F380641

General Info

Members Datasets Scaffolds Average Seq Length
275 186 550 190

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0119426|Ga0495628_0119426_919_1548
Length 209
Sequence MANVAELALIQDIKDKETRMRTLISSAFISLDGVMEGPGGETGYRNAGWTFKDVEFVPEAYEIKGREQEEAGAVMLGRVSYEAFSPVWPDMQEFARYKTLPKYIVSTTLADADLVSNWGESTILRSLDEVAALKKTEGGPIIVHGSVALNHALSDAGLIDRYNLLVFPLLLGAGKRLFSAADKDTQKLKLVESAVYSNGVQKQIFDVVR

Samples

Sample ID Description Type Environment
1 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
64 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
65 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
66 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
67 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
70 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
71 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
72 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
73 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
79 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
82 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
83 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
89 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
90 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
91 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
94 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
95 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
98 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
99 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
119 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
127 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
128 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
151 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
165 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
166 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
167 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
168 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
169 2558860280 Kutzneria sp. 744 Isolate Unclassified
170 2626541554 Frankia sp. AvcI.1 Isolate Nodule
171 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
172 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
173 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
174 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
175 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
176 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
177 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
178 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
179 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
180 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
181 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
182 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
183 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
184 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
185 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
186 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.36
Metatranscriptomes 0.73
Isolates 6.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.82
Nodule 0.36
Rhizoplane 11.64
Rhizosphere 76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495628_0119426 3300046516 Bacteria 2023
2 JGI25405J52794_10033103 3300003911 Bacteria 1078
3 Ga0070683_100908903 3300005329 Bacteria 844
4 Ga0070668_100154024 3300005347 Bacteria 1861
5 Ga0070671_100187029 3300005355 Bacteria 1755
6 Ga0070709_10106450 3300005434 Bacteria 1877
7 Ga0070714_100262595 3300005435 Bacteria 1599
8 Ga0070713_100041401 3300005436 Bacteria 3753
9 Ga0070713_100362774 3300005436 Bacteria 1346
10 Ga0070713_100475557 3300005436 Bacteria 1176
11 Ga0070710_10131490 3300005437 Bacteria 1526
12 Ga0070711_100043212 3300005439 Bacteria 3051
13 Ga0070700_100800637 3300005441 Bacteria 759
14 Ga0070663_100043880 3300005455 Bacteria 3149
15 Ga0070706_100495051 3300005467 Bacteria 1137
16 Ga0070698_100099109 3300005471 Bacteria 2887
17 Ga0070697_100003819 3300005536 Bacteria 11568
18 Ga0068853_100584149 3300005539 Bacteria 1060
19 Ga0070665_101061634 3300005548 Bacteria 822
20 Ga0070664_100615653 3300005564 Bacteria 1008
21 Ga0070702_100434653 3300005615 Bacteria 948
22 Ga0068852_100383737 3300005616 Bacteria 1379
23 Ga0068864_100576654 3300005618 Bacteria 1090
24 Ga0068870_10235919 3300005840 Bacteria 1127
25 Ga0068863_100005417 3300005841 Bacteria 12575
26 Ga0081455_10005995 3300005937 Bacteria 13181
27 Ga0081455_10126223 3300005937 Bacteria 2008
28 Ga0081455_10176365 3300005937 Bacteria 1622
29 Ga0070717_10013282 3300006028 Bacteria 6304
30 Ga0070715_10073698 3300006163 Bacteria 1532
31 Ga0070716_100234596 3300006173 Bacteria 1240
32 Ga0070712_100449599 3300006175 Bacteria 1072
33 Ga0070712_100680922 3300006175 Bacteria 875
34 Ga0099795_10055038 3300007788 Bacteria 1460
35 Ga0105245_10309612 3300009098 Bacteria 1552
36 Ga0105247_10093420 3300009101 Bacteria 1912
37 Ga0105243_10084514 3300009148 Bacteria 2599
38 Ga0105243_10966043 3300009148 Bacteria 852
39 Ga0157371_10626030 3300013102 Bacteria 802
40 Ga0157374_10313822 3300013296 Bacteria 1553
41 Ga0157374_11088706 3300013296 Bacteria 819
42 Ga0163162_10097438 3300013306 Bacteria 3029
43 Ga0157372_10689183 3300013307 Bacteria 1189
44 Ga0157372_11004644 3300013307 Bacteria 966
45 Ga0157375_10856724 3300013308 Bacteria 1055
46 Ga0163163_10024154 3300014325 Bacteria 5783
47 Ga0157379_10073218 3300014968 Bacteria 3066
48 Ga0163161_10420179 3300017792 Bacteria 1075
49 Ga0206350_10536675 3300020080 Bacteria 1360
50 Ga0224712_10011999 3300022467 Bacteria 2709
51 Ga0207692_10732277 3300025898 Bacteria 643
52 Ga0207710_10051929 3300025900 Bacteria 1842
53 Ga0207688_10290120 3300025901 Bacteria 998
54 Ga0207685_10100183 3300025905 Bacteria 1237
55 Ga0207699_10275664 3300025906 Bacteria 1167
56 Ga0207705_10267094 3300025909 Bacteria 1307
57 Ga0207693_10212418 3300025915 Bacteria 1521
58 Ga0207646_10126285 3300025922 Bacteria 2300
59 Ga0207687_10160276 3300025927 Bacteria 1726
60 Ga0207700_10120916 3300025928 Bacteria 2123
61 Ga0207700_10219199 3300025928 Bacteria 1612
62 Ga0207664_10089445 3300025929 Bacteria 2521
63 Ga0207664_10995228 3300025929 Bacteria 751
64 Ga0207709_10218289 3300025935 Bacteria 1373
65 Ga0207665_10074876 3300025939 Bacteria 2318
66 Ga0207661_10568814 3300025944 Bacteria 1039
67 Ga0207679_11128777 3300025945 Bacteria 719
68 Ga0207668_10207643 3300025972 Bacteria 1564
69 Ga0207641_10004146 3300026088 Bacteria 12632
70 Ga0307517_10024675 3300028786 Bacteria 7394
71 Ga0307515_10001878 3300028794 Bacteria 46732
72 Ga0307515_10294460 3300028794 Bacteria 1315
73 Ga0307515_10465313 3300028794 Bacteria 878
74 Ga0265338_10002792 3300028800 Bacteria 25536
75 Ga0265338_10004654 3300028800 Bacteria 18432
76 Ga0307512_10197459 3300030522 Bacteria 1096
77 Ga0307509_10041314 3300031507 Bacteria 5005
78 Ga0307509_10185926 3300031507 Bacteria 1936
79 Ga0307509_10265703 3300031507 Bacteria 1487
80 Ga0307514_10192550 3300031649 Bacteria 1296
81 Ga0307516_10424211 3300031730 Bacteria 988
82 Ga0307518_10057275 3300031838 Bacteria 2831
83 Ga0307415_100835116 3300032126 Bacteria 844
84 Ga0307507_10019741 3300033179 Bacteria 7580
85 Ga0307507_10031944 3300033179 Bacteria 5511
86 Ga0307510_10004939 3300033180 Bacteria 15782
87 Ga0307510_10284314 3300033180 Bacteria 1123
88 Ga0373934_0332209 3300035086 Bacteria 632
89 Ga0373956_0161605 3300035119 Bacteria 1056
90 Ga0373960_0189742 3300035121 Bacteria 722
91 Ga0373927_0344664 3300035695 Bacteria 982
92 Ga0373933_0047757 3300035724 Bacteria 2547
93 Ga0373947_0630263 3300035725 Bacteria 731
94 Ga0373937_0108946 3300036401 Bacteria 2575
95 Ga0466969_0036610 3300044656 Bacteria 2478
96 Ga0466969_0051752 3300044656 Bacteria 2020
97 Ga0466961_0038870 3300044693 Bacteria 3052
98 Ga0466961_0108074 3300044693 Bacteria 1751
99 Ga0466961_0206840 3300044693 Bacteria 1212
100 Ga0466961_0409357 3300044693 Bacteria 823
101 Ga0466963_0317661 3300044694 Bacteria 1096
102 Ga0466971_0012660 3300044719 Bacteria 3699
103 Ga0466971_0020500 3300044719 Bacteria 2939
104 Ga0466970_0260918 3300044765 Bacteria 972
105 Ga0466959_0004485 3300045049 Bacteria 9352
106 Ga0466959_0061351 3300045049 Bacteria 2734
107 Ga0466958_0191338 3300045836 Bacteria 1300
108 Ga0466958_0648634 3300045836 Bacteria 687
109 Ga0495592_0008043 3300046454 Bacteria 7919
110 Ga0495592_0135881 3300046454 Bacteria 1715
111 Ga0495592_0631955 3300046454 Bacteria 650
112 Ga0495629_0015753 3300046459 Bacteria 5429
113 Ga0495651_0003776 3300046462 Bacteria 11585
114 Ga0495651_0017256 3300046462 Bacteria 5592
115 Ga0495651_0058493 3300046462 Bacteria 2957
116 Ga0495651_0092509 3300046462 Bacteria 2265
117 Ga0495653_0130670 3300046463 Bacteria 1778
118 Ga0495653_0282106 3300046463 Bacteria 1090
119 Ga0495580_0858720 3300046472 Bacteria 585
120 Ga0495639_0024414 3300046475 Bacteria 2662
121 Ga0495662_0232610 3300046476 Bacteria 908
122 Ga0495664_0014354 3300046477 Bacteria 4490
123 Ga0495664_0026613 3300046477 Bacteria 3369
124 Ga0495664_0223704 3300046477 Bacteria 1139
125 Ga0495583_0047942 3300046506 Bacteria 1962
126 Ga0495616_0148799 3300046513 Bacteria 1061
127 Ga0495618_0331958 3300046514 Bacteria 940
128 Ga0495628_0005291 3300046516 Bacteria 11319
129 Ga0495628_0120296 3300046516 Bacteria 2015
130 Ga0495628_0182527 3300046516 Bacteria 1587
131 Ga0495628_0320497 3300046516 Bacteria 1144
132 Ga0495630_0088940 3300046517 Bacteria 2333
133 Ga0495643_0000878 3300046522 Bacteria 32006
134 Ga0495648_0003505 3300046524 Bacteria 13757
135 Ga0495666_0153885 3300046526 Bacteria 1068
136 Ga0495652_0000734 3300046529 Bacteria 37934
137 Ga0495652_0006436 3300046529 Bacteria 10920
138 Ga0495652_0019322 3300046529 Bacteria 6070
139 Ga0495652_0562104 3300046529 Bacteria 783
140 Ga0495586_0038682 3300046535 Bacteria 2563
141 Ga0495586_0431410 3300046535 Bacteria 759
142 Ga0495587_0001732 3300046536 Bacteria 14563
143 Ga0495587_0016355 3300046536 Bacteria 4616
144 Ga0495597_0026055 3300046542 Bacteria 2688
145 Ga0495645_0025620 3300046543 Bacteria 4282
146 Ga0495645_0036874 3300046543 Bacteria 3564
147 Ga0495645_0187481 3300046543 Bacteria 1412
148 Ga0495645_0264394 3300046543 Bacteria 1138
149 Ga0495667_0085257 3300046559 Bacteria 2050
150 Ga0495667_0162258 3300046559 Bacteria 1438
151 Ga0495667_0547119 3300046559 Bacteria 723
152 Ga0495668_0040953 3300046616 Bacteria 2582
153 Ga0495634_0600785 3300046642 Bacteria 638
154 Ga0495611_0028254 3300046648 Bacteria 2455
155 Ga0495625_0025408 3300046660 Bacteria 4493
156 Ga0495635_0000272 3300046663 Bacteria 33271
157 Ga0495635_0025529 3300046663 Bacteria 4116
158 Ga0495635_0101913 3300046663 Bacteria 1962
159 Ga0495588_0001466 3300046674 Bacteria 10126
160 Ga0495657_0000089 3300046675 Bacteria 81161
161 Ga0495657_0104457 3300046675 Bacteria 1801
162 Ga0495657_0200784 3300046675 Bacteria 1215
163 Ga0495657_0283378 3300046675 Bacteria 991
164 Ga0495599_0011244 3300046678 Bacteria 5497
165 Ga0495623_0168581 3300046679 Bacteria 1281
166 Ga0495623_0194498 3300046679 Bacteria 1170
167 Ga0495646_0006161 3300046680 Bacteria 7606
168 Ga0495646_0049469 3300046680 Bacteria 2551
169 Ga0495646_0165568 3300046680 Bacteria 1221
170 Ga0495613_0004433 3300046689 Bacteria 10514
171 Ga0495613_0022062 3300046689 Bacteria 4745
172 Ga0495624_0271907 3300046690 Bacteria 1024
173 Ga0495649_0017068 3300046694 Bacteria 4105
174 Ga0495589_0002691 3300046794 Bacteria 9828
175 Ga0495600_0006873 3300046809 Bacteria 6937
176 Ga0495600_0022287 3300046809 Bacteria 4066
177 Ga0495600_0119924 3300046809 Bacteria 1711
178 Ga0495600_0302628 3300046809 Bacteria 1008
179 Ga0495581_0136647 3300047315 Bacteria 1429
180 Ga0495604_0000922 3300047317 Bacteria 24470
181 Ga0495604_0057167 3300047317 Bacteria 3000
182 Ga0495604_0143438 3300047317 Bacteria 1704
183 Ga0495674_0074081 3300047319 Bacteria 2934
184 Ga0495674_0155930 3300047319 Bacteria 1913
185 Ga0495674_0919425 3300047319 Bacteria 674
186 Ga0495676_0025737 3300047321 Bacteria 5075
187 Ga0495680_0012606 3300047322 Bacteria 7428
188 Ga0495683_0209810 3300047323 Bacteria 874
189 Ga0495687_025659 3300047443 Bacteria 2782
190 Ga0495685_084983 3300047447 Bacteria 1052
191 Ga0495684_0033349 3300047471 Bacteria 3950
192 Ga0495684_0074508 3300047471 Bacteria 2579
193 Ga0495686_0212121 3300047472 Bacteria 1106
194 Ga0495593_0018726 3300047673 Bacteria 3888
195 Ga0495593_0027563 3300047673 Bacteria 3126
196 Ga0495602_0185287 3300048088 Bacteria 1601
197 Ga0495602_0479666 3300048088 Bacteria 873
198 Ga0495602_0567492 3300048088 Bacteria 784
199 Ga0495614_0011003 3300048089 Bacteria 3981
200 Ga0496100_0010352 3300048903 Bacteria 5277
201 Ga0496101_0022746 3300048904 Bacteria 4319
202 Ga0496101_0208841 3300048904 Bacteria 1512
203 Ga0496102_0000286 3300048905 Bacteria 64518
204 Ga0496102_0034055 3300048905 Bacteria 4581
205 Ga0496103_0000490 3300048906 Bacteria 32894
206 Ga0496103_0335890 3300048906 Bacteria 972
207 Ga0496104_0015609 3300048907 Bacteria 6885
208 Ga0496104_0211490 3300048907 Bacteria 1851
209 Ga0496104_0391845 3300048907 Bacteria 1301
210 Ga0496105_0025534 3300048908 Bacteria 4810
211 Ga0496105_0642493 3300048908 Bacteria 820
212 Ga0496108_0255766 3300048911 Bacteria 1524
213 Ga0496108_0328299 3300048911 Bacteria 1334
214 Ga0496108_0636926 3300048911 Bacteria 927
215 Ga0496109_0019959 3300048912 Bacteria 5916
216 Ga0496109_0074188 3300048912 Bacteria 3127
217 Ga0496109_0680538 3300048912 Bacteria 966
218 Ga0496110_0015579 3300048913 Bacteria 6331
219 Ga0496110_0276680 3300048913 Bacteria 1528
220 Ga0496111_0014403 3300048914 Bacteria 5401
221 Ga0496111_0090842 3300048914 Bacteria 2237
222 Ga0496111_0116356 3300048914 Bacteria 1972
223 Ga0496111_0253419 3300048914 Bacteria 1306
224 Ga0496112_0045348 3300048915 Bacteria 4310
225 Ga0496112_0556410 3300048915 Bacteria 1081
226 Ga0496113_0079321 3300048916 Bacteria 2513
227 Ga0496114_0052178 3300048917 Bacteria 3407
228 Ga0496114_0098677 3300048917 Bacteria 2491
229 Ga0496114_0189111 3300048917 Bacteria 1801
230 Ga0496114_0255402 3300048917 Bacteria 1542
231 Ga0496114_0307354 3300048917 Bacteria 1400
232 Ga0496116_0000716 3300048919 Bacteria 42501
233 Ga0496117_0000579 3300048920 Bacteria 60223
234 Ga0496118_0000587 3300048921 Bacteria 60205
235 Ga0496119_0001329 3300048922 Bacteria 30377
236 Ga0496120_0002815 3300048923 Bacteria 16800
237 Ga0496121_0015333 3300048924 Bacteria 8041
238 Ga0496124_0010828 3300048927 Bacteria 9184
239 Ga0496126_0000649 3300048929 Bacteria 64480
240 Ga0495678_084937 3300049459 Bacteria 1128
241 Ga0501036_0002875 3300049572 Bacteria 13653
242 Ga0501047_0156326 3300049581 Bacteria 2154
243 Ga0501070_0657347 3300049586 Bacteria 832
244 nmdc:mga00v17_436537_c1 3300050491 Bacteria 850
245 nmdc:mga08x19_391599_c1 3300050514 Bacteria 974
246 Ga0495601_0001239 3300053077 Bacteria 13997
247 Ga0495601_0005059 3300053077 Bacteria 7651
248 Ga0495601_0034040 3300053077 Bacteria 3176
249 Ga0495612_0001105 3300053078 Bacteria 11047
250 Ga0495619_0044062 3300053085 Bacteria 2927
251 Ga0500640_003199 3300053095 Bacteria 5645
252 Ga0500560_065262 3300053107 Bacteria 1193
253 Ga0500560_100957 3300053107 Bacteria 966
254 Ga0500628_169623 3300053129 Bacteria 619
255 Ga0466962_0006946 3300061719 Bacteria 5427
256 Ga0466962_0052960 3300061719 Bacteria 1939
257 2552107459 2551306166 Bacteria 9731570
258 2559425346 2558860280 Bacteria 11429938
259 2626638894 2626541554 Bacteria 7741902
260 2753037384 2751185725 Bacteria 5740550
261 2753325253 2751185792 Bacteria 5739090
262 2819428503 2818991318 Bacteria 5266538
263 2819666127 2818991458 Bacteria 4794049
264 2819692332 2818991462 Bacteria 4320267
265 2819730495 2818991469 Bacteria 4644110
266 2852679634 2852677369 Bacteria 3768884
267 2862286500 2862281513 Bacteria 9621493
268 2875394232 2875391855 Bacteria 7600475
269 2912760969 2912757875 Bacteria 7940295
270 2918505580 2918501144 Bacteria 8668083
271 2932401383 2932398195 Bacteria 3847976
272 2954003256 2954002825 Bacteria 9173742
273 2997455874 2997451912 Bacteria 8492419
274 8001783355 8001781756 Bacteria 9586736
275 8033688611 8033684223 Bacteria 6906479
276 Ga0495628_0119426
277 JGI25405J52794_10033103
278 Ga0070683_100908903
279 Ga0070668_100154024
280 Ga0070671_100187029
281 Ga0070709_10106450
282 Ga0070714_100262595
283 Ga0070713_100041401
284 Ga0070713_100362774
285 Ga0070713_100475557
286 Ga0070710_10131490
287 Ga0070711_100043212
288 Ga0070700_100800637
289 Ga0070663_100043880
290 Ga0070706_100495051
291 Ga0070698_100099109
292 Ga0070697_100003819
293 Ga0068853_100584149
294 Ga0070665_101061634
295 Ga0070664_100615653
296 Ga0070702_100434653
297 Ga0068852_100383737
298 Ga0068864_100576654
299 Ga0068870_10235919
300 Ga0068863_100005417
301 Ga0081455_10005995
302 Ga0081455_10126223
303 Ga0081455_10176365
304 Ga0070717_10013282
305 Ga0070715_10073698
306 Ga0070716_100234596
307 Ga0070712_100449599
308 Ga0070712_100680922
309 Ga0099795_10055038
310 Ga0105245_10309612
311 Ga0105247_10093420
312 Ga0105243_10084514
313 Ga0105243_10966043
314 Ga0157371_10626030
315 Ga0157374_10313822
316 Ga0157374_11088706
317 Ga0163162_10097438
318 Ga0157372_10689183
319 Ga0157372_11004644
320 Ga0157375_10856724
321 Ga0163163_10024154
322 Ga0157379_10073218
323 Ga0163161_10420179
324 Ga0206350_10536675
325 Ga0224712_10011999
326 Ga0207692_10732277
327 Ga0207710_10051929
328 Ga0207688_10290120
329 Ga0207685_10100183
330 Ga0207699_10275664
331 Ga0207705_10267094
332 Ga0207693_10212418
333 Ga0207646_10126285
334 Ga0207687_10160276
335 Ga0207700_10120916
336 Ga0207700_10219199
337 Ga0207664_10089445
338 Ga0207664_10995228
339 Ga0207709_10218289
340 Ga0207665_10074876
341 Ga0207661_10568814
342 Ga0207679_11128777
343 Ga0207668_10207643
344 Ga0207641_10004146
345 Ga0307517_10024675
346 Ga0307515_10001878
347 Ga0307515_10294460
348 Ga0307515_10465313
349 Ga0265338_10002792
350 Ga0265338_10004654
351 Ga0307512_10197459
352 Ga0307509_10041314
353 Ga0307509_10185926
354 Ga0307509_10265703
355 Ga0307514_10192550
356 Ga0307516_10424211
357 Ga0307518_10057275
358 Ga0307415_100835116
359 Ga0307507_10019741
360 Ga0307507_10031944
361 Ga0307510_10004939
362 Ga0307510_10284314
363 Ga0373934_0332209
364 Ga0373956_0161605
365 Ga0373960_0189742
366 Ga0373927_0344664
367 Ga0373933_0047757
368 Ga0373947_0630263
369 Ga0373937_0108946
370 Ga0466969_0036610
371 Ga0466969_0051752
372 Ga0466961_0038870
373 Ga0466961_0108074
374 Ga0466961_0206840
375 Ga0466961_0409357
376 Ga0466963_0317661
377 Ga0466971_0012660
378 Ga0466971_0020500
379 Ga0466970_0260918
380 Ga0466959_0004485
381 Ga0466959_0061351
382 Ga0466958_0191338
383 Ga0466958_0648634
384 Ga0495592_0008043
385 Ga0495592_0135881
386 Ga0495592_0631955
387 Ga0495629_0015753
388 Ga0495651_0003776
389 Ga0495651_0017256
390 Ga0495651_0058493
391 Ga0495651_0092509
392 Ga0495653_0130670
393 Ga0495653_0282106
394 Ga0495580_0858720
395 Ga0495639_0024414
396 Ga0495662_0232610
397 Ga0495664_0014354
398 Ga0495664_0026613
399 Ga0495664_0223704
400 Ga0495583_0047942
401 Ga0495616_0148799
402 Ga0495618_0331958
403 Ga0495628_0005291
404 Ga0495628_0120296
405 Ga0495628_0182527
406 Ga0495628_0320497
407 Ga0495630_0088940
408 Ga0495643_0000878
409 Ga0495648_0003505
410 Ga0495666_0153885
411 Ga0495652_0000734
412 Ga0495652_0006436
413 Ga0495652_0019322
414 Ga0495652_0562104
415 Ga0495586_0038682
416 Ga0495586_0431410
417 Ga0495587_0001732
418 Ga0495587_0016355
419 Ga0495597_0026055
420 Ga0495645_0025620
421 Ga0495645_0036874
422 Ga0495645_0187481
423 Ga0495645_0264394
424 Ga0495667_0085257
425 Ga0495667_0162258
426 Ga0495667_0547119
427 Ga0495668_0040953
428 Ga0495634_0600785
429 Ga0495611_0028254
430 Ga0495625_0025408
431 Ga0495635_0000272
432 Ga0495635_0025529
433 Ga0495635_0101913
434 Ga0495588_0001466
435 Ga0495657_0000089
436 Ga0495657_0104457
437 Ga0495657_0200784
438 Ga0495657_0283378
439 Ga0495599_0011244
440 Ga0495623_0168581
441 Ga0495623_0194498
442 Ga0495646_0006161
443 Ga0495646_0049469
444 Ga0495646_0165568
445 Ga0495613_0004433
446 Ga0495613_0022062
447 Ga0495624_0271907
448 Ga0495649_0017068
449 Ga0495589_0002691
450 Ga0495600_0006873
451 Ga0495600_0022287
452 Ga0495600_0119924
453 Ga0495600_0302628
454 Ga0495581_0136647
455 Ga0495604_0000922
456 Ga0495604_0057167
457 Ga0495604_0143438
458 Ga0495674_0074081
459 Ga0495674_0155930
460 Ga0495674_0919425
461 Ga0495676_0025737
462 Ga0495680_0012606
463 Ga0495683_0209810
464 Ga0495687_025659
465 Ga0495685_084983
466 Ga0495684_0033349
467 Ga0495684_0074508
468 Ga0495686_0212121
469 Ga0495593_0018726
470 Ga0495593_0027563
471 Ga0495602_0185287
472 Ga0495602_0479666
473 Ga0495602_0567492
474 Ga0495614_0011003
475 Ga0496100_0010352
476 Ga0496101_0022746
477 Ga0496101_0208841
478 Ga0496102_0000286
479 Ga0496102_0034055
480 Ga0496103_0000490
481 Ga0496103_0335890
482 Ga0496104_0015609
483 Ga0496104_0211490
484 Ga0496104_0391845
485 Ga0496105_0025534
486 Ga0496105_0642493
487 Ga0496108_0255766
488 Ga0496108_0328299
489 Ga0496108_0636926
490 Ga0496109_0019959
491 Ga0496109_0074188
492 Ga0496109_0680538
493 Ga0496110_0015579
494 Ga0496110_0276680
495 Ga0496111_0014403
496 Ga0496111_0090842
497 Ga0496111_0116356
498 Ga0496111_0253419
499 Ga0496112_0045348
500 Ga0496112_0556410
501 Ga0496113_0079321
502 Ga0496114_0052178
503 Ga0496114_0098677
504 Ga0496114_0189111
505 Ga0496114_0255402
506 Ga0496114_0307354
507 Ga0496116_0000716
508 Ga0496117_0000579
509 Ga0496118_0000587
510 Ga0496119_0001329
511 Ga0496120_0002815
512 Ga0496121_0015333
513 Ga0496124_0010828
514 Ga0496126_0000649
515 Ga0495678_084937
516 Ga0501036_0002875
517 Ga0501047_0156326
518 Ga0501070_0657347
519 nmdc:mga00v17_436537_c1
520 nmdc:mga08x19_391599_c1
521 Ga0495601_0001239
522 Ga0495601_0005059
523 Ga0495601_0034040
524 Ga0495612_0001105
525 Ga0495619_0044062
526 Ga0500640_003199
527 Ga0500560_065262
528 Ga0500560_100957
529 Ga0500628_169623
530 Ga0466962_0006946
531 Ga0466962_0052960
532 2552107459
533 2559425346
534 2626638894
535 2753037384
536 2753325253
537 2819428503
538 2819666127
539 2819692332
540 2819730495
541 2852679634
542 2862286500
543 2875394232
544 2912760969
545 2918505580
546 2932401383
547 2954003256
548 2997455874
549 8001783355
550 8033688611

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

21

202

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oip-assembly3.cif.gz_E-2 crystal structure of the s290g active site mutant of ts-dhfr from cryptosporidium hominis 0.6637 1 143
3i3r-assembly1.cif.gz_B x-ray structure dihydrofolate reductase/thymidylate synthase from babesia bovis at 2.35a resolution 0.6512 2 146
8sze-assembly2.cif.gz_B crystal structure of yersinia pestis dihydrofolate reductase in complex with trimethoprim 0.644 1 180
2oip-assembly2.cif.gz_C crystal structure of the s290g active site mutant of ts-dhfr from cryptosporidium hominis 0.6434 1 143
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.634 1 184
ID Description Score Start End Superfamily
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.6546 2 184 3.40.430.10
3ix9B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.6542 1 175 3.40.430.10
af_Q12465_604_788_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6415 167 188 2.130.10.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.6317 2 184 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.6279 1 184 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A6B3ENU2-F1-model_v4 Dihydrofolate reductase family protein 0.8951 37 117
AF-A0A6B3ENU2-F1-model_v4 Dihydrofolate reductase family protein 0.8656 37 117
AF-A0A434NNI0-F1-model_v4 Dihydrofolate reductase 0.8581 1 151 GO:0008703
GO:0009231
AF-A0A1Q7C0A1-F1-model_v4 Pyrimidine reductase 0.8475 1 138 GO:0008703
GO:0009231
AF-A0A6I4VRN8-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.8416 38 139 GO:0008703
GO:0009231

Map