F380610

General Info

Members Datasets Scaffolds Average Seq Length
275 180 252 244

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0042905|Ga0466960_0042905_565_1374
Length 269
Sequence VTSGALTDPATGGSEAAVGRARRRAAWHVATVTEVRPETPTAVRIVLDVPTWPGNDAGAHLDVRLTAPDGYQATRSYSIASAGAGTRVVLAVDEVPDGEVSPFLVHDLRPGDQLELHGPLGAFFVWRPGRDDRPVQLISGGSGVVPLYAMASLHTAVSDPTVFRLLYSVRTPQDVFFADELAALSDAAVHGGSALDLDLVWTRRAPDGSSSRVGRLTAETLASRTIPADEGPQVYVCGPTGFVEAVAGWLQEAGHAAADIRTERFGGTP

Samples

Sample ID Description Type Environment
1 2643221575 Microbacterium sp. Root61 Isolate Unclassified
2 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
3 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
4 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
5 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
6 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
7 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
8 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
9 2808606394 Promicromonospora sp. C35 Isolate Unclassified
10 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
11 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
12 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
13 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
14 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
15 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
16 2919069694 Microbacterium sp. 1154 Isolate Unclassified
17 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
18 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
19 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
20 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
21 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
22 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
23 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
63 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
80 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
81 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
94 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
95 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
96 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
97 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
98 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
99 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
100 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
101 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
104 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
105 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
109 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
110 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
111 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
112 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
113 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
114 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
126 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
127 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
128 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
129 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
132 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
133 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
134 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
170 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
171 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
172 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
173 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
175 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
176 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.64
Metatranscriptomes 0
Isolates 8.36

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 11.27
Nodule 0
Rhizoplane 8
Rhizosphere 61.45
Stem 0
Stem Tuber 0
Unclassified 18.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1001509 3300002738 Bacteria 8129
2 JGI25406J46586_10018800 3300003203 Bacteria 2832
3 rootH1_10104188 3300003323 Bacteria 2141
4 Ga0055540_1008874 3300003792 Bacteria 3559
5 Ga0070683_100102652 3300005329 Bacteria 2693
6 Ga0070682_100001474 3300005337 Bacteria 13190
7 Ga0070669_100323550 3300005353 Bacteria 1246
8 Ga0070710_10031291 3300005437 Bacteria 2871
9 Ga0070678_100099647 3300005456 Bacteria 2249
10 Ga0070662_100014276 3300005457 Bacteria 5303
11 Ga0068867_100196378 3300005459 Bacteria 1613
12 Ga0070685_10288078 3300005466 Bacteria 1102
13 Ga0070684_100333627 3300005535 Bacteria 1394
14 Ga0070665_100253075 3300005548 Bacteria 1762
15 Ga0070665_100310777 3300005548 Bacteria 1580
16 Ga0068852_101161499 3300005616 Bacteria 793
17 Ga0081455_10002663 3300005937 Bacteria 21122
18 Ga0081539_10000015 3300005985 Bacteria 395781
19 Ga0075365_10360335 3300006038 Bacteria 1025
20 Ga0075363_100004959 3300006048 Bacteria 5887
21 Ga0075363_100027689 3300006048 Bacteria 2909
22 Ga0075364_10038188 3300006051 Bacteria 3111
23 Ga0075364_10088286 3300006051 Bacteria 2056
24 Ga0075432_10001795 3300006058 Bacteria 7071
25 Ga0075369_10012162 3300006186 Bacteria 3397
26 Ga0075428_100020161 3300006844 Bacteria 7384
27 Ga0075431_100032612 3300006847 Bacteria 5368
28 Ga0075433_10002929 3300006852 Bacteria 13099
29 Ga0075434_100033625 3300006871 Bacteria 5062
30 Ga0075429_100018481 3300006880 Bacteria 6039
31 Ga0075435_100018162 3300007076 Bacteria 5339
32 Ga0105244_10046914 3300009036 Bacteria 2217
33 Ga0105245_10062613 3300009098 Bacteria 3357
34 Ga0105245_10207978 3300009098 Bacteria 1882
35 Ga0114129_10012373 3300009147 Bacteria 12146
36 Ga0105243_10109867 3300009148 Bacteria 2304
37 Ga0105242_10032514 3300009176 Bacteria 4172
38 Ga0105249_10022145 3300009553 Bacteria 5691
39 Ga0157370_10052276 3300013104 Bacteria 3901
40 Ga0171462_1003 3300013250 Bacteria 853796
41 Ga0163162_10006286 3300013306 Bacteria 11505
42 Ga0163162_10007378 3300013306 Bacteria 10693
43 Ga0157372_10002265 3300013307 Bacteria 20847
44 Ga0157372_10040005 3300013307 Bacteria 5177
45 Ga0157372_10199070 3300013307 Bacteria 2320
46 Ga0157372_10917787 3300013307 Bacteria 1016
47 Ga0157380_10067651 3300014326 Bacteria 2877
48 Ga0157380_10076852 3300014326 Bacteria 2719
49 Ga0163161_10012520 3300017792 Bacteria 5889
50 Ga0163161_10089498 3300017792 Bacteria 2277
51 Ga0163161_10560747 3300017792 Bacteria 937
52 Ga0209646_1000268 3300025246 Bacteria 49238
53 Ga0209051_1002691 3300025303 Bacteria 12372
54 Ga0209051_1008804 3300025303 Bacteria 5291
55 Ga0207655_1057572 3300025728 Bacteria 1525
56 Ga0207692_10077983 3300025898 Bacteria 1764
57 Ga0207643_10428749 3300025908 Bacteria 839
58 Ga0207687_10106715 3300025927 Bacteria 2071
59 Ga0207706_10012023 3300025933 Bacteria 7886
60 Ga0207686_10083987 3300025934 Bacteria 2085
61 Ga0207709_10192812 3300025935 Bacteria 1449
62 Ga0207669_10286409 3300025937 Bacteria 1245
63 Ga0207712_10006129 3300025961 Bacteria 7581
64 Ga0207712_10275980 3300025961 Bacteria 1370
65 Ga0207668_10052153 3300025972 Bacteria 2829
66 Ga0207640_10135055 3300025981 Bacteria 1789
67 Ga0207675_100030204 3300026118 Bacteria 5047
68 Ga0207675_100248466 3300026118 Bacteria 1721
69 Ga0209813_10069136 3300027866 Bacteria 1144
70 Ga0207428_10014421 3300027907 Bacteria 6869
71 Ga0268265_10056866 3300028380 Bacteria 2979
72 Ga0307515_10217028 3300028794 Bacteria 1741
73 Ga0307515_10303086 3300028794 Bacteria 1281
74 Ga0314311_1045761 3300030733 Bacteria 1580
75 Ga0314311_1130801 3300030733 Bacteria 2098
76 Ga0316179_1107488 3300030734 Bacteria 2573
77 Ga0307408_100162198 3300031548 Bacteria 1776
78 Ga0307413_10005637 3300031824 Bacteria 5615
79 Ga0307413_10143750 3300031824 Bacteria 1652
80 Ga0307413_10345362 3300031824 Bacteria 1146
81 Ga0307410_10000111 3300031852 Bacteria 28496
82 Ga0307410_10262485 3300031852 Bacteria 1347
83 Ga0307406_10000655 3300031901 Bacteria 19636
84 Ga0307406_10100636 3300031901 Bacteria 1968
85 Ga0307406_10230636 3300031901 Bacteria 1382
86 Ga0307407_10006736 3300031903 Bacteria 5141
87 Ga0307407_10395862 3300031903 Bacteria 990
88 Ga0307407_10422007 3300031903 Bacteria 961
89 Ga0307412_10021457 3300031911 Bacteria 3946
90 Ga0307409_100001895 3300031995 Bacteria 10661
91 Ga0307409_100014402 3300031995 Bacteria 5143
92 Ga0307409_100234877 3300031995 Bacteria 1665
93 Ga0307416_100000114 3300032002 Bacteria 48291
94 Ga0307416_100077743 3300032002 Bacteria 2788
95 Ga0307414_10017803 3300032004 Bacteria 4357
96 Ga0307414_10107656 3300032004 Bacteria 2113
97 Ga0307414_10281570 3300032004 Bacteria 1397
98 Ga0307411_10006316 3300032005 Bacteria 5921
99 Ga0307415_100121625 3300032126 Bacteria 1958
100 Ga0307415_100129967 3300032126 Bacteria 1905
101 Ga0439465_0000954 3300041413 Bacteria 9186
102 Ga0439465_0059551 3300041413 Bacteria 1264
103 Ga0451791_0440029 3300041451 Bacteria 1094
104 Ga0451793_0205548 3300041452 Bacteria 922
105 Ga0451793_0281478 3300041452 Bacteria 4073
106 Ga0451793_0521670 3300041452 Bacteria 1427
107 Ga0451793_1713271 3300041452 Bacteria 1234
108 Ga0439463_001910 3300042016 Bacteria 5408
109 Ga0439444_0007452 3300042437 Bacteria 1680
110 Ga0439460_0056953 3300042461 Bacteria 1185
111 Ga0439440_0002032 3300042993 Bacteria 3769
112 Ga0439440_0020319 3300042993 Bacteria 1488
113 Ga0466960_0042905 3300044901 Bacteria 2149
114 Ga0495627_004594 3300046453 Bacteria 5733
115 Ga0495592_0334065 3300046454 Bacteria 976
116 Ga0495641_0141211 3300046461 Bacteria 1076
117 Ga0495620_0041763 3300046515 Bacteria 2009
118 Ga0495631_0093181 3300046518 Bacteria 1297
119 Ga0495645_0438818 3300046543 Bacteria 825
120 Ga0495668_0288180 3300046616 Bacteria 900
121 Ga0495661_0229569 3300046665 Bacteria 958
122 Ga0495624_0166622 3300046690 Bacteria 1345
123 Ga0495670_0297407 3300046691 Bacteria 865
124 Ga0495671_0271515 3300046692 Bacteria 818
125 Ga0495649_0228558 3300046694 Bacteria 961
126 Ga0495672_0014447 3300047320 Bacteria 5407
127 Ga0495680_0096238 3300047322 Bacteria 2212
128 Ga0496101_0009952 3300048904 Bacteria 6264
129 Ga0496104_0024124 3300048907 Bacteria 5596
130 Ga0496104_0130931 3300048907 Bacteria 2409
131 Ga0496105_0042775 3300048908 Bacteria 3735
132 Ga0496105_0069585 3300048908 Bacteria 2908
133 Ga0496105_0182753 3300048908 Bacteria 1717
134 Ga0496107_0005162 3300048910 Bacteria 8914
135 Ga0496108_0464051 3300048911 Bacteria 1106
136 Ga0496109_0011027 3300048912 Bacteria 7747
137 Ga0496109_0085830 3300048912 Bacteria 2906
138 Ga0496109_0092082 3300048912 Bacteria 2804
139 Ga0496109_0135475 3300048912 Bacteria 2301
140 Ga0496111_0004329 3300048914 Bacteria 8956
141 Ga0496112_0021946 3300048915 Bacteria 6076
142 Ga0496114_0039192 3300048917 Bacteria 3920
143 Ga0496115_0015362 3300048918 Bacteria 5806
144 Ga0496115_0139912 3300048918 Bacteria 1997
145 Ga0496116_0011625 3300048919 Bacteria 7264
146 Ga0496117_0000069 3300048920 Bacteria 246025
147 Ga0496117_0075996 3300048920 Bacteria 2229
148 Ga0496117_0104563 3300048920 Bacteria 1781
149 Ga0496117_0137729 3300048920 Bacteria 1468
150 Ga0496118_0004437 3300048921 Bacteria 16652
151 Ga0496119_0001191 3300048922 Bacteria 32545
152 Ga0496119_0001502 3300048922 Bacteria 27879
153 Ga0496119_0003502 3300048922 Bacteria 16238
154 Ga0496119_0004397 3300048922 Bacteria 14061
155 Ga0496119_0044410 3300048922 Bacteria 2798
156 Ga0496120_0001453 3300048923 Bacteria 28337
157 Ga0496120_0003254 3300048923 Bacteria 15011
158 Ga0496120_0011791 3300048923 Bacteria 5983
159 Ga0496120_0020277 3300048923 Bacteria 4229
160 Ga0496121_0000025 3300048924 Bacteria 453467
161 Ga0496121_0090661 3300048924 Bacteria 2389
162 Ga0496122_0000059 3300048925 Bacteria 247170
163 Ga0496122_0003178 3300048925 Bacteria 21897
164 Ga0496123_0000013 3300048926 Bacteria 439694
165 Ga0496123_0001583 3300048926 Bacteria 30943
166 Ga0496124_0010813 3300048927 Bacteria 9192
167 Ga0496124_0037216 3300048927 Bacteria 4234
168 Ga0496125_0001957 3300048928 Bacteria 28103
169 Ga0496125_0002413 3300048928 Bacteria 24328
170 Ga0496125_0029940 3300048928 Bacteria 4880
171 Ga0496126_0003663 3300048929 Bacteria 19191
172 Ga0496126_0013823 3300048929 Bacteria 8188
173 Ga0496126_0018131 3300048929 Bacteria 6987
174 Ga0496126_0035000 3300048929 Bacteria 4710
175 Ga0501031_0006764 3300049568 Bacteria 7479
176 Ga0501032_0009493 3300049569 Bacteria 7049
177 Ga0501032_0023836 3300049569 Bacteria 4226
178 Ga0501032_0061031 3300049569 Bacteria 2528
179 Ga0501032_0223827 3300049569 Bacteria 1224
180 Ga0501033_0013028 3300049570 Bacteria 6341
181 Ga0501033_0160486 3300049570 Bacteria 1618
182 Ga0501034_0011240 3300049571 Bacteria 9294
183 Ga0501034_0013755 3300049571 Bacteria 8324
184 Ga0501034_0024825 3300049571 Bacteria 6098
185 Ga0501034_0036916 3300049571 Bacteria 4947
186 Ga0501034_0078612 3300049571 Bacteria 3303
187 Ga0501036_0014137 3300049572 Bacteria 6638
188 Ga0501036_0061744 3300049572 Bacteria 3174
189 Ga0501037_0001620 3300049573 Bacteria 16350
190 Ga0501037_0009058 3300049573 Bacteria 7294
191 Ga0501037_0013443 3300049573 Bacteria 6029
192 Ga0501038_0026419 3300049574 Bacteria 5171
193 Ga0501038_0052566 3300049574 Bacteria 3512
194 Ga0501039_0047895 3300049575 Bacteria 3304
195 Ga0501039_0325868 3300049575 Bacteria 1207
196 Ga0501043_0003547 3300049579 Bacteria 12815
197 Ga0501043_0004377 3300049579 Bacteria 11498
198 Ga0501043_0281610 3300049579 Bacteria 1274
199 Ga0501043_0347012 3300049579 Bacteria 1128
200 Ga0501046_0006555 3300049580 Bacteria 10292
201 Ga0501047_0031255 3300049581 Bacteria 5135
202 Ga0501047_0144077 3300049581 Bacteria 2260
203 Ga0501047_0147483 3300049581 Bacteria 2229
204 Ga0501067_0019701 3300049583 Bacteria 3735
205 Ga0501068_0086668 3300049584 Bacteria 1928
206 Ga0501070_0003729 3300049586 Bacteria 13151
207 Ga0501070_0127019 3300049586 Bacteria 2107
208 Ga0501070_0170582 3300049586 Bacteria 1792
209 Ga0501070_0175700 3300049586 Bacteria 1763
210 Ga0501073_0000024 3300049589 Bacteria 128851
211 Ga0501073_0021215 3300049589 Bacteria 4683
212 Ga0501073_0140681 3300049589 Bacteria 1672
213 Ga0501079_0146209 3300049741 Bacteria 1842
214 Ga0501080_0000161 3300049742 Bacteria 48396
215 Ga0501083_0016567 3300049744 Bacteria 5155
216 Ga0501232_010441 3300049757 Unclassified 1047
217 Ga0501035_0002541 3300049822 Bacteria 17844
218 Ga0501035_0039093 3300049822 Bacteria 4294
219 Ga0501035_0395784 3300049822 Bacteria 1150
220 Ga0501044_0002381 3300049823 Bacteria 21422
221 Ga0501044_0005591 3300049823 Bacteria 13954
222 Ga0501045_0047750 3300049824 Bacteria 3119
223 nmdc:mga00v17_16434_c1 3300050491 Bacteria 3414
224 nmdc:mga00v17_31890_c1 3300050491 Bacteria 3110
225 nmdc:mga0yw44_309506_c1 3300050492 Bacteria 1059
226 nmdc:mga0yw44_50508_c1 3300050492 Bacteria 2515
227 nmdc:mga0yw44_9024_c2 3300050492 Bacteria 4406
228 nmdc:mga05p37_56873_c1 3300050507 Bacteria 4817
229 nmdc:mga09592_8870_c1 3300050508 Bacteria 8178
230 nmdc:mga06r32_15306_c1 3300050510 Bacteria 6968
231 nmdc:mga08y16_150892_c1 3300050511 Bacteria 2416
232 nmdc:mga0n895_15295_c1 3300050512 Bacteria 6991
233 nmdc:mga0rr50_4880_c1 3300050513 Bacteria 7933
234 nmdc:mga0a205_15867_c1 3300050515 Bacteria 7046
235 nmdc:mga0sz30_176794_c1 3300050516 Bacteria 946
236 nmdc:mga0sz30_39501_c1 3300050516 Bacteria 1980
237 Ga0495619_0207070 3300053085 Bacteria 1358
238 Ga0500556_0000542 3300053104 Bacteria 25482
239 Ga0500562_005248 3300053108 Bacteria 3255
240 Ga0500593_006221 3300053117 Bacteria 4767
241 Ga0500655_001417 3300053133 Bacteria 4547
242 Ga0500559_0000885 3300053136 Bacteria 19180
243 Ga0500559_0033426 3300053136 Bacteria 2214
244 Ga0500568_0019140 3300053139 Bacteria 2982
245 Ga0500568_0019465 3300053139 Bacteria 2949
246 Ga0500568_0022190 3300053139 Bacteria 2721
247 Ga0500573_0018689 3300053140 Bacteria 3955
248 Ga0500573_0075271 3300053140 Bacteria 1922
249 Ga0500588_0010099 3300053146 Bacteria 2268
250 Ga0500616_0000205 3300053153 Bacteria 96713
251 Ga0500645_012876 3300053730 Bacteria 2696
252 Ga0501084_0000170 3300054114 Bacteria 50710

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10207978 Ga0105245_102079782 209
2 3300013307 Ga0157372_10002265 Ga0157372_100022652 209
3 3300046515 Ga0495620_0041763 Ga0495620_0041763_61_723 212
4 3300046518 Ga0495631_0093181 Ga0495631_0093181_153_815 212
5 3300046665 Ga0495661_0229569 Ga0495661_0229569_264_926 212
6 3300005535 Ga0070684_100333627 Ga0070684_1003336272 214
7 3300050516 nmdc:mga0sz30_176794_c1 nmdc:mga0sz30_176794_c1_271_924 215
8 3300013306 Ga0163162_10006286 Ga0163162_100062866 216
9 3300013307 Ga0157372_10040005 Ga0157372_100400056 216
10 3300048904 Ga0496101_0009952 Ga0496101_0009952_5186_5848 216
11 3300048907 Ga0496104_0024124 Ga0496104_0024124_1651_2313 216
12 3300048908 Ga0496105_0069585 Ga0496105_0069585_2097_2759 216
13 3300048910 Ga0496107_0005162 Ga0496107_0005162_1653_2315 216
14 3300048912 Ga0496109_0011027 Ga0496109_0011027_2280_2942 216
15 3300048914 Ga0496111_0004329 Ga0496111_0004329_4017_4679 216
16 3300048915 Ga0496112_0021946 Ga0496112_0021946_4252_4914 216
17 3300048918 Ga0496115_0015362 Ga0496115_0015362_3509_4171 216
18 3300054114 Ga0501084_0000170 Ga0501084_0000170_23924_24613 216
19 3300047320 Ga0495672_0014447 Ga0495672_0014447_4344_5006 218
20 3300028794 Ga0307515_10217028 Ga0307515_102170282 221
21 3300041452 Ga0451793_0281478 Ga0451793_0281478_139_816 223
22 3300041452 Ga0451793_0521670 Ga0451793_0521670_614_1294 224
23 3300049571 Ga0501034_0013755 Ga0501034_0013755_4124_4810 224
24 3300049573 Ga0501037_0013443 Ga0501037_0013443_4372_5058 224
25 3300049579 Ga0501043_0004377 Ga0501043_0004377_3355_4041 224
26 3300049586 Ga0501070_0003729 Ga0501070_0003729_1830_2516 224
27 3300049742 Ga0501080_0000161 Ga0501080_0000161_19087_19773 224
28 3300049744 Ga0501083_0016567 Ga0501083_0016567_2074_2760 224
29 3300049822 Ga0501035_0395784 Ga0501035_0395784_319_1005 224
30 3300025898 Ga0207692_10077983 Ga0207692_100779833 226
31 3300049569 Ga0501032_0061031 Ga0501032_0061031_1102_1797 227
32 3300049570 Ga0501033_0013028 Ga0501033_0013028_1184_1879 227
33 3300049571 Ga0501034_0024825 Ga0501034_0024825_4006_4701 227
34 3300049572 Ga0501036_0061744 Ga0501036_0061744_1816_2511 227
35 3300049574 Ga0501038_0052566 Ga0501038_0052566_990_1685 227
36 3300049575 Ga0501039_0325868 Ga0501039_0325868_10_705 227
37 3300049579 Ga0501043_0347012 Ga0501043_0347012_330_1025 227
38 3300049581 Ga0501047_0144077 Ga0501047_0144077_1324_2019 227
39 3300049584 Ga0501068_0086668 Ga0501068_0086668_697_1392 227
40 3300049586 Ga0501070_0175700 Ga0501070_0175700_343_1038 227
41 3300053153 Ga0500616_0000205 Ga0500616_0000205_63978_64673 227
42 3300031995 Ga0307409_100234877 Ga0307409_1002348773 230
43 3300053136 Ga0500559_0033426 Ga0500559_0033426_1023_1721 230
44 3300053140 Ga0500573_0018689 Ga0500573_0018689_2735_3433 230
45 3300046453 Ga0495627_004594 Ga0495627_004594_2728_3441 231
46 3300046461 Ga0495641_0141211 Ga0495641_0141211_139_855 231
47 3300047322 Ga0495680_0096238 Ga0495680_0096238_453_1169 231
48 3300053085 Ga0495619_0207070 Ga0495619_0207070_363_1079 231
49 3300046454 Ga0495592_0334065 Ga0495592_0334065_21_743 232
50 3300046543 Ga0495645_0438818 Ga0495645_0438818_52_774 232
51 3300031901 Ga0307406_10100636 Ga0307406_101006363 233
52 3300031903 Ga0307407_10395862 Ga0307407_103958621 233
53 3300053730 Ga0500645_012876 Ga0500645_012876_59_793 234
54 iso_pu_bacteria 2808606306 2808631327 234
55 3300049586 Ga0501070_0127019 Ga0501070_0127019_895_1611 235
56 iso_pu_bacteria 2852663356 2852666347 235
57 3300003323 rootH1_10104188 rootH1_101041881 236
58 3300006048 Ga0075363_100004959 Ga0075363_1000049594 236
59 iso_pu_bacteria 2857737099 2857740169 236
60 3300005437 Ga0070710_10031291 Ga0070710_100312914 237
61 3300009098 Ga0105245_10062613 Ga0105245_100626133 237
62 3300009147 Ga0114129_10012373 Ga0114129_100123735 237
63 3300009148 Ga0105243_10109867 Ga0105243_101098672 237
64 3300009176 Ga0105242_10032514 Ga0105242_100325142 237
65 3300013307 Ga0157372_10199070 Ga0157372_101990703 237
66 3300046616 Ga0495668_0288180 Ga0495668_0288180_37_771 237
67 3300046691 Ga0495670_0297407 Ga0495670_0297407_13_747 237
68 3300046692 Ga0495671_0271515 Ga0495671_0271515_59_793 237
69 3300048922 Ga0496119_0001191 Ga0496119_0001191_4157_4885 237
70 3300048923 Ga0496120_0011791 Ga0496120_0011791_5016_5744 237
71 3300048924 Ga0496121_0000025 Ga0496121_0000025_175358_176086 237
72 3300050507 nmdc:mga05p37_56873_c1 nmdc:mga05p37_56873_c1_954_1688 237
73 3300050508 nmdc:mga09592_8870_c1 nmdc:mga09592_8870_c1_3619_4353 237
74 3300050510 nmdc:mga06r32_15306_c1 nmdc:mga06r32_15306_c1_3323_4057 237
75 3300050511 nmdc:mga08y16_150892_c1 nmdc:mga08y16_150892_c1_729_1463 237
76 3300050512 nmdc:mga0n895_15295_c1 nmdc:mga0n895_15295_c1_4258_4992 237
77 3300050513 nmdc:mga0rr50_4880_c1 nmdc:mga0rr50_4880_c1_2189_2923 237
78 3300050515 nmdc:mga0a205_15867_c1 nmdc:mga0a205_15867_c1_3237_3971 237
79 3300053139 Ga0500568_0019465 Ga0500568_0019465_710_1429 237
80 3300053139 Ga0500568_0022190 Ga0500568_0022190_1903_2616 237
81 iso_pu_bacteria 2811994872 2812322969 237
82 3300003792 Ga0055540_1008874 Ga0055540_10088744 238
83 3300005548 Ga0070665_100310777 Ga0070665_1003107773 238
84 3300005616 Ga0068852_101161499 Ga0068852_1011614991 238
85 3300025303 Ga0209051_1002691 Ga0209051_10026915 238
86 3300025303 Ga0209051_1008804 Ga0209051_10088045 238
87 3300032126 Ga0307415_100129967 Ga0307415_1001299672 238
88 3300041413 Ga0439465_0000954 Ga0439465_0000954_7532_8266 238
89 3300041413 Ga0439465_0059551 Ga0439465_0059551_420_1148 238
90 3300041452 Ga0451793_0205548 Ga0451793_0205548_48_782 238
91 3300048907 Ga0496104_0130931 Ga0496104_0130931_1493_2218 238
92 3300048908 Ga0496105_0042775 Ga0496105_0042775_1134_1859 238
93 3300048911 Ga0496108_0464051 Ga0496108_0464051_261_986 238
94 3300048912 Ga0496109_0085830 Ga0496109_0085830_73_798 238
95 3300048912 Ga0496109_0092082 Ga0496109_0092082_154_912 238
96 3300048917 Ga0496114_0039192 Ga0496114_0039192_41_766 238
97 3300048918 Ga0496115_0139912 Ga0496115_0139912_212_937 238
98 3300048919 Ga0496116_0011625 Ga0496116_0011625_4023_4745 238
99 3300048921 Ga0496118_0004437 Ga0496118_0004437_10815_11537 238
100 3300048922 Ga0496119_0003502 Ga0496119_0003502_1657_2379 238
101 3300048923 Ga0496120_0003254 Ga0496120_0003254_5291_6013 238
102 3300048925 Ga0496122_0000059 Ga0496122_0000059_204331_205053 238
103 3300048926 Ga0496123_0000013 Ga0496123_0000013_371727_372449 238
104 3300048927 Ga0496124_0010813 Ga0496124_0010813_3903_4625 238
105 3300048928 Ga0496125_0001957 Ga0496125_0001957_7432_8154 238
106 3300048929 Ga0496126_0018131 Ga0496126_0018131_4150_4872 238
107 3300049569 Ga0501032_0023836 Ga0501032_0023836_2394_3125 238
108 3300049571 Ga0501034_0078612 Ga0501034_0078612_1299_2030 238
109 3300049573 Ga0501037_0001620 Ga0501037_0001620_1862_2593 238
110 3300049579 Ga0501043_0281610 Ga0501043_0281610_56_787 238
111 3300049581 Ga0501047_0147483 Ga0501047_0147483_326_1054 238
112 3300049589 Ga0501073_0021215 Ga0501073_0021215_1888_2616 238
113 3300049822 Ga0501035_0002541 Ga0501035_0002541_11419_12150 238
114 3300049823 Ga0501044_0005591 Ga0501044_0005591_5079_5810 238
115 iso_pu_bacteria 2939657138 2939660054 238
116 iso_pu_bacteria 2977228692 2977229299 238
117 3300006038 Ga0075365_10360335 Ga0075365_103603352 239
118 3300006051 Ga0075364_10038188 Ga0075364_100381885 239
119 3300013250 Ga0171462_1003 Ga0171462_1003552 239
120 3300048920 Ga0496117_0104563 Ga0496117_0104563_622_1347 239
121 3300048920 Ga0496117_0137729 Ga0496117_0137729_477_1202 239
122 3300048922 Ga0496119_0004397 Ga0496119_0004397_12277_13005 239
123 3300048928 Ga0496125_0029940 Ga0496125_0029940_2891_3616 239
124 3300048929 Ga0496126_0035000 Ga0496126_0035000_3009_3734 239
125 3300049569 Ga0501032_0223827 Ga0501032_0223827_98_838 239
126 3300050491 nmdc:mga00v17_31890_c1 nmdc:mga00v17_31890_c1_2023_2748 239
127 3300050492 nmdc:mga0yw44_309506_c1 nmdc:mga0yw44_309506_c1_176_907 239
128 iso_pu_bacteria 2643221575 2643886123 239
129 iso_pu_bacteria 2757320536 2758227452 239
130 iso_pu_bacteria 2773857758 2774379901 239
131 iso_pu_bacteria 2904509784 2904513037 239
132 iso_pu_bacteria 2908678064 2908679093 239
133 iso_pu_bacteria 2919069694 2919069723 239
134 iso_pu_bacteria 2977236895 2977238663 239
135 iso_pu_bacteria 2977264416 2977264468 239
136 iso_pu_bacteria 2984542743 2984543554 239
137 3300046690 Ga0495624_0166622 Ga0495624_0166622_238_981 240
138 3300048924 Ga0496121_0090661 Ga0496121_0090661_268_1002 240
139 3300049571 Ga0501034_0011240 Ga0501034_0011240_7915_8649 240
140 3300049583 Ga0501067_0019701 Ga0501067_0019701_1645_2379 240
141 3300049741 Ga0501079_0146209 Ga0501079_0146209_698_1432 240
142 3300053139 Ga0500568_0019140 Ga0500568_0019140_1568_2293 240
143 3300053146 Ga0500588_0010099 Ga0500588_0010099_791_1525 240
144 3300005937 Ga0081455_10002663 Ga0081455_100026636 241
145 3300006186 Ga0075369_10012162 Ga0075369_100121622 241
146 3300049589 Ga0501073_0000024 Ga0501073_0000024_94812_95546 241
147 3300053140 Ga0500573_0075271 Ga0500573_0075271_672_1409 241
148 3300017792 Ga0163161_10560747 Ga0163161_105607472 242
149 3300041452 Ga0451793_1713271 Ga0451793_1713271_248_1048 242
150 3300048929 Ga0496126_0013823 Ga0496126_0013823_115_852 242
151 3300049568 Ga0501031_0006764 Ga0501031_0006764_5334_6086 242
152 3300049569 Ga0501032_0009493 Ga0501032_0009493_1800_2552 242
153 3300049570 Ga0501033_0160486 Ga0501033_0160486_404_1156 242
154 3300049571 Ga0501034_0036916 Ga0501034_0036916_2751_3503 242
155 3300049572 Ga0501036_0014137 Ga0501036_0014137_1266_2018 242
156 3300049573 Ga0501037_0009058 Ga0501037_0009058_5259_6011 242
157 3300049574 Ga0501038_0026419 Ga0501038_0026419_45_797 242
158 3300049575 Ga0501039_0047895 Ga0501039_0047895_970_1722 242
159 3300049579 Ga0501043_0003547 Ga0501043_0003547_5822_6574 242
160 3300049580 Ga0501046_0006555 Ga0501046_0006555_3825_4577 242
161 3300049581 Ga0501047_0031255 Ga0501047_0031255_3652_4404 242
162 3300049586 Ga0501070_0170582 Ga0501070_0170582_390_1142 242
163 3300049589 Ga0501073_0140681 Ga0501073_0140681_481_1233 242
164 3300049822 Ga0501035_0039093 Ga0501035_0039093_2622_3374 242
165 3300049823 Ga0501044_0002381 Ga0501044_0002381_16050_16802 242
166 3300049824 Ga0501045_0047750 Ga0501045_0047750_1364_2116 242
167 3300050516 nmdc:mga0sz30_39501_c1 nmdc:mga0sz30_39501_c1_358_1095 242
168 3300053104 Ga0500556_0000542 Ga0500556_0000542_19832_20590 242
169 3300053117 Ga0500593_006221 Ga0500593_006221_964_1722 242
170 3300053133 Ga0500655_001417 Ga0500655_001417_3433_4191 242
171 3300053136 Ga0500559_0000885 Ga0500559_0000885_6609_7346 242
172 3300006051 Ga0075364_10088286 Ga0075364_100882862 243
173 3300009036 Ga0105244_10046914 Ga0105244_100469144 243
174 3300013104 Ga0157370_10052276 Ga0157370_100522767 243
175 3300025728 Ga0207655_1057572 Ga0207655_10575722 243
176 3300048920 Ga0496117_0000069 Ga0496117_0000069_5339_6079 243
177 3300048920 Ga0496117_0075996 Ga0496117_0075996_1038_1778 243
178 3300048922 Ga0496119_0001502 Ga0496119_0001502_5103_5843 243
179 3300048922 Ga0496119_0044410 Ga0496119_0044410_1724_2464 243
180 3300048923 Ga0496120_0001453 Ga0496120_0001453_5465_6205 243
181 3300048923 Ga0496120_0020277 Ga0496120_0020277_1535_2275 243
182 3300048925 Ga0496122_0003178 Ga0496122_0003178_15816_16556 243
183 3300048926 Ga0496123_0001583 Ga0496123_0001583_5364_6104 243
184 3300048927 Ga0496124_0037216 Ga0496124_0037216_941_1681 243
185 3300048928 Ga0496125_0002413 Ga0496125_0002413_21604_22344 243
186 3300048929 Ga0496126_0003663 Ga0496126_0003663_16804_17544 243
187 3300025908 Ga0207643_10428749 Ga0207643_104287491 244
188 3300028794 Ga0307515_10303086 Ga0307515_103030862 244
189 3300041451 Ga0451791_0440029 Ga0451791_0440029_193_936 244
190 3300050491 nmdc:mga00v17_16434_c1 nmdc:mga00v17_16434_c1_1644_2387 244
191 3300050492 nmdc:mga0yw44_9024_c2 nmdc:mga0yw44_9024_c2_3190_3933 244
192 3300053108 Ga0500562_005248 Ga0500562_005248_1955_2698 244
193 3300046694 Ga0495649_0228558 Ga0495649_0228558_101_856 245
194 3300003203 JGI25406J46586_10018800 JGI25406J46586_100188003 246
195 3300005337 Ga0070682_100001474 Ga0070682_10000147412 246
196 3300005353 Ga0070669_100323550 Ga0070669_1003235502 246
197 3300005457 Ga0070662_100014276 Ga0070662_1000142765 246
198 3300005459 Ga0068867_100196378 Ga0068867_1001963781 246
199 3300005985 Ga0081539_10000015 Ga0081539_10000015180 246
200 3300006058 Ga0075432_10001795 Ga0075432_100017958 246
201 3300006844 Ga0075428_100020161 Ga0075428_1000201616 246
202 3300006847 Ga0075431_100032612 Ga0075431_1000326126 246
203 3300006852 Ga0075433_10002929 Ga0075433_100029292 246
204 3300006871 Ga0075434_100033625 Ga0075434_1000336253 246
205 3300006880 Ga0075429_100018481 Ga0075429_1000184814 246
206 3300007076 Ga0075435_100018162 Ga0075435_1000181622 246
207 3300009553 Ga0105249_10022145 Ga0105249_100221452 246
208 3300013306 Ga0163162_10007378 Ga0163162_100073782 246
209 3300014326 Ga0157380_10076852 Ga0157380_100768522 246
210 3300017792 Ga0163161_10012520 Ga0163161_100125202 246
211 3300017792 Ga0163161_10089498 Ga0163161_100894982 246
212 3300025933 Ga0207706_10012023 Ga0207706_100120234 246
213 3300025934 Ga0207686_10083987 Ga0207686_100839871 246
214 3300025935 Ga0207709_10192812 Ga0207709_101928122 246
215 3300025937 Ga0207669_10286409 Ga0207669_102864092 246
216 3300025961 Ga0207712_10006129 Ga0207712_100061297 246
217 3300025961 Ga0207712_10275980 Ga0207712_102759802 246
218 3300025972 Ga0207668_10052153 Ga0207668_100521533 246
219 3300025981 Ga0207640_10135055 Ga0207640_101350553 246
220 3300026118 Ga0207675_100030204 Ga0207675_1000302045 246
221 3300026118 Ga0207675_100248466 Ga0207675_1002484662 246
222 3300027907 Ga0207428_10014421 Ga0207428_100144217 246
223 3300028380 Ga0268265_10056866 Ga0268265_100568663 246
224 3300031548 Ga0307408_100162198 Ga0307408_1001621982 246
225 3300031824 Ga0307413_10005637 Ga0307413_100056375 246
226 3300031824 Ga0307413_10143750 Ga0307413_101437502 246
227 3300031824 Ga0307413_10345362 Ga0307413_103453622 246
228 3300031852 Ga0307410_10000111 Ga0307410_1000011120 246
229 3300031852 Ga0307410_10262485 Ga0307410_102624851 246
230 3300031901 Ga0307406_10000655 Ga0307406_1000065512 246
231 3300031901 Ga0307406_10230636 Ga0307406_102306362 246
232 3300031903 Ga0307407_10006736 Ga0307407_100067368 246
233 3300031903 Ga0307407_10422007 Ga0307407_104220072 246
234 3300031911 Ga0307412_10021457 Ga0307412_100214575 246
235 3300031995 Ga0307409_100001895 Ga0307409_1000018959 246
236 3300031995 Ga0307409_100014402 Ga0307409_1000144027 246
237 3300032002 Ga0307416_100000114 Ga0307416_1000001144 246
238 3300032002 Ga0307416_100077743 Ga0307416_1000777431 246
239 3300032004 Ga0307414_10017803 Ga0307414_100178033 246
240 3300032004 Ga0307414_10107656 Ga0307414_101076562 246
241 3300032004 Ga0307414_10281570 Ga0307414_102815702 246
242 3300032005 Ga0307411_10006316 Ga0307411_100063164 246
243 3300032126 Ga0307415_100121625 Ga0307415_1001216252 246
244 3300042016 Ga0439463_001910 Ga0439463_001910_4120_4881 246
245 3300042437 Ga0439444_0007452 Ga0439444_0007452_716_1477 246
246 3300042461 Ga0439460_0056953 Ga0439460_0056953_372_1133 246
247 3300042993 Ga0439440_0002032 Ga0439440_0002032_2859_3620 246
248 3300042993 Ga0439440_0020319 Ga0439440_0020319_245_1006 246
249 3300049757 Ga0501232_010441 Ga0501232_010441_96_857 246
250 3300030733 Ga0314311_1045761 Ga0314311_10457612 248
251 iso_pu_bacteria 2758568522 2760304332 248
252 iso_pu_bacteria 2784132109 2784473584 248
253 iso_pu_bacteria 2739367654 2739607636 249
254 iso_pu_bacteria 2758568621 2760621722 249
255 iso_pu_bacteria 2808606394 2809026516 249
256 iso_pu_bacteria 8056579771 8056583462 249
257 iso_pu_bacteria 2758568522 2760307681 250
258 iso_pu_bacteria 2821268502 2821270559 250
259 3300002738 JGI25154J39366_1001509 JGI25154J39366_10015095 252
260 3300005329 Ga0070683_100102652 Ga0070683_1001026523 252
261 3300005456 Ga0070678_100099647 Ga0070678_1000996473 252
262 3300005466 Ga0070685_10288078 Ga0070685_102880782 252
263 3300005548 Ga0070665_100253075 Ga0070665_1002530754 252
264 3300006048 Ga0075363_100027689 Ga0075363_1000276895 252
265 3300013307 Ga0157372_10917787 Ga0157372_109177871 252
266 3300014326 Ga0157380_10067651 Ga0157380_100676512 252
267 3300025246 Ga0209646_1000268 Ga0209646_100026851 252
268 3300025927 Ga0207687_10106715 Ga0207687_101067152 252
269 3300027866 Ga0209813_10069136 Ga0209813_100691361 252
270 3300030733 Ga0314311_1130801 Ga0314311_11308012 252
271 3300030734 Ga0316179_1107488 Ga0316179_11074883 252
272 3300044901 Ga0466960_0042905 Ga0466960_0042905_565_1374 252
273 3300048908 Ga0496105_0182753 Ga0496105_0182753_223_1002 252
274 3300048912 Ga0496109_0135475 Ga0496109_0135475_694_1473 252
275 3300050492 nmdc:mga0yw44_50508_c1 nmdc:mga0yw44_50508_c1_139_915 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00970

FAD_binding_6

Oxidoreductase FAD-binding domain

31

125

0.89

PF00175

NAD_binding_1

Oxidoreductase NAD-binding domain

137

248

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eh1-assembly1.cif.gz_A crystal structure of the flavohem-like-fad/nad binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor 0.8893 18 251
1gvh-assembly1.cif.gz_A the x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket 0.8862 16 252
4eh1-assembly1.cif.gz_A crystal structure of the flavohem-like-fad/nad binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor 0.875 18 251
7w3o-assembly5.cif.gz_E crystal structure of human cyb5r3 0.8732 16 247
7c3a-assembly2.cif.gz_B ferredoxin reductase in carbazole 1,9a-dioxygenase 0.8727 11 249
ID Description Score Start End Superfamily
4eh1A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.9083 120 251 3.40.50.80
1cnfA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.9055 123 245 3.40.50.80
af_Q4DLP7_148_306_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.9036 123 247 3.40.50.80
af_P75824_106_229_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.8981 120 251 3.40.50.80
af_I1KVY3_156_295_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.8973 108 245 3.40.50.80
ID Description Score Start End GO Terms
AF-A0A286HAY6-F1-model_v4 Ferredoxin-NADP reductase 0.975 16 252 GO:0016491
GO:0051537
AF-A0A4Q2KVP1-F1-model_v4 Oxidoreductase 0.968 9 252 GO:0016491
GO:0051537
AF-A0A2W2BJW3-F1-model_v4 Oxidoreductase 0.966 6 252 GO:0016491
GO:0051537
AF-A0A1S2ITT0-F1-model_v4 Oxidoreductase 0.9657 1 252 GO:0016491
GO:0051537
AF-A0A1S2ITT0-F1-model_v4 Oxidoreductase 0.962 1 252 GO:0016491
GO:0051537

Feature Viewer

pLDDT pTM Quality
92.21 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map