 Ga0105239_10436363 3300010375 Bacteria 1485
68 Ga0105239_10542770 3300010375 Bacteria 1324
69 Ga0157370_11122540 3300013104 Bacteria 710
70 Ga0157374_10898218 3300013296 Bacteria 903
71 Ga0157378_10137564 3300013297 Bacteria 2265
72 Ga0157372_10311837 3300013307 Bacteria 1831
73 Ga0157372_10496238 3300013307 Bacteria 1423
74 Ga0157372_10539395 3300013307 Bacteria 1360
75 Ga0157375_10017817 3300013308 Bacteria 6423
76 Ga0163163_12648491 3300014325 Bacteria 559
77 Ga0157380_10742067 3300014326 Bacteria 992
78 Ga0157377_11232791 3300014745 Bacteria 581
79 Ga0157379_10340791 3300014968 Bacteria 1371
80 Ga0157376_10043237 3300014969 Bacteria 3697
81 Ga0163161_10724446 3300017792 Bacteria 830
82 Ga0163161_10741239 3300017792 Bacteria 821
83 Ga0206356_11751969 3300020070 Bacteria 2641
84 Ga0206354_10625483 3300020081 Bacteria 5371
85 Ga0206353_11560388 3300020082 Bacteria 4724
86 Ga0207688_10062014 3300025901 Bacteria 2108
87 Ga0207699_10466415 3300025906 Bacteria 908
88 Ga0207645_11057288 3300025907 Bacteria 548
89 Ga0207693_10019881 3300025915 Bacteria 5341
90 Ga0207663_10967367 3300025916 Bacteria 682
91 Ga0207660_10096834 3300025917 Bacteria 2198
92 Ga0207662_10620854 3300025918 Bacteria 753
93 Ga0207657_10106456 3300025919 Bacteria 2320
94 Ga0207652_10121633 3300025921 Bacteria 2323
95 Ga0207646_10831344 3300025922 Bacteria 821
96 Ga0207694_11103357 3300025924 Bacteria 671
97 Ga0207687_10003659 3300025927 Bacteria 10358
98 Ga0207687_10005687 3300025927 Bacteria 8241
99 Ga0207644_10343581 3300025931 Bacteria 1211
100 Ga0207706_10001340 3300025933 Bacteria 24589
101 Ga0207686_10258005 3300025934 Bacteria 1277
102 Ga0207670_10044693 3300025936 Bacteria 2932
103 Ga0207669_10163086 3300025937 Bacteria 1577
104 Ga0207704_10320465 3300025938 Bacteria 1195
105 Ga0207661_10752112 3300025944 Bacteria 897
106 Ga0207667_10102587 3300025949 Bacteria 2951
107 Ga0207651_10189310 3300025960 Bacteria 1640
108 Ga0207712_10029323 3300025961 Bacteria 3690
109 Ga0207712_10178976 3300025961 Bacteria 1664
110 Ga0207668_10061503 3300025972 Bacteria 2641
111 Ga0207668_10392504 3300025972 Bacteria 1171
112 Ga0207677_10028039 3300026023 Bacteria 3556
113 Ga0207708_10114421 3300026075 Bacteria 2097
114 Ga0207708_10159575 3300026075 Bacteria 1780
115 Ga0207648_10745105 3300026089 Bacteria 910
116 Ga0207675_100001652 3300026118 Bacteria 22310
117 Ga0207683_10019682 3300026121 Bacteria 5768
118 Ga0268265_10944907 3300028380 Bacteria 849
119 Ga0307408_101572948 3300031548 Bacteria 624
120 Ga0307413_10290020 3300031824 Bacteria 1235
121 Ga0307410_10019333 3300031852 Bacteria 4141
122 Ga0307406_10138475 3300031901 Bacteria 1719
123 Ga0307407_10005224 3300031903 Bacteria 5605
124 Ga0307412_10029834 3300031911 Bacteria 3427
125 Ga0307409_100058897 3300031995 Bacteria 2986
126 Ga0307414_10034091 3300032004 Bacteria 3371
127 Ga0307411_10117857 3300032005 Bacteria 1914
128 Ga0307415_100320190 3300032126 Bacteria 1293
129 Ga0307415_100324287 3300032126 Bacteria 1285
130 Ga0307415_101497958 3300032126 Bacteria 645
131 Ga0373944_0110600 3300035089 Unclassified 938
132 Ga0373923_0196944 3300035111 Bacteria 930
133 Ga0373953_0243069 3300035117 Bacteria 782
134 Ga0373954_0472860 3300035118 Bacteria 621
135 Ga0373956_0092708 3300035119 Bacteria 1395
136 Ga0373943_0439872 3300035170 Bacteria 757
137 Ga0373943_0658563 3300035170 Bacteria 619
138 Ga0373955_0007292 3300035172 Bacteria 5077
139 Ga0373924_0003325 3300035410 Bacteria 5519
140 Ga0373931_0228083 3300035691 Bacteria 1124
141 Ga0373933_0240140 3300035724 Bacteria 1165
142 Ga0373937_0095903 3300036401 Bacteria 2750
143 Ga0395900_0189085 3300037418 Bacteria 2089
144 Ga0395900_1234819 3300037418 Bacteria 662
145 Ga0395900_1609537 3300037418 Bacteria 561
146 Ga0395898_0091338 3300037466 Bacteria 2929
147 Ga0395898_0568134 3300037466 Bacteria 1076
148 Ga0395905_0090248 3300037471 Bacteria 2872
149 Ga0395905_0158842 3300037471 Bacteria 2125
150 Ga0436360_1274312 3300039438 Bacteria 815
151 Ga0436362_0742961 3300039453 Bacteria 2868
152 Ga0451807_1259298 3300041486 Unclassified 786
153 Ga0439459_0066352 3300042438 Bacteria 826
154 Ga0466966_0159980 3300044684 Bacteria 1371
155 Ga0466963_0694456 3300044694 Bacteria 718
156 Ga0466963_0805847 3300044694 Bacteria 662
157 Ga0466964_0068814 3300044706 Bacteria 1491
158 Ga0466964_0560846 3300044706 Bacteria 621
159 Ga0466968_0711959 3300044735 Bacteria 513
160 Ga0466960_0340567 3300044901 Bacteria 853
161 Ga0466958_0450002 3300045836 Bacteria 834
162 Ga0466967_0004134 3300045976 Bacteria 9704
163 Ga0466967_0288656 3300045976 Bacteria 1575
164 Ga0466967_1568751 3300045976 Bacteria 656
165 Ga0495592_0100735 3300046454 Bacteria 2059
166 Ga0495629_0495539 3300046459 Bacteria 824
167 Ga0495641_0163239 3300046461 Bacteria 996
168 Ga0495641_0454979 3300046461 Bacteria 583
169 Ga0495651_0032276 3300046462 Bacteria 4085
170 Ga0495653_0334658 3300046463 Bacteria 977
171 Ga0495584_0623437 3300046491 Bacteria 550
172 Ga0495594_0316734 3300046499 Unclassified 889
173 Ga0495596_0325123 3300046500 Bacteria 598
174 Ga0495608_0031040 3300046511 Bacteria 3614
175 Ga0495618_0465299 3300046514 Bacteria 766
176 Ga0495628_0024643 3300046516 Bacteria 4922
177 Ga0495630_0562334 3300046517 Bacteria 874
178 Ga0495652_0058689 3300046529 Bacteria 3257
179 Ga0495640_0094591 3300046533 Bacteria 1968
180 Ga0495587_0012643 3300046536 Bacteria 5309
181 Ga0495645_0088548 3300046543 Bacteria 2214
182 Ga0495656_0021459 3300046615 Bacteria 2515
183 Ga0495635_0070530 3300046663 Bacteria 2395
184 Ga0495657_0019730 3300046675 Bacteria 4859
185 Ga0495599_0047559 3300046678 Bacteria 2688
186 Ga0495623_0051495 3300046679 Bacteria 2604
187 Ga0495646_0236493 3300046680 Unclassified 983
188 Ga0495613_0316497 3300046689 Bacteria 1078
189 Ga0495600_0040447 3300046809 Bacteria 3036
190 Ga0495604_0004659 3300047317 Bacteria 10872
191 Ga0495674_0050932 3300047319 Bacteria 3652
192 Ga0495676_0138086 3300047321 Bacteria 1750
193 Ga0495676_0278418 3300047321 Unclassified 1133
194 Ga0495675_0019012 3300047444 Bacteria 4363
195 Ga0495684_0067143 3300047471 Bacteria 2727
196 Ga0496100_0429120 3300048903 Bacteria 1010
197 Ga0496101_0026454 3300048904 Bacteria 4034
198 Ga0496102_0025122 3300048905 Bacteria 5299
199 Ga0496103_0097699 3300048906 Bacteria 1856
200 Ga0496104_0005470 3300048907 Bacteria 11124
201 Ga0496105_0011296 3300048908 Bacteria 7050
202 Ga0496105_1186822 3300048908 Bacteria 562
203 Ga0496106_0016157 3300048909 Bacteria 5521
204 Ga0496107_0032418 3300048910 Bacteria 3734
205 Ga0496108_0219851 3300048911 Bacteria 1650
206 Ga0496108_0405581 3300048911 Bacteria 1190
207 Ga0496109_0087693 3300048912 Bacteria 2874
208 Ga0496109_0807529 3300048912 Bacteria 876
209 Ga0496110_0036637 3300048913 Bacteria 4260
210 Ga0496110_0613004 3300048913 Bacteria 987
211 Ga0496111_0020086 3300048914 Bacteria 4646
212 Ga0496112_0301217 3300048915 Bacteria 1548
213 Ga0496112_0747265 3300048915 Bacteria 904
214 Ga0496113_0038747 3300048916 Bacteria 3505
215 Ga0496113_1169580 3300048916 Bacteria 601
216 Ga0496114_0089416 3300048917 Bacteria 2613
217 Ga0496115_0008308 3300048918 Bacteria 7675
218 Ga0501031_0038097 3300049568 Unclassified 3138
219 Ga0501036_0389669 3300049572 Bacteria 1162
220 Ga0501036_0550590 3300049572 Bacteria 959
221 Ga0501038_0095179 3300049574 Bacteria 2488
222 Ga0501039_0332287 3300049575 Bacteria 1194
223 Ga0501039_1135105 3300049575 Bacteria 605
224 Ga0501040_0028961 3300049576 Bacteria 3735
225 Ga0501040_0070011 3300049576 Bacteria 2420
226 Ga0501041_0100028 3300049577 Bacteria 1794
227 Ga0501041_0384216 3300049577 Bacteria 888
228 Ga0501042_0043618 3300049578 Bacteria 3194
229 Ga0501043_0469482 3300049579 Bacteria 943
230 Ga0501046_0054310 3300049580 Bacteria 3152
231 Ga0501046_0061235 3300049580 Unclassified 2943
232 Ga0501048_0020596 3300049582 Bacteria 4833
233 Ga0501048_0715842 3300049582 Bacteria 719
234 Ga0501067_0570034 3300049583 Bacteria 634
235 Ga0501068_0049358 3300049584 Bacteria 2542
236 Ga0501068_0217655 3300049584 Bacteria 1213
237 Ga0501069_0000690 3300049585 Bacteria 15734
238 Ga0501071_0024827 3300049587 Bacteria 4193
239 Ga0501072_0020653 3300049588 Bacteria 5103
240 Ga0501072_0038347 3300049588 Bacteria 3760
241 Ga0501074_0055034 3300049590 Bacteria 2868
242 Ga0501076_0045876 3300049592 Bacteria 3451
243 Ga0501076_0281860 3300049592 Bacteria 1361
244 Ga0501077_0016055 3300049593 Bacteria 4717
245 Ga0501079_0029629 3300049741 Bacteria 4203
246 Ga0501079_0048857 3300049741 Bacteria 3265
247 Ga0501080_0713381 3300049742 Bacteria 884
248 Ga0501081_0016756 3300049743 Bacteria 4844
249 Ga0501081_0040263 3300049743 Bacteria 3199
250 Ga0501081_0557555 3300049743 Unclassified 856
251 Ga0501045_0431933 3300049824 Bacteria 979
252 Ga0501045_0545381 3300049824 Bacteria 860
253 nmdc:mga03n38_567777_c1 3300050490 Bacteria 643
254 nmdc:mga06z11_801103_c1 3300050494 Bacteria 574
255 nmdc:mga05p37_1218074_c1 3300050507 Bacteria 776
256 nmdc:mga05p37_74349_c1 3300050507 Bacteria 4182
257 nmdc:mga09592_687494_c1 3300050508 Bacteria 871
258 nmdc:mga0qj67_171526_c1 3300050509 Bacteria 1761
259 nmdc:mga06r32_302170_c1 3300050510 Bacteria 1586
260 nmdc:mga06r32_663322_c1 3300050510 Bacteria 1010
261 nmdc:mga08y16_1633330_c1 3300050511 Bacteria 601
262 nmdc:mga08y16_384378_c1 3300050511 Bacteria 1438
263 nmdc:mga08y16_431371_c1 3300050511 Bacteria 1346
264 nmdc:mga08y16_563136_c1 3300050511 Unclassified 1152
265 nmdc:mga0n895_189397_c1 3300050512 Bacteria 2088
266 nmdc:mga0a205_752195_c1 3300050515 Bacteria 823
267 Ga0495612_0129451 3300053078 Unclassified 1090
268 Ga0495619_0015663 3300053085 Bacteria 4800
269 Ga0501084_1402174 3300054114 Bacteria 585
270 Ga0501082_0033534 3300060353 Bacteria 4430
271 Ga0501082_0304564 3300060353 Unclassified 1388
272 Ga0501082_0557670 3300060353 Bacteria 1002
273 Ga0501082_1496190 3300060353 Bacteria 590
274 Ga0530510_0218774 3300061734 Bacteria 1415
275 Ga0530510_0407004 3300061734 Bacteria 1026
276 Ga0501031_0893140
277 JGI25407J50210_10021911
278 Ga0070676_10501991
279 Ga0070676_10724695
280 Ga0070680_100976318
281 Ga0070682_100353784
282 Ga0068868_100035161
283 Ga0070660_100809784
284 Ga0070691_10049275
285 Ga0070668_100011314
286 Ga0070668_100111792
287 Ga0070671_100710467
288 Ga0070674_100129840
289 Ga0070709_10772718
290 Ga0070710_10485528
291 Ga0070711_100009858
292 Ga0070700_100027208
293 Ga0070694_100372343
294 Ga0070708_100930463
295 Ga0070678_100094304
296 Ga0070662_100007353
297 Ga0070685_10056489
298 Ga0070707_100536518
299 Ga0070698_100443618
300 Ga0070679_100079565
301 Ga0070686_100473220
302 Ga0070686_101394374
303 Ga0070695_100423714
304 Ga0070696_100128999
305 Ga0070704_100039450
306 Ga0068855_100074509
307 Ga0068854_100096660
308 Ga0068861_100008041
309 Ga0068851_10530881
310 Ga0081538_10000243
311 Ga0081538_10002886
312 Ga0081538_10019175
313 Ga0081538_10027522
314 Ga0075363_100358829
315 Ga0070715_10048490
316 Ga0070712_100058567
317 Ga0075367_10032683
318 Ga0075428_100409859
319 Ga0075430_100403632
320 Ga0075430_101764590
321 Ga0075431_100603002
322 Ga0075431_101392539
323 Ga0075434_100128371
324 Ga0075434_100845593
325 Ga0068865_100341020
326 Ga0075435_100744403
327 Ga0105250_10575375
328 Ga0111539_10199296
329 Ga0111539_11085645
330 Ga0111539_12076505
331 Ga0105245_10001984
332 Ga0105245_10025582
333 Ga0105245_12173415
334 Ga0114129_10338827
335 Ga0114129_12147602
336 Ga0114129_12264594
337 Ga0114129_13378612
338 Ga0105242_10255678
339 Ga0105249_10012450
340 Ga0105249_10215492
341 Ga0105249_10748037
342 Ga0105239_10436363
343 Ga0105239_10542770
344 Ga0157370_11122540
345 Ga0157374_10898218
346 Ga0157378_10137564
347 Ga0157372_10311837
348 Ga0157372_10496238
349 Ga0157372_10539395
350 Ga0157375_10017817
351 Ga0163163_12648491
352 Ga0157380_10742067
353 Ga0157377_11232791
354 Ga0157379_10340791
355 Ga0157376_10043237
356 Ga0163161_10724446
357 Ga0163161_10741239
358 Ga0206356_11751969
359 Ga0206354_10625483
360 Ga0206353_11560388
361 Ga0207688_10062014
362 Ga0207699_10466415
363 Ga0207645_11057288
364 Ga0207693_10019881
365 Ga0207663_10967367
366 Ga0207660_10096834
367 Ga0207662_10620854
368 Ga0207657_10106456
369 Ga0207652_10121633
370 Ga0207646_10831344
371 Ga0207694_11103357
372 Ga0207687_10003659
373 Ga0207687_10005687
374 Ga0207644_10343581
375 Ga0207706_10001340
376 Ga0207686_10258005
377 Ga0207670_10044693
378 Ga0207669_10163086
379 Ga0207704_10320465
380 Ga0207661_10752112
381 Ga0207667_10102587
382 Ga0207651_10189310
383 Ga0207712_10029323
384 Ga0207712_10178976
385 Ga0207668_10061503
386 Ga0207668_10392504
387 Ga0207677_10028039
388 Ga0207708_10114421
389 Ga0207708_10159575
390 Ga0207648_10745105
391 Ga0207675_100001652
392 Ga0207683_10019682
393 Ga0268265_10944907
394 Ga0307408_101572948
395 Ga0307413_10290020
396 Ga0307410_10019333
397 Ga0307406_10138475
398 Ga0307407_10005224
399 Ga0307412_10029834
400 Ga0307409_100058897
401 Ga0307414_10034091
402 Ga0307411_10117857
403 Ga0307415_100320190
404 Ga0307415_100324287
405 Ga0307415_101497958
406 Ga0373944_0110600
407 Ga0373923_0196944
408 Ga0373953_0243069
409 Ga0373954_0472860
410 Ga0373956_0092708
411 Ga0373943_0439872
412 Ga0373943_0658563
413 Ga0373955_0007292
414 Ga0373924_0003325
415 Ga0373931_0228083
416 Ga0373933_0240140
417 Ga0373937_0095903
418 Ga0395900_0189085
419 Ga0395900_1234819
420 Ga0395900_1609537
421 Ga0395898_0091338
422 Ga0395898_0568134
423 Ga0395905_0090248
424 Ga0395905_0158842
425 Ga0436360_1274312
426 Ga0436362_0742961
427 Ga0451807_1259298
428 Ga0439459_0066352
429 Ga0466966_0159980
430 Ga0466963_0694456
431 Ga0466963_0805847
432 Ga0466964_0068814
433 Ga0466964_0560846
434 Ga0466968_0711959
435 Ga0466960_0340567
436 Ga0466958_0450002
437 Ga0466967_0004134
438 Ga0466967_0288656
439 Ga0466967_1568751
440 Ga0495592_0100735
441 Ga0495629_0495539
442 Ga0495641_0163239
443 Ga0495641_0454979
444 Ga0495651_0032276
445 Ga0495653_0334658
446 Ga0495584_0623437
447 Ga0495594_0316734
448 Ga0495596_0325123
449 Ga0495608_0031040
450 Ga0495618_0465299
451 Ga0495628_0024643
452 Ga0495630_0562334
453 Ga0495652_0058689
454 Ga0495640_0094591
455 Ga0495587_0012643
456 Ga0495645_0088548
457 Ga0495656_0021459
458 Ga0495635_0070530
459 Ga0495657_0019730
460 Ga0495599_0047559
461 Ga0495623_0051495
462 Ga0495646_0236493
463 Ga0495613_0316497
464 Ga0495600_0040447
465 Ga0495604_0004659
466 Ga0495674_0050932
467 Ga0495676_0138086
468 Ga0495676_0278418
469 Ga0495675_0019012
470 Ga0495684_0067143
471 Ga0496100_0429120
472 Ga0496101_0026454
473 Ga0496102_0025122
474 Ga0496103_0097699
475 Ga0496104_0005470
476 Ga0496105_0011296
477 Ga0496105_1186822
478 Ga0496106_0016157
479 Ga0496107_0032418
480 Ga0496108_0219851
481 Ga0496108_0405581
482 Ga0496109_0087693
483 Ga0496109_0807529
484 Ga0496110_0036637
485 Ga0496110_0613004
486 Ga0496111_0020086
487 Ga0496112_0301217
488 Ga0496112_0747265
489 Ga0496113_0038747
490 Ga0496113_1169580
491 Ga0496114_0089416
492 Ga0496115_0008308
493 Ga0501031_0038097
494 Ga0501036_0389669
495 Ga0501036_0550590
496 Ga0501038_0095179
497 Ga0501039_0332287
498 Ga0501039_1135105
499 Ga0501040_0028961
500 Ga0501040_0070011
501 Ga0501041_0100028
502 Ga0501041_0384216
503 Ga0501042_0043618
504 Ga0501043_0469482
505 Ga0501046_0054310
506 Ga0501046_0061235
507 Ga0501048_0020596
508 Ga0501048_0715842
509 Ga0501067_0570034
510 Ga0501068_0049358
511 Ga0501068_0217655
512 Ga0501069_0000690
513 Ga0501071_0024827
514 Ga0501072_0020653
515 Ga0501072_0038347
516 Ga0501074_0055034
517 Ga0501076_0045876
518 Ga0501076_0281860
519 Ga0501077_0016055
520 Ga0501079_0029629
521 Ga0501079_0048857
522 Ga0501080_0713381
523 Ga0501081_0016756
524 Ga0501081_0040263
525 Ga0501081_0557555
526 Ga0501045_0431933
527 Ga0501045_0545381
528 nmdc:mga03n38_567777_c1
529 nmdc:mga06z11_801103_c1
530 nmdc:mga05p37_1218074_c1
531 nmdc:mga05p37_74349_c1
532 nmdc:mga09592_687494_c1
533 nmdc:mga0qj67_171526_c1
534 nmdc:mga06r32_302170_c1
535 nmdc:mga06r32_663322_c1
536 nmdc:mga08y16_1633330_c1
537 nmdc:mga08y16_384378_c1
538 nmdc:mga08y16_431371_c1
539 nmdc:mga08y16_563136_c1
540 nmdc:mga0n895_189397_c1
541 nmdc:mga0a205_752195_c1
542 Ga0495612_0129451
543 Ga0495619_0015663
544 Ga0501084_1402174
545 Ga0501082_0033534
546 Ga0501082_0304564
547 Ga0501082_0557670
548 Ga0501082_1496190
549 Ga0530510_0218774
550 Ga0530510_0407004

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04993

TfoX_N

TfoX N-terminal domain

34

125

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.6734 8 111
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.668 9 102
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.6639 7 108
6i7v-assembly1.cif.gz_C5 ribosomal protein paralogs bl31 and bl36 0.6412 11 37
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.6311 8 111
ID Description Score Start End Superfamily
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7424 5 108 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7345 9 108 3.90.1150.30
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7248 8 98 3.90.1150.30
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.699 5 108 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6689 9 108 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A6J4THZ5-F1-model_v4 Uncharacterized protein 0.9918 50 108
AF-A0A7I7WJ16-F1-model_v4 TfoX N-terminal domain-containing protein 0.9908 2 110
AF-I4EQR7-F1-model_v4 TfoX N-terminal domain-containing protein 0.9885 2 108
AF-A0A7V9DNC1-F1-model_v4 TfoX/Sxy family protein 0.9874 1 111
AF-A0A4R8J6C8-F1-model_v4 deleted 0.9874 5 110

Map