F380613

General Info

Members Datasets Scaffolds Average Seq Length
275 162 550 161

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0026049|Ga0466958_0026049_285_863
Length 185
Sequence MSLKGGFRDMALIRWEPVRELNTIQNEMNRLFNTFFESPASQGNGAATSRRWIPAMDLVEAGDDFILRADLPGLSEGDVNIELEDNVLTISGQRKSEHEERKEGYYRVERASGTFSRSLTLPEGVDPEKVQAHFDRGVLEVRIPKPEQRKPRKVTISAGGSGTKTIEGAETEGTADPSTPAGATA

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
83 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
84 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
94 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
95 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
96 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
97 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
103 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
104 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
117 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
146 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
161 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
162 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.73
Metatranscriptomes 7.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.91
Rhizosphere 81.45
Stem 0
Stem Tuber 0
Unclassified 16.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0026049 3300045836 Bacteria 3454
2 Ga0070676_10289237 3300005328 Bacteria 1107
3 Ga0070683_100222415 3300005329 Bacteria 1794
4 Ga0068868_100803809 3300005338 Bacteria 849
5 Ga0070660_100296618 3300005339 Bacteria 1325
6 Ga0070692_10295210 3300005345 Bacteria 988
7 Ga0070668_100885834 3300005347 Unclassified 797
8 Ga0070671_100478995 3300005355 Unclassified 1069
9 Ga0070659_100125756 3300005366 Bacteria 2080
10 Ga0070714_100152702 3300005435 Bacteria 2082
11 Ga0070713_100433227 3300005436 Bacteria 1232
12 Ga0070710_10004634 3300005437 Bacteria 6503
13 Ga0070694_101201394 3300005444 Bacteria 635
14 Ga0070708_100417021 3300005445 Unclassified 1266
15 Ga0070663_100876538 3300005455 Bacteria 774
16 Ga0068867_100563486 3300005459 Bacteria 988
17 Ga0070685_10180336 3300005466 Bacteria 1359
18 Ga0070707_100120972 3300005468 Bacteria 2542
19 Ga0070699_100559707 3300005518 Unclassified 1041
20 Ga0070684_100400699 3300005535 Bacteria 1265
21 Ga0070686_100134043 3300005544 Unclassified 1716
22 Ga0070665_101240907 3300005548 Bacteria 756
23 Ga0070664_100071992 3300005564 Bacteria 2964
24 Ga0068857_100508714 3300005577 Bacteria 1131
25 Ga0068856_101650637 3300005614 Unclassified 654
26 Ga0068852_100367872 3300005616 Bacteria 1408
27 Ga0068859_101444203 3300005617 Bacteria 759
28 Ga0070717_10088720 3300006028 Bacteria 2607
29 Ga0070717_10309041 3300006028 Bacteria 1406
30 Ga0070717_10559459 3300006028 Unclassified 1036
31 Ga0070715_10292736 3300006163 Bacteria 868
32 Ga0070712_100020950 3300006175 Bacteria 4285
33 Ga0070712_100631652 3300006175 Bacteria 909
34 Ga0070712_100951416 3300006175 Unclassified 742
35 Ga0075428_100101843 3300006844 Bacteria 3131
36 Ga0097620_101444197 3300006931 Bacteria 759
37 Ga0111539_10171474 3300009094 Bacteria 2535
38 Ga0111539_10204193 3300009094 Bacteria 2304
39 Ga0111539_10361220 3300009094 Bacteria 1690
40 Ga0111539_10561686 3300009094 Bacteria 1329
41 Ga0111539_11069291 3300009094 Bacteria 938
42 Ga0105245_10096238 3300009098 Bacteria 2732
43 Ga0114129_10225114 3300009147 Bacteria 2528
44 Ga0105243_10343323 3300009148 Bacteria 1368
45 Ga0105243_11991454 3300009148 Bacteria 615
46 Ga0105239_10337146 3300010375 Bacteria 1701
47 Ga0157374_10973104 3300013296 Bacteria 867
48 Ga0157377_10501010 3300014745 Bacteria 849
49 Ga0157379_10003199 3300014968 Bacteria 13872
50 Ga0197907_10226898 3300020069 Bacteria 596
51 Ga0206351_10132139 3300020077 Bacteria 610
52 Ga0206351_10720970 3300020077 Bacteria 575
53 Ga0206350_10033649 3300020080 Bacteria 661
54 Ga0206350_10856078 3300020080 Unclassified 628
55 Ga0206350_11209119 3300020080 Bacteria 575
56 Ga0154015_1295031 3300020610 Unclassified 590
57 Ga0154015_1490029 3300020610 Bacteria 523
58 Ga0154015_1641370 3300020610 Bacteria 506
59 Ga0154015_1673236 3300020610 Unclassified 515
60 Ga0213874_10000263 3300021377 Bacteria 10106
61 Ga0213874_10002971 3300021377 Bacteria 3710
62 Ga0213874_10062611 3300021377 Bacteria 1169
63 Ga0213874_10291717 3300021377 Unclassified 612
64 Ga0213876_10031180 3300021384 Bacteria 2814
65 Ga0213876_10033043 3300021384 Bacteria 2727
66 Ga0213876_10070064 3300021384 Bacteria 1852
67 Ga0213876_10150769 3300021384 Bacteria 1236
68 Ga0213876_10314534 3300021384 Bacteria 832
69 Ga0213875_10099456 3300021388 Bacteria 1357
70 Ga0213875_10233270 3300021388 Bacteria 867
71 Ga0213875_10251391 3300021388 Bacteria 834
72 Ga0224712_10112659 3300022467 Bacteria 1169
73 Ga0224712_10115345 3300022467 Bacteria 1157
74 Ga0224712_10146677 3300022467 Bacteria 1043
75 Ga0224712_10192593 3300022467 Unclassified 923
76 Ga0224712_10220366 3300022467 Bacteria 868
77 Ga0224712_10327833 3300022467 Bacteria 720
78 Ga0224712_10485060 3300022467 Bacteria 596
79 Ga0224712_10499002 3300022467 Unclassified 588
80 Ga0224712_10553731 3300022467 Bacteria 559
81 Ga0207688_10032304 3300025901 Bacteria 2892
82 Ga0207685_10119541 3300025905 Bacteria 1154
83 Ga0207699_10039040 3300025906 Bacteria 2725
84 Ga0207693_10001165 3300025915 Bacteria 23432
85 Ga0207693_10204116 3300025915 Bacteria 1554
86 Ga0207657_10239660 3300025919 Bacteria 1448
87 Ga0207681_10669934 3300025923 Unclassified 861
88 Ga0207687_10043291 3300025927 Bacteria 3102
89 Ga0207687_10529731 3300025927 Bacteria 986
90 Ga0207700_10311053 3300025928 Bacteria 1363
91 Ga0207690_11602211 3300025932 Bacteria 544
92 Ga0207706_10948465 3300025933 Unclassified 725
93 Ga0207686_10763489 3300025934 Bacteria 773
94 Ga0207670_10117451 3300025936 Bacteria 1928
95 Ga0207669_11759411 3300025937 Bacteria 529
96 Ga0207665_10057080 3300025939 Bacteria 2637
97 Ga0207691_10416153 3300025940 Bacteria 1145
98 Ga0207689_10237956 3300025942 Bacteria 1505
99 Ga0207661_10077504 3300025944 Unclassified 2734
100 Ga0207712_10067532 3300025961 Bacteria 2559
101 Ga0207668_10729074 3300025972 Unclassified 873
102 Ga0207677_10296929 3300026023 Bacteria 1333
103 Ga0207678_10623240 3300026067 Bacteria 947
104 Ga0207648_10539838 3300026089 Bacteria 1070
105 Ga0207648_11162720 3300026089 Unclassified 724
106 Ga0207676_11204560 3300026095 Unclassified 751
107 Ga0207674_11076485 3300026116 Bacteria 773
108 Ga0207698_10277978 3300026142 Bacteria 1547
109 Ga0268266_10630454 3300028379 Bacteria 1031
110 Ga0265760_10238183 3300031090 Bacteria 626
111 Ga0307413_10188377 3300031824 Bacteria 1479
112 Ga0307406_10443261 3300031901 Bacteria 1040
113 Ga0307407_10713032 3300031903 Bacteria 757
114 Ga0307409_100787811 3300031995 Bacteria 957
115 Ga0307411_11200688 3300032005 Bacteria 688
116 Ga0307415_101580132 3300032126 Bacteria 629
117 Ga0373953_0132003 3300035117 Bacteria 1065
118 Ga0373957_0095662 3300035120 Bacteria 1185
119 Ga0373946_0587574 3300035171 Bacteria 577
120 Ga0373955_0265360 3300035172 Bacteria 1031
121 Ga0373947_0417391 3300035725 Bacteria 907
122 Ga0373937_0018464 3300036401 Bacteria 6229
123 Ga0395900_0528271 3300037418 Bacteria 1127
124 Ga0436364_0041291 3300037853 Bacteria 1607
125 Ga0436364_0121330 3300037853 Bacteria 4890
126 Ga0436364_0284384 3300037853 Bacteria 655
127 Ga0436364_0562022 3300037853 Bacteria 2094
128 Ga0436364_0569239 3300037853 Bacteria 828
129 Ga0436364_0743394 3300037853 Bacteria 785
130 Ga0436364_0954211 3300037853 Bacteria 1840
131 Ga0436364_0985119 3300037853 Bacteria 4746
132 Ga0436364_1165602 3300037853 Bacteria 565
133 Ga0395901_0583847 3300038443 Bacteria 1129
134 Ga0436365_0275157 3300039437 Unclassified 568
135 Ga0436365_0656570 3300039437 Bacteria 965
136 Ga0436365_0656592 3300039437 Bacteria 8263
137 Ga0436365_0745121 3300039437 Bacteria 2234
138 Ga0436365_1002678 3300039437 Bacteria 16809
139 Ga0436365_1029997 3300039437 Bacteria 4333
140 Ga0436365_1102419 3300039437 Bacteria 6206
141 Ga0436365_1135292 3300039437 Bacteria 3311
142 Ga0436365_1238206 3300039437 Bacteria 4092
143 Ga0436365_1585158 3300039437 Bacteria 1067
144 Ga0436363_0105695 3300039450 Bacteria 1322
145 Ga0436363_0236448 3300039450 Bacteria 656
146 Ga0436363_0365326 3300039450 Bacteria 16368
147 Ga0436363_0754964 3300039450 Bacteria 2842
148 Ga0436363_0820913 3300039450 Unclassified 1258
149 Ga0436363_1275665 3300039450 Bacteria 2785
150 Ga0436363_1342808 3300039450 Bacteria 1504
151 Ga0436363_1530589 3300039450 Bacteria 3242
152 Ga0436363_1585209 3300039450 Bacteria 798
153 Ga0436362_0300473 3300039453 Bacteria 744
154 Ga0436362_0534151 3300039453 Bacteria 2260
155 Ga0436362_0649877 3300039453 Bacteria 869
156 Ga0436362_1105248 3300039453 Bacteria 1884
157 Ga0451833_0203346 3300041491 Bacteria 790
158 Ga0439450_047680 3300042008 Unclassified 1010
159 Ga0439458_0012232 3300042157 Bacteria 1924
160 Ga0466969_0078212 3300044656 Bacteria 1582
161 Ga0466969_0263528 3300044656 Unclassified 781
162 Ga0466969_0315844 3300044656 Unclassified 707
163 Ga0466965_0068127 3300044683 Bacteria 1787
164 Ga0466965_0173466 3300044683 Unclassified 1135
165 Ga0466965_0600918 3300044683 Unclassified 625
166 Ga0466965_0605020 3300044683 Bacteria 623
167 Ga0466966_0057024 3300044684 Bacteria 2470
168 Ga0466966_0064284 3300044684 Bacteria 2310
169 Ga0466966_0564632 3300044684 Unclassified 685
170 Ga0466961_0013029 3300044693 Bacteria 5319
171 Ga0466961_0112424 3300044693 Bacteria 1713
172 Ga0466961_0450585 3300044693 Bacteria 779
173 Ga0466961_0569094 3300044693 Bacteria 682
174 Ga0466961_0778643 3300044693 Bacteria 571
175 Ga0466963_0000273 3300044694 Bacteria 22985
176 Ga0466963_0003004 3300044694 Bacteria 9545
177 Ga0466963_0054938 3300044694 Bacteria 2648
178 Ga0466963_0148638 3300044694 Bacteria 1626
179 Ga0466963_0493160 3300044694 Bacteria 865
180 Ga0466964_0053816 3300044706 Bacteria 1658
181 Ga0466971_0001423 3300044719 Bacteria 10052
182 Ga0466971_0042558 3300044719 Bacteria 2041
183 Ga0466971_0127219 3300044719 Bacteria 1181
184 Ga0466971_0152006 3300044719 Bacteria 1081
185 Ga0466971_0251651 3300044719 Bacteria 842
186 Ga0466971_0525045 3300044719 Unclassified 586
187 Ga0466968_0023533 3300044735 Bacteria 2511
188 Ga0466968_0192627 3300044735 Bacteria 952
189 Ga0466968_0225631 3300044735 Unclassified 883
190 Ga0466968_0233473 3300044735 Unclassified 869
191 Ga0466968_0254637 3300044735 Unclassified 834
192 Ga0466970_0139703 3300044765 Bacteria 1334
193 Ga0466970_0264151 3300044765 Bacteria 966
194 Ga0466957_0027178 3300044842 Bacteria 3399
195 Ga0466957_0052706 3300044842 Bacteria 2478
196 Ga0466957_0070468 3300044842 Bacteria 2160
197 Ga0466960_0054211 3300044901 Bacteria 1946
198 Ga0466959_0006088 3300045049 Bacteria 8327
199 Ga0466959_0012882 3300045049 Bacteria 6053
200 Ga0466959_0018861 3300045049 Bacteria 5068
201 Ga0466959_0064888 3300045049 Bacteria 2650
202 Ga0466958_0001164 3300045836 Bacteria 12224
203 Ga0466958_0032460 3300045836 Bacteria 3106
204 Ga0466958_0065947 3300045836 Bacteria 2210
205 Ga0466958_0080843 3300045836 Bacteria 1999
206 Ga0466958_0106031 3300045836 Bacteria 1752
207 Ga0466958_0752351 3300045836 Unclassified 635
208 Ga0466967_0019491 3300045976 Bacteria 5455
209 Ga0466967_0040214 3300045976 Bacteria 4025
210 Ga0466967_0179355 3300045976 Bacteria 1997
211 Ga0466967_0304205 3300045976 Unclassified 1535
212 Ga0466967_0456263 3300045976 Bacteria 1250
213 Ga0466967_1051477 3300045976 Unclassified 811
214 Ga0466967_1796404 3300045976 Bacteria 610
215 Ga0495592_0027336 3300046454 Bacteria 4326
216 Ga0495629_0734873 3300046459 Unclassified 654
217 Ga0495641_0126661 3300046461 Bacteria 1140
218 Ga0495641_0176834 3300046461 Bacteria 955
219 Ga0495653_0026910 3300046463 Bacteria 4607
220 Ga0495582_0445428 3300046473 Unclassified 748
221 Ga0495608_0003047 3300046511 Bacteria 11967
222 Ga0495618_0177915 3300046514 Bacteria 1352
223 Ga0495665_0465873 3300046531 Unclassified 638
224 Ga0495640_0201115 3300046533 Bacteria 1262
225 Ga0495586_0465520 3300046535 Unclassified 729
226 Ga0495587_0074441 3300046536 Bacteria 1972
227 Ga0495667_0004076 3300046559 Bacteria 9816
228 Ga0495634_0045320 3300046642 Bacteria 2974
229 Ga0495635_0009815 3300046663 Bacteria 6694
230 Ga0495657_0019923 3300046675 Bacteria 4833
231 Ga0495599_0031379 3300046678 Bacteria 3335
232 Ga0495646_0035522 3300046680 Bacteria 3091
233 Ga0495647_0112435 3300046681 Unclassified 1138
234 Ga0495658_0378932 3300046683 Bacteria 901
235 Ga0495600_0155515 3300046809 Bacteria 1479
236 Ga0495581_0376910 3300047315 Bacteria 828
237 Ga0495604_0060355 3300047317 Bacteria 2904
238 Ga0495674_0033320 3300047319 Bacteria 4668
239 Ga0495676_0173254 3300047321 Unclassified 1517
240 Ga0495680_0010647 3300047322 Bacteria 8201
241 Ga0495684_0032061 3300047471 Bacteria 4033
242 Ga0495593_0247577 3300047673 Bacteria 892
243 Ga0495602_0025499 3300048088 Bacteria 5722
244 Ga0496104_0167309 3300048907 Bacteria 2108
245 Ga0496104_0454075 3300048907 Bacteria 1193
246 Ga0496105_0658542 3300048908 Bacteria 807
247 Ga0496106_0212963 3300048909 Bacteria 1540
248 Ga0496109_0295189 3300048912 Bacteria 1528
249 Ga0496110_0269354 3300048913 Bacteria 1551
250 Ga0496112_0072829 3300048915 Bacteria 3396
251 Ga0496114_0182733 3300048917 Bacteria 1832
252 Ga0496119_0119371 3300048922 Bacteria 1452
253 Ga0496120_0199121 3300048923 Bacteria 971
254 Ga0501031_0348118 3300049568 Unclassified 959
255 Ga0501034_0038390 3300049571 Bacteria 4849
256 Ga0501036_0158574 3300049572 Bacteria 1908
257 Ga0501038_0029084 3300049574 Bacteria 4901
258 Ga0501039_0435736 3300049575 Bacteria 1029
259 Ga0501040_0426585 3300049576 Unclassified 953
260 Ga0501072_0273018 3300049588 Bacteria 1345
261 Ga0501074_0163796 3300049590 Bacteria 1588
262 Ga0501076_0121201 3300049592 Bacteria 2118
263 Ga0501044_1189577 3300049823 Unclassified 630
264 nmdc:mga05p37_245539_c1 3300050507 Bacteria 2149
265 nmdc:mga05p37_960151_c1 3300050507 Bacteria 913
266 nmdc:mga08y16_827223_c1 3300050511 Bacteria 917
267 Ga0495601_0159555 3300053077 Bacteria 1474
268 Ga0495595_0064188 3300053084 Bacteria 1725
269 Ga0495595_0273365 3300053084 Bacteria 848
270 Ga0495619_0084158 3300053085 Bacteria 2146
271 Ga0466962_0003445 3300061719 Bacteria 7536
272 Ga0466962_0022869 3300061719 Bacteria 3004
273 Ga0466962_0110126 3300061719 Bacteria 1326
274 Ga0466962_0263658 3300061719 Bacteria 848
275 Ga0466962_0348651 3300061719 Unclassified 737
276 Ga0466958_0026049
277 Ga0070676_10289237
278 Ga0070683_100222415
279 Ga0068868_100803809
280 Ga0070660_100296618
281 Ga0070692_10295210
282 Ga0070668_100885834
283 Ga0070671_100478995
284 Ga0070659_100125756
285 Ga0070714_100152702
286 Ga0070713_100433227
287 Ga0070710_10004634
288 Ga0070694_101201394
289 Ga0070708_100417021
290 Ga0070663_100876538
291 Ga0068867_100563486
292 Ga0070685_10180336
293 Ga0070707_100120972
294 Ga0070699_100559707
295 Ga0070684_100400699
296 Ga0070686_100134043
297 Ga0070665_101240907
298 Ga0070664_100071992
299 Ga0068857_100508714
300 Ga0068856_101650637
301 Ga0068852_100367872
302 Ga0068859_101444203
303 Ga0070717_10088720
304 Ga0070717_10309041
305 Ga0070717_10559459
306 Ga0070715_10292736
307 Ga0070712_100020950
308 Ga0070712_100631652
309 Ga0070712_100951416
310 Ga0075428_100101843
311 Ga0097620_101444197
312 Ga0111539_10171474
313 Ga0111539_10204193
314 Ga0111539_10361220
315 Ga0111539_10561686
316 Ga0111539_11069291
317 Ga0105245_10096238
318 Ga0114129_10225114
319 Ga0105243_10343323
320 Ga0105243_11991454
321 Ga0105239_10337146
322 Ga0157374_10973104
323 Ga0157377_10501010
324 Ga0157379_10003199
325 Ga0197907_10226898
326 Ga0206351_10132139
327 Ga0206351_10720970
328 Ga0206350_10033649
329 Ga0206350_10856078
330 Ga0206350_11209119
331 Ga0154015_1295031
332 Ga0154015_1490029
333 Ga0154015_1641370
334 Ga0154015_1673236
335 Ga0213874_10000263
336 Ga0213874_10002971
337 Ga0213874_10062611
338 Ga0213874_10291717
339 Ga0213876_10031180
340 Ga0213876_10033043
341 Ga0213876_10070064
342 Ga0213876_10150769
343 Ga0213876_10314534
344 Ga0213875_10099456
345 Ga0213875_10233270
346 Ga0213875_10251391
347 Ga0224712_10112659
348 Ga0224712_10115345
349 Ga0224712_10146677
350 Ga0224712_10192593
351 Ga0224712_10220366
352 Ga0224712_10327833
353 Ga0224712_10485060
354 Ga0224712_10499002
355 Ga0224712_10553731
356 Ga0207688_10032304
357 Ga0207685_10119541
358 Ga0207699_10039040
359 Ga0207693_10001165
360 Ga0207693_10204116
361 Ga0207657_10239660
362 Ga0207681_10669934
363 Ga0207687_10043291
364 Ga0207687_10529731
365 Ga0207700_10311053
366 Ga0207690_11602211
367 Ga0207706_10948465
368 Ga0207686_10763489
369 Ga0207670_10117451
370 Ga0207669_11759411
371 Ga0207665_10057080
372 Ga0207691_10416153
373 Ga0207689_10237956
374 Ga0207661_10077504
375 Ga0207712_10067532
376 Ga0207668_10729074
377 Ga0207677_10296929
378 Ga0207678_10623240
379 Ga0207648_10539838
380 Ga0207648_11162720
381 Ga0207676_11204560
382 Ga0207674_11076485
383 Ga0207698_10277978
384 Ga0268266_10630454
385 Ga0265760_10238183
386 Ga0307413_10188377
387 Ga0307406_10443261
388 Ga0307407_10713032
389 Ga0307409_100787811
390 Ga0307411_11200688
391 Ga0307415_101580132
392 Ga0373953_0132003
393 Ga0373957_0095662
394 Ga0373946_0587574
395 Ga0373955_0265360
396 Ga0373947_0417391
397 Ga0373937_0018464
398 Ga0395900_0528271
399 Ga0436364_0041291
400 Ga0436364_0121330
401 Ga0436364_0284384
402 Ga0436364_0562022
403 Ga0436364_0569239
404 Ga0436364_0743394
405 Ga0436364_0954211
406 Ga0436364_0985119
407 Ga0436364_1165602
408 Ga0395901_0583847
409 Ga0436365_0275157
410 Ga0436365_0656570
411 Ga0436365_0656592
412 Ga0436365_0745121
413 Ga0436365_1002678
414 Ga0436365_1029997
415 Ga0436365_1102419
416 Ga0436365_1135292
417 Ga0436365_1238206
418 Ga0436365_1585158
419 Ga0436363_0105695
420 Ga0436363_0236448
421 Ga0436363_0365326
422 Ga0436363_0754964
423 Ga0436363_0820913
424 Ga0436363_1275665
425 Ga0436363_1342808
426 Ga0436363_1530589
427 Ga0436363_1585209
428 Ga0436362_0300473
429 Ga0436362_0534151
430 Ga0436362_0649877
431 Ga0436362_1105248
432 Ga0451833_0203346
433 Ga0439450_047680
434 Ga0439458_0012232
435 Ga0466969_0078212
436 Ga0466969_0263528
437 Ga0466969_0315844
438 Ga0466965_0068127
439 Ga0466965_0173466
440 Ga0466965_0600918
441 Ga0466965_0605020
442 Ga0466966_0057024
443 Ga0466966_0064284
444 Ga0466966_0564632
445 Ga0466961_0013029
446 Ga0466961_0112424
447 Ga0466961_0450585
448 Ga0466961_0569094
449 Ga0466961_0778643
450 Ga0466963_0000273
451 Ga0466963_0003004
452 Ga0466963_0054938
453 Ga0466963_0148638
454 Ga0466963_0493160
455 Ga0466964_0053816
456 Ga0466971_0001423
457 Ga0466971_0042558
458 Ga0466971_0127219
459 Ga0466971_0152006
460 Ga0466971_0251651
461 Ga0466971_0525045
462 Ga0466968_0023533
463 Ga0466968_0192627
464 Ga0466968_0225631
465 Ga0466968_0233473
466 Ga0466968_0254637
467 Ga0466970_0139703
468 Ga0466970_0264151
469 Ga0466957_0027178
470 Ga0466957_0052706
471 Ga0466957_0070468
472 Ga0466960_0054211
473 Ga0466959_0006088
474 Ga0466959_0012882
475 Ga0466959_0018861
476 Ga0466959_0064888
477 Ga0466958_0001164
478 Ga0466958_0032460
479 Ga0466958_0065947
480 Ga0466958_0080843
481 Ga0466958_0106031
482 Ga0466958_0752351
483 Ga0466967_0019491
484 Ga0466967_0040214
485 Ga0466967_0179355
486 Ga0466967_0304205
487 Ga0466967_0456263
488 Ga0466967_1051477
489 Ga0466967_1796404
490 Ga0495592_0027336
491 Ga0495629_0734873
492 Ga0495641_0126661
493 Ga0495641_0176834
494 Ga0495653_0026910
495 Ga0495582_0445428
496 Ga0495608_0003047
497 Ga0495618_0177915
498 Ga0495665_0465873
499 Ga0495640_0201115
500 Ga0495586_0465520
501 Ga0495587_0074441
502 Ga0495667_0004076
503 Ga0495634_0045320
504 Ga0495635_0009815
505 Ga0495657_0019923
506 Ga0495599_0031379
507 Ga0495646_0035522
508 Ga0495647_0112435
509 Ga0495658_0378932
510 Ga0495600_0155515
511 Ga0495581_0376910
512 Ga0495604_0060355
513 Ga0495674_0033320
514 Ga0495676_0173254
515 Ga0495680_0010647
516 Ga0495684_0032061
517 Ga0495593_0247577
518 Ga0495602_0025499
519 Ga0496104_0167309
520 Ga0496104_0454075
521 Ga0496105_0658542
522 Ga0496106_0212963
523 Ga0496109_0295189
524 Ga0496110_0269354
525 Ga0496112_0072829
526 Ga0496114_0182733
527 Ga0496119_0119371
528 Ga0496120_0199121
529 Ga0501031_0348118
530 Ga0501034_0038390
531 Ga0501036_0158574
532 Ga0501038_0029084
533 Ga0501039_0435736
534 Ga0501040_0426585
535 Ga0501072_0273018
536 Ga0501074_0163796
537 Ga0501076_0121201
538 Ga0501044_1189577
539 nmdc:mga05p37_245539_c1
540 nmdc:mga05p37_960151_c1
541 nmdc:mga08y16_827223_c1
542 Ga0495601_0159555
543 Ga0495595_0064188
544 Ga0495595_0273365
545 Ga0495619_0084158
546 Ga0466962_0003445
547 Ga0466962_0022869
548 Ga0466962_0110126
549 Ga0466962_0263658
550 Ga0466962_0348651

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17886

ArsA_HSP20

HSP20-like domain found in ArsA

62

143

0.97

PF00011

HSP20

Hsp20/alpha crystallin family

57

157

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h50-assembly1.cif.gz_P multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 0.8363 43 133
5zul-assembly1.cif.gz_E-2 small heat shock protein from mycobacterium marinum m : form-3 0.8298 38 133
5ds2-assembly2.cif.gz_D core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum 0.8225 41 133
2h50-assembly1.cif.gz_P multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 0.8115 43 133
5ds2-assembly2.cif.gz_D core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum 0.8068 41 133
ID Description Score Start End Superfamily
af_Q8S1F2_1_96_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8663 37 138 2.60.40.790
af_K7L898_13_106_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8441 38 133 2.60.40.790
af_F4K6X6_3_101_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8441 38 138 2.60.40.790
af_K7UST5_61_183_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8271 42 138 2.60.40.790
af_I1MKZ4_1_104_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8258 30 133 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A7V1JEQ8-F1-model_v4 Hsp20/alpha crystallin family protein 0.8235 37 133
AF-A0A1F2VEY8-F1-model_v4 SHSP domain-containing protein 0.7653 39 151
AF-A0A1E7HMT7-F1-model_v4 SHSP domain-containing protein 0.7631 41 144
AF-A0A2E0QYR1-F1-model_v4 Heat-shock protein 0.7595 30 144 GO:0009408
AF-A0A258ZKY2-F1-model_v4 SHSP domain-containing protein 0.7574 44 144

Map