F380534

General Info

Members Datasets Scaffolds Average Seq Length
275 135 235 283

Family's Representative Sequence

Representative Sequence 3300033541|Ga0316596_1023426|Ga0316596_10234262
Length 306
Sequence LKLSRRGLETPFFIALWFFHWCCVSSVNNRVQGAGLGLRRSLLEPILANPPREIGFYEVAPENWITMGGKPGKLFRTMTEKFDFVCHGLSLSIGSQDPLDEHFIKEVKKFMTEHHIKLYSEHLSYCSHEGHLYDLMPIPFTAEAVRYVAERINRVQDILEQRIALENVSYYAAPGQEMDEIDFFNAVVAEADCEVLIDINNIYVNSVNHGYDAEAFLKAMPGKRIAYAHIAGHYVEAEDFLVDTHGADIIDPVWRLLAKAYELFGVFPTLLERDFNIPPLQVLLKEVKTIQAIQSSWEKQLHHCYA

Samples

Sample ID Description Type Environment
1 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
2 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
3 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
4 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
5 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
6 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
7 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
8 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
9 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
10 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
11 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
12 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
13 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
14 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
15 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
16 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
17 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
18 2643221559 Lysobacter sp. Root559 Isolate Unclassified
19 2643221586 Lysobacter sp. Root667 Isolate Unclassified
20 2643221593 Lysobacter sp. Root690 Isolate Unclassified
21 2643221612 Lysobacter sp. Root76 Isolate Unclassified
22 2643221727 Lysobacter sp. Root96 Isolate Unclassified
23 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
24 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
25 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
26 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
27 2773857670 Pseudomonas sp. 478 Isolate Unclassified
28 2784132072 Pseudomonas sp. 460 Isolate Unclassified
29 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
30 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
31 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
32 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
33 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
34 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
35 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
36 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
37 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
38 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
39 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
66 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
69 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
70 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
71 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
72 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
73 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
74 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
80 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
81 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
82 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
85 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
86 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
87 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
88 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
89 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
90 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
91 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
92 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
93 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
94 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
95 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
96 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
97 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
98 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
103 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
104 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
105 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
111 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
133 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
134 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
135 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.18
Metatranscriptomes 11.27
Isolates 14.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.27
Nodule 0
Rhizoplane 6.91
Rhizosphere 79.64
Stem 0
Stem Tuber 0
Unclassified 10.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10157153 3300003320 Bacteria 3504
2 rootH1_10022214 3300003323 Bacteria 32591
3 Ga0055536_1000032 3300003781 Bacteria 150527
4 Ga0055530_10000029 3300003791 Bacteria 127049
5 Ga0055530_10000062 3300003791 Bacteria 94942
6 Ga0055540_1000166 3300003792 Bacteria 65613
7 Ga0070660_100096395 3300005339 Bacteria 2339
8 Ga0070660_100166762 3300005339 Bacteria 1777
9 Ga0070671_100318351 3300005355 Bacteria 1325
10 Ga0070659_100215089 3300005366 Bacteria 1585
11 Ga0070706_100155195 3300005467 Bacteria 2137
12 Ga0068853_100114300 3300005539 Bacteria 2401
13 Ga0068856_100101322 3300005614 Bacteria 2872
14 Ga0105237_10352387 3300009545 Bacteria 1476
15 Ga0157316_1001470 3300012510 Bacteria 1466
16 Ga0157370_10287456 3300013104 Bacteria 1519
17 Ga0157374_10000156 3300013296 Bacteria 62978
18 Ga0163161_10438552 3300017792 Bacteria 1054
19 Ga0209676_1000003 3300025292 Bacteria 1454178
20 Ga0209676_1001312 3300025292 Bacteria 25251
21 Ga0209025_1006840 3300025294 Bacteria 8704
22 Ga0209050_1000004 3300025298 Bacteria 1600040
23 Ga0209051_1000052 3300025303 Bacteria 283346
24 Ga0207713_1051926 3300025735 Bacteria 1627
25 Ga0207684_10132208 3300025910 Bacteria 2142
26 Ga0207657_10313009 3300025919 Bacteria 1242
27 Ga0207639_10101886 3300026041 Bacteria 2323
28 Ga0265328_10034924 3300031239 Bacteria 1860
29 Ga0265328_10034978 3300031239 Bacteria 1858
30 Ga0265331_10011001 3300031250 Bacteria 4966
31 Ga0265331_10032321 3300031250 Bacteria 2593
32 Ga0265327_10000247 3300031251 Bacteria 107636
33 Ga0265327_10006957 3300031251 Bacteria 8890
34 Ga0265327_10020344 3300031251 Bacteria 4048
35 Ga0265316_10001281 3300031344 Bacteria 27017
36 Ga0265316_10005304 3300031344 Bacteria 12575
37 Ga0316575_10003799 3300031665 Bacteria 5258
38 Ga0316575_10046925 3300031665 Bacteria 1717
39 Ga0316575_10046980 3300031665 Bacteria 1716
40 Ga0316579_10014338 3300031691 Bacteria 3425
41 Ga0316579_10021500 3300031691 Bacteria 2876
42 Ga0316579_10070277 3300031691 Bacteria 1658
43 Ga0265314_10076478 3300031711 Bacteria 2224
44 Ga0316576_10000575 3300031727 Bacteria 17430
45 Ga0316576_10004516 3300031727 Bacteria 8361
46 Ga0316576_10010987 3300031727 Bacteria 5907
47 Ga0316576_10019654 3300031727 Bacteria 4631
48 Ga0316576_10024520 3300031727 Bacteria 4212
49 Ga0316576_10039707 3300031727 Bacteria 3379
50 Ga0316576_10058073 3300031727 Bacteria 2829
51 Ga0316576_10061614 3300031727 Bacteria 2750
52 Ga0316576_10072400 3300031727 Bacteria 2544
53 Ga0316576_10155144 3300031727 Bacteria 1726
54 Ga0316576_10157428 3300031727 Bacteria 1712
55 Ga0316576_10200679 3300031727 Bacteria 1502
56 Ga0316576_10206042 3300031727 Bacteria 1481
57 Ga0316578_10020284 3300031728 Bacteria 3670
58 Ga0316578_10020855 3300031728 Bacteria 3628
59 Ga0316578_10069854 3300031728 Bacteria 2078
60 Ga0316577_10001292 3300031733 Bacteria 11691
61 Ga0316577_10001698 3300031733 Bacteria 10565
62 Ga0316577_10021396 3300031733 Bacteria 3589
63 Ga0316577_10055058 3300031733 Bacteria 2220
64 Ga0316577_10056952 3300031733 Bacteria 2182
65 Ga0316577_10085620 3300031733 Bacteria 1764
66 Ga0316577_10113358 3300031733 Bacteria 1522
67 Ga0316577_10181867 3300031733 Bacteria 1187
68 Ga0316583_10004225 3300032133 Bacteria 5114
69 Ga0316583_10026793 3300032133 Bacteria 2057
70 Ga0316583_10089200 3300032133 Bacteria 1076
71 Ga0316585_10000405 3300032137 Bacteria 9993
72 Ga0316585_10004219 3300032137 Bacteria 3993
73 Ga0316580_10000522 3300032139 Bacteria 8895
74 Ga0316580_10002246 3300032139 Bacteria 5280
75 Ga0316580_10002949 3300032139 Bacteria 4775
76 Ga0316580_10005979 3300032139 Bacteria 3571
77 Ga0316580_10008563 3300032139 Bacteria 3065
78 Ga0316593_10002432 3300032168 Bacteria 4414
79 Ga0316593_10005537 3300032168 Bacteria 3342
80 Ga0316593_10009494 3300032168 Bacteria 2750
81 Ga0316593_10011362 3300032168 Bacteria 2585
82 Ga0316593_10014597 3300032168 Bacteria 2347
83 Ga0316593_10015056 3300032168 Bacteria 2320
84 Ga0316593_10017141 3300032168 Bacteria 2206
85 Ga0316593_10018617 3300032168 Bacteria 2136
86 Ga0316593_10024666 3300032168 Bacteria 1908
87 Ga0316593_10046068 3300032168 Bacteria 1463
88 Ga0316593_10050826 3300032168 Bacteria 1400
89 Ga0316592_1000196 3300033524 Bacteria 7256
90 Ga0316592_1000819 3300033524 Bacteria 4647
91 Ga0316592_1005801 3300033524 Bacteria 2357
92 Ga0316592_1010652 3300033524 Bacteria 1857
93 Ga0316592_1011704 3300033524 Bacteria 1788
94 Ga0316592_1016334 3300033524 Bacteria 1551
95 Ga0316592_1019464 3300033524 Bacteria 1436
96 Ga0316592_1026589 3300033524 Bacteria 1250
97 Ga0316588_1000244 3300033528 Bacteria 6550
98 Ga0316588_1016509 3300033528 Bacteria 1637
99 Ga0316588_1020262 3300033528 Bacteria 1505
100 Ga0316587_1003718 3300033529 Bacteria 2158
101 Ga0316587_1009193 3300033529 Bacteria 1565
102 Ga0316596_1001118 3300033541 Bacteria 5236
103 Ga0316596_1001502 3300033541 Bacteria 4734
104 Ga0316596_1002892 3300033541 Bacteria 3717
105 Ga0316596_1004574 3300033541 Bacteria 3114
106 Ga0316596_1016855 3300033541 Bacteria 1832
107 Ga0316596_1019476 3300033541 Bacteria 1722
108 Ga0316596_1023426 3300033541 Bacteria 1582
109 Ga0373952_0000612 3300035092 Bacteria 6338
110 Ga0316574_0000885 3300035398 Bacteria 13231
111 Ga0316574_0001419 3300035398 Bacteria 11368
112 Ga0316574_0003760 3300035398 Bacteria 7862
113 Ga0316574_0012134 3300035398 Bacteria 4922
114 Ga0316574_0019831 3300035398 Bacteria 3974
115 Ga0316574_0021943 3300035398 Bacteria 3796
116 Ga0316574_0049976 3300035398 Bacteria 2601
117 Ga0316574_0094588 3300035398 Bacteria 1908
118 Ga0316574_0109263 3300035398 Bacteria 1772
119 Ga0316574_0166612 3300035398 Bacteria 1419
120 Ga0316582_0000189 3300036647 Bacteria 19327
121 Ga0316582_0003523 3300036647 Bacteria 7693
122 Ga0316582_0007282 3300036647 Bacteria 5884
123 Ga0316582_0019217 3300036647 Bacteria 3994
124 Ga0316582_0019622 3300036647 Bacteria 3962
125 Ga0316582_0022549 3300036647 Bacteria 3739
126 Ga0316582_0024323 3300036647 Bacteria 3624
127 Ga0316582_0042218 3300036647 Bacteria 2856
128 Ga0316582_0079893 3300036647 Bacteria 2133
129 Ga0316582_0089648 3300036647 Bacteria 2022
130 Ga0316582_0316050 3300036647 Bacteria 1073
131 Ga0316582_0316261 3300036647 Unclassified 1073
132 Ga0316584_0002030 3300036712 Bacteria 12672
133 Ga0316584_0004278 3300036712 Bacteria 9432
134 Ga0316584_0008178 3300036712 Bacteria 7192
135 Ga0316584_0008645 3300036712 Bacteria 7024
136 Ga0316584_0012746 3300036712 Bacteria 5934
137 Ga0316584_0013479 3300036712 Bacteria 5787
138 Ga0316584_0026934 3300036712 Bacteria 4228
139 Ga0316584_0030007 3300036712 Bacteria 4016
140 Ga0316584_0037885 3300036712 Bacteria 3585
141 Ga0316584_0042411 3300036712 Bacteria 3393
142 Ga0316584_0054976 3300036712 Bacteria 2981
143 Ga0316584_0067309 3300036712 Bacteria 2684
144 Ga0316584_0097614 3300036712 Bacteria 2200
145 Ga0316584_0214113 3300036712 Bacteria 1417
146 Ga0395900_0161251 3300037418 Bacteria 2287
147 Ga0395900_0190072 3300037418 Bacteria 2083
148 Ga0316581_0004263 3300037588 Bacteria 3634
149 Ga0400488_09688 3300038741 Bacteria 2641
150 Ga0400488_60029 3300038741 Bacteria 2064
151 Ga0400483_249044 3300039062 Unclassified 1609
152 Ga0400487_11473 3300039110 Bacteria 9022
153 Ga0400487_16746 3300039110 Bacteria 54203
154 Ga0400487_16772 3300039110 Bacteria 9263
155 Ga0400487_24436 3300039110 Bacteria 1203
156 Ga0400487_52307 3300039110 Bacteria 22894
157 Ga0439439_0000183 3300041406 Bacteria 9496
158 Ga0439447_013160 3300041407 Bacteria 2354
159 Ga0439466_0000781 3300041411 Bacteria 12070
160 Ga0439465_0025787 3300041413 Bacteria 1856
161 Ga0439449_0020180 3300042007 Bacteria 2497
162 Ga0439451_002936 3300042009 Bacteria 3467
163 Ga0439456_003922 3300042013 Bacteria 3022
164 Ga0439463_000173 3300042016 Bacteria 16877
165 Ga0439463_016206 3300042016 Bacteria 1843
166 Ga0450891_000496 3300042129 Bacteria 4110
167 Ga0450904_000457 3300042139 Bacteria 8099
168 Ga0450906_003612 3300042145 Bacteria 3307
169 Ga0451577_0000071 3300042876 Bacteria 238560
170 Ga0453684_0000537 3300044712 Bacteria 144017
171 Ga0453684_0002309 3300044712 Bacteria 46864
172 Ga0453684_0007300 3300044712 Bacteria 20438
173 Ga0453684_0027745 3300044712 Bacteria 8106
174 Ga0453684_0116569 3300044712 Bacteria 3234
175 Ga0453684_0587535 3300044712 Bacteria 1222
176 Ga0451576_0006131 3300045051 Bacteria 14817
177 Ga0495607_0011989 3300046501 Bacteria 5737
178 Ga0495622_0019220 3300046557 Bacteria 3182
179 Ga0495670_0007662 3300046691 Bacteria 5307
180 Ga0495685_027921 3300047447 Bacteria 1941
181 Ga0496109_0117673 3300048912 Bacteria 2474
182 Ga0496110_0768009 3300048913 Bacteria 867
183 Ga0496113_0055587 3300048916 Bacteria 2968
184 Ga0496114_0004694 3300048917 Bacteria 10627
185 Ga0496118_0000409 3300048921 Bacteria 71632
186 Ga0501031_0022416 3300049568 Bacteria 4117
187 Ga0501031_0029848 3300049568 Bacteria 3556
188 Ga0501032_0000588 3300049569 Bacteria 29293
189 Ga0501032_0039714 3300049569 Bacteria 3200
190 Ga0501033_0009180 3300049570 Bacteria 7618
191 Ga0501034_0000844 3300049571 Bacteria 45327
192 Ga0501034_0118965 3300049571 Bacteria 2628
193 Ga0501034_0396445 3300049571 Unclassified 1303
194 Ga0501036_0001286 3300049572 Bacteria 19223
195 Ga0501036_0005166 3300049572 Bacteria 10558
196 Ga0501036_0020486 3300049572 Bacteria 5554
197 Ga0501037_0026769 3300049573 Bacteria 4261
198 Ga0501037_0071157 3300049573 Bacteria 2530
199 Ga0501037_0134923 3300049573 Bacteria 1768
200 Ga0501037_0225820 3300049573 Unclassified 1316
201 Ga0501038_0005428 3300049574 Bacteria 11847
202 Ga0501038_0014080 3300049574 Bacteria 7286
203 Ga0501038_0022372 3300049574 Bacteria 5666
204 Ga0501038_0033546 3300049574 Bacteria 4522
205 Ga0501038_0056287 3300049574 Bacteria 3377
206 Ga0501038_0144730 3300049574 Bacteria 1941
207 Ga0501038_0184931 3300049574 Bacteria 1679
208 Ga0501039_0028007 3300049575 Bacteria 4334
209 Ga0501040_0000500 3300049576 Bacteria 23417
210 Ga0501042_0009099 3300049578 Bacteria 6602
211 Ga0501043_0050527 3300049579 Bacteria 3268
212 Ga0501043_0070936 3300049579 Bacteria 2736
213 Ga0501043_0106019 3300049579 Bacteria 2208
214 Ga0501043_0161743 3300049579 Bacteria 1749
215 Ga0501046_0006968 3300049580 Bacteria 9957
216 Ga0501046_0049731 3300049580 Bacteria 3315
217 Ga0501046_0072556 3300049580 Bacteria 2673
218 Ga0501047_0002699 3300049581 Bacteria 16886
219 Ga0501047_0120150 3300049581 Bacteria 2510
220 Ga0501048_0015808 3300049582 Bacteria 5567
221 Ga0501068_0032639 3300049584 Bacteria 3096
222 Ga0501070_0010538 3300049586 Bacteria 7815
223 Ga0501070_0162462 3300049586 Bacteria 1841
224 Ga0501074_0095960 3300049590 Bacteria 2123
225 Ga0501230_031625 3300049667 Bacteria 988
226 Ga0501080_0077280 3300049742 Bacteria 3096
227 Ga0501080_0386734 3300049742 Unclassified 1260
228 Ga0501035_0003981 3300049822 Bacteria 14083
229 Ga0501035_0035436 3300049822 Bacteria 4529
230 Ga0501035_0183504 3300049822 Bacteria 1802
231 Ga0501044_0000111 3300049823 Bacteria 100080
232 Ga0501044_0006145 3300049823 Bacteria 13263
233 Ga0501044_0006735 3300049823 Bacteria 12667
234 Ga0501044_0186002 3300049823 Bacteria 2042
235 Ga0501044_0322784 3300049823 Bacteria 1468

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031665 Ga0316575_10046980 Ga0316575_100469802 241
2 3300035398 Ga0316574_0094588 Ga0316574_0094588_999_1778 247
3 3300037418 Ga0395900_0190072 Ga0395900_0190072_132_959 248
4 3300049571 Ga0501034_0396445 Ga0501034_0396445_124_990 249
5 3300049579 Ga0501043_0106019 Ga0501043_0106019_132_1019 249
6 3300049822 Ga0501035_0183504 Ga0501035_0183504_704_1591 249
7 3300031733 Ga0316577_10001698 Ga0316577_100016985 252
8 3300032133 Ga0316583_10026793 Ga0316583_100267932 252
9 3300032137 Ga0316585_10000405 Ga0316585_1000040510 252
10 3300032139 Ga0316580_10005979 Ga0316580_100059792 252
11 3300032168 Ga0316593_10018617 Ga0316593_100186172 252
12 3300033541 Ga0316596_1019476 Ga0316596_10194761 252
13 3300035398 Ga0316574_0049976 Ga0316574_0049976_419_1276 252
14 3300036647 Ga0316582_0000189 Ga0316582_0000189_7308_8165 252
15 3300036647 Ga0316582_0007282 Ga0316582_0007282_2869_3660 252
16 3300036712 Ga0316584_0008178 Ga0316584_0008178_5567_6424 252
17 3300036712 Ga0316584_0097614 Ga0316584_0097614_685_1476 252
18 3300046501 Ga0495607_0011989 Ga0495607_0011989_3400_4173 252
19 3300046691 Ga0495670_0007662 Ga0495670_0007662_3502_4275 252
20 3300035398 Ga0316574_0001419 Ga0316574_0001419_2441_3232 253
21 3300036712 Ga0316584_0030007 Ga0316584_0030007_1964_2767 254
22 3300036647 Ga0316582_0316261 Ga0316582_0316261_242_1042 255
23 3300036647 Ga0316582_0003523 Ga0316582_0003523_2441_3241 256
24 3300039110 Ga0400487_11473 Ga0400487_11473_2804_3604 256
25 3300048913 Ga0496110_0768009 Ga0496110_0768009_30_833 256
26 3300035398 Ga0316574_0109263 Ga0316574_0109263_169_1029 257
27 3300049586 Ga0501070_0010538 Ga0501070_0010538_409_1257 257
28 3300049742 Ga0501080_0386734 Ga0501080_0386734_355_1203 257
29 iso_pu_bacteria 2923153595 2923156291 257
30 3300049573 Ga0501037_0026769 Ga0501037_0026769_3099_3950 258
31 iso_pu_bacteria 8054357960 8054360692 260
32 3300042139 Ga0450904_000457 Ga0450904_000457_2295_3140 261
33 3300049581 Ga0501047_0120150 Ga0501047_0120150_11_835 261
34 3300005339 Ga0070660_100166762 Ga0070660_1001667623 262
35 3300005614 Ga0068856_100101322 Ga0068856_1001013224 262
36 3300013104 Ga0157370_10287456 Ga0157370_102874562 262
37 3300048912 Ga0496109_0117673 Ga0496109_0117673_334_1137 262
38 iso_pu_bacteria 2887630918 2887631518 264
39 3300033524 Ga0316592_1019464 Ga0316592_10194642 267
40 3300035398 Ga0316574_0003760 Ga0316574_0003760_5108_5944 267
41 iso_pu_bacteria 8001522603 8001525062 268
42 iso_pu_bacteria 2599185318 2600033825 269
43 iso_pu_bacteria 2599185319 2600040966 269
44 iso_pu_bacteria 2599185323 2600067313 269
45 iso_pu_bacteria 2643221593 2643974860 269
46 iso_pu_bacteria 2690315857 2691330904 269
47 iso_pu_bacteria 2773857670 2774123110 269
48 iso_pu_bacteria 2784132072 2784315484 269
49 iso_pu_bacteria 2919534386 2919534457 269
50 iso_pu_bacteria 2989392574 2989392582 269
51 3300017792 Ga0163161_10438552 Ga0163161_104385521 270
52 3300037418 Ga0395900_0161251 Ga0395900_0161251_26_853 270
53 3300048917 Ga0496114_0004694 Ga0496114_0004694_7394_8236 270
54 iso_pu_bacteria 2600255389 2602011440 270
55 iso_pu_bacteria 2643221559 2643818305 270
56 iso_pu_bacteria 2643221586 2643937966 270
57 iso_pu_bacteria 2643221612 2644078884 270
58 iso_pu_bacteria 2643221727 2644693661 270
59 iso_pu_bacteria 2894510363 2894510371 270
60 3300005467 Ga0070706_100155195 Ga0070706_1001551953 271
61 3300025910 Ga0207684_10132208 Ga0207684_101322082 271
62 3300031250 Ga0265331_10011001 Ga0265331_100110016 271
63 3300031251 Ga0265327_10020344 Ga0265327_100203443 271
64 3300031727 Ga0316576_10024520 Ga0316576_100245202 271
65 3300041407 Ga0439447_013160 Ga0439447_013160_1361_2206 271
66 3300042009 Ga0439451_002936 Ga0439451_002936_1039_1884 271
67 3300042013 Ga0439456_003922 Ga0439456_003922_575_1420 271
68 3300042016 Ga0439463_016206 Ga0439463_016206_382_1227 271
69 3300042129 Ga0450891_000496 Ga0450891_000496_97_984 271
70 3300042145 Ga0450906_003612 Ga0450906_003612_1590_2435 271
71 3300044712 Ga0453684_0002309 Ga0453684_0002309_36921_37742 271
72 iso_pu_bacteria 2599185300 2599932677 271
73 iso_pu_bacteria 2599185302 2599943433 271
74 iso_pu_bacteria 2599185304 2599954544 271
75 iso_pu_bacteria 2599185309 2599983857 271
76 iso_pu_bacteria 2599185310 2599988637 271
77 iso_pu_bacteria 2599185312 2600001459 271
78 iso_pu_bacteria 2599185320 2600048662 271
79 iso_pu_bacteria 2916178963 2916182891 271
80 3300025735 Ga0207713_1051926 Ga0207713_10519262 272
81 3300031239 Ga0265328_10034924 Ga0265328_100349242 272
82 3300031250 Ga0265331_10032321 Ga0265331_100323212 272
83 3300031344 Ga0265316_10005304 Ga0265316_1000530412 272
84 3300031665 Ga0316575_10003799 Ga0316575_100037997 272
85 3300031711 Ga0265314_10076478 Ga0265314_100764782 272
86 3300031727 Ga0316576_10200679 Ga0316576_102006792 272
87 3300031733 Ga0316577_10021396 Ga0316577_100213963 272
88 3300031733 Ga0316577_10056952 Ga0316577_100569523 272
89 3300031733 Ga0316577_10113358 Ga0316577_101133582 272
90 3300032139 Ga0316580_10002949 Ga0316580_100029492 272
91 3300032168 Ga0316593_10009494 Ga0316593_100094943 272
92 3300032168 Ga0316593_10024666 Ga0316593_100246662 272
93 3300032168 Ga0316593_10046068 Ga0316593_100460682 272
94 3300033541 Ga0316596_1002892 Ga0316596_10028923 272
95 3300035398 Ga0316574_0021943 Ga0316574_0021943_220_1074 272
96 3300035398 Ga0316574_0166612 Ga0316574_0166612_248_1138 272
97 3300036647 Ga0316582_0019622 Ga0316582_0019622_2660_3514 272
98 3300036647 Ga0316582_0022549 Ga0316582_0022549_1037_1909 272
99 3300036712 Ga0316584_0002030 Ga0316584_0002030_11488_12360 272
100 3300036712 Ga0316584_0008645 Ga0316584_0008645_3461_4315 272
101 3300037588 Ga0316581_0004263 Ga0316581_0004263_1136_2008 272
102 3300039110 Ga0400487_52307 Ga0400487_52307_896_1747 272
103 3300044712 Ga0453684_0007300 Ga0453684_0007300_16373_17215 272
104 3300044712 Ga0453684_0587535 Ga0453684_0587535_263_1111 272
105 3300049573 Ga0501037_0134923 Ga0501037_0134923_205_1056 272
106 3300049574 Ga0501038_0005428 Ga0501038_0005428_9659_10510 272
107 3300049586 Ga0501070_0162462 Ga0501070_0162462_208_1059 272
108 3300049590 Ga0501074_0095960 Ga0501074_0095960_326_1177 272
109 3300049742 Ga0501080_0077280 Ga0501080_0077280_1487_2338 272
110 3300005339 Ga0070660_100096395 Ga0070660_1000963953 273
111 3300005366 Ga0070659_100215089 Ga0070659_1002150892 273
112 3300005539 Ga0068853_100114300 Ga0068853_1001143004 273
113 3300009545 Ga0105237_10352387 Ga0105237_103523871 273
114 3300013296 Ga0157374_10000156 Ga0157374_1000015636 273
115 3300025292 Ga0209676_1001312 Ga0209676_100131215 273
116 3300025294 Ga0209025_1006840 Ga0209025_10068403 273
117 3300025919 Ga0207657_10313009 Ga0207657_103130091 273
118 3300026041 Ga0207639_10101886 Ga0207639_101018864 273
119 3300031239 Ga0265328_10034978 Ga0265328_100349782 273
120 3300031251 Ga0265327_10000247 Ga0265327_1000024727 273
121 3300031251 Ga0265327_10006957 Ga0265327_100069577 273
122 3300031344 Ga0265316_10001281 Ga0265316_1000128116 273
123 3300032168 Ga0316593_10017141 Ga0316593_100171412 273
124 3300033524 Ga0316592_1005801 Ga0316592_10058012 273
125 3300035092 Ga0373952_0000612 Ga0373952_0000612_3027_3878 273
126 3300035398 Ga0316574_0000885 Ga0316574_0000885_9870_10727 273
127 3300036712 Ga0316584_0026934 Ga0316584_0026934_1880_2734 273
128 3300038741 Ga0400488_09688 Ga0400488_09688_1086_1937 273
129 3300038741 Ga0400488_60029 Ga0400488_60029_835_1689 273
130 3300039062 Ga0400483_249044 Ga0400483_249044_153_1004 273
131 3300039110 Ga0400487_16746 Ga0400487_16746_52486_53340 273
132 3300039110 Ga0400487_16772 Ga0400487_16772_5578_6429 273
133 3300039110 Ga0400487_24436 Ga0400487_24436_124_975 273
134 3300041406 Ga0439439_0000183 Ga0439439_0000183_6274_7134 273
135 3300041413 Ga0439465_0025787 Ga0439465_0025787_468_1325 273
136 3300042007 Ga0439449_0020180 Ga0439449_0020180_352_1209 273
137 3300047447 Ga0495685_027921 Ga0495685_027921_260_1120 273
138 3300048921 Ga0496118_0000409 Ga0496118_0000409_61838_62692 273
139 3300049568 Ga0501031_0022416 Ga0501031_0022416_2831_3691 273
140 3300049568 Ga0501031_0029848 Ga0501031_0029848_1679_2539 273
141 3300049569 Ga0501032_0000588 Ga0501032_0000588_9182_10042 273
142 3300049570 Ga0501033_0009180 Ga0501033_0009180_3882_4742 273
143 3300049571 Ga0501034_0000844 Ga0501034_0000844_8013_8873 273
144 3300049571 Ga0501034_0118965 Ga0501034_0118965_1533_2387 273
145 3300049572 Ga0501036_0001286 Ga0501036_0001286_8014_8874 273
146 3300049572 Ga0501036_0005166 Ga0501036_0005166_7072_7932 273
147 3300049572 Ga0501036_0020486 Ga0501036_0020486_2904_3764 273
148 3300049573 Ga0501037_0071157 Ga0501037_0071157_825_1685 273
149 3300049573 Ga0501037_0225820 Ga0501037_0225820_284_1144 273
150 3300049574 Ga0501038_0022372 Ga0501038_0022372_3304_4164 273
151 3300049574 Ga0501038_0033546 Ga0501038_0033546_1643_2503 273
152 3300049574 Ga0501038_0056287 Ga0501038_0056287_1976_2836 273
153 3300049574 Ga0501038_0144730 Ga0501038_0144730_296_1156 273
154 3300049574 Ga0501038_0184931 Ga0501038_0184931_82_942 273
155 3300049575 Ga0501039_0028007 Ga0501039_0028007_447_1307 273
156 3300049576 Ga0501040_0000500 Ga0501040_0000500_975_1835 273
157 3300049578 Ga0501042_0009099 Ga0501042_0009099_456_1316 273
158 3300049579 Ga0501043_0050527 Ga0501043_0050527_607_1467 273
159 3300049579 Ga0501043_0070936 Ga0501043_0070936_10_870 273
160 3300049579 Ga0501043_0161743 Ga0501043_0161743_419_1279 273
161 3300049580 Ga0501046_0006968 Ga0501046_0006968_7014_7874 273
162 3300049580 Ga0501046_0049731 Ga0501046_0049731_729_1589 273
163 3300049580 Ga0501046_0072556 Ga0501046_0072556_1008_1868 273
164 3300049581 Ga0501047_0002699 Ga0501047_0002699_8014_8874 273
165 3300049582 Ga0501048_0015808 Ga0501048_0015808_1244_2104 273
166 3300049584 Ga0501068_0032639 Ga0501068_0032639_1913_2773 273
167 3300049822 Ga0501035_0003981 Ga0501035_0003981_6615_7475 273
168 3300049822 Ga0501035_0035436 Ga0501035_0035436_632_1492 273
169 3300049823 Ga0501044_0000111 Ga0501044_0000111_5381_6241 273
170 3300049823 Ga0501044_0006145 Ga0501044_0006145_11299_12159 273
171 3300049823 Ga0501044_0006735 Ga0501044_0006735_3178_4038 273
172 3300049823 Ga0501044_0186002 Ga0501044_0186002_416_1276 273
173 3300049823 Ga0501044_0322784 Ga0501044_0322784_481_1335 273
174 3300005355 Ga0070671_100318351 Ga0070671_1003183511 274
175 3300012510 Ga0157316_1001470 Ga0157316_10014702 274
176 3300031691 Ga0316579_10021500 Ga0316579_100215003 274
177 3300031727 Ga0316576_10061614 Ga0316576_100616144 274
178 3300032168 Ga0316593_10015056 Ga0316593_100150563 274
179 3300036647 Ga0316582_0089648 Ga0316582_0089648_750_1604 274
180 3300036712 Ga0316584_0037885 Ga0316584_0037885_1002_1904 274
181 3300036712 Ga0316584_0214113 Ga0316584_0214113_274_1128 274
182 3300042876 Ga0451577_0000071 Ga0451577_0000071_118963_119805 274
183 3300044712 Ga0453684_0000537 Ga0453684_0000537_36551_37393 274
184 3300044712 Ga0453684_0027745 Ga0453684_0027745_6693_7544 274
185 3300044712 Ga0453684_0116569 Ga0453684_0116569_932_1774 274
186 3300045051 Ga0451576_0006131 Ga0451576_0006131_2553_3404 274
187 3300048916 Ga0496113_0055587 Ga0496113_0055587_123_983 274
188 3300049569 Ga0501032_0039714 Ga0501032_0039714_927_1757 274
189 3300049574 Ga0501038_0014080 Ga0501038_0014080_824_1681 274
190 iso_pu_bacteria 2738541276 2738715649 274
191 iso_pu_bacteria 3007395558 3007395671 274
192 3300031665 Ga0316575_10046925 Ga0316575_100469251 275
193 3300031691 Ga0316579_10014338 Ga0316579_100143382 275
194 3300031691 Ga0316579_10070277 Ga0316579_100702772 275
195 3300031727 Ga0316576_10004516 Ga0316576_100045166 275
196 3300031727 Ga0316576_10019654 Ga0316576_100196545 275
197 3300031727 Ga0316576_10039707 Ga0316576_100397071 275
198 3300031727 Ga0316576_10058073 Ga0316576_100580732 275
199 3300031727 Ga0316576_10157428 Ga0316576_101574282 275
200 3300031727 Ga0316576_10206042 Ga0316576_102060422 275
201 3300031728 Ga0316578_10020284 Ga0316578_100202843 275
202 3300031728 Ga0316578_10069854 Ga0316578_100698542 275
203 3300031733 Ga0316577_10001292 Ga0316577_1000129211 275
204 3300031733 Ga0316577_10055058 Ga0316577_100550582 275
205 3300031733 Ga0316577_10181867 Ga0316577_101818672 275
206 3300032133 Ga0316583_10004225 Ga0316583_100042254 275
207 3300032133 Ga0316583_10089200 Ga0316583_100892002 275
208 3300032137 Ga0316585_10004219 Ga0316585_100042193 275
209 3300032139 Ga0316580_10000522 Ga0316580_100005225 275
210 3300032139 Ga0316580_10002246 Ga0316580_100022463 275
211 3300032139 Ga0316580_10008563 Ga0316580_100085632 275
212 3300032168 Ga0316593_10002432 Ga0316593_100024322 275
213 3300032168 Ga0316593_10005537 Ga0316593_100055373 275
214 3300032168 Ga0316593_10011362 Ga0316593_100113623 275
215 3300032168 Ga0316593_10014597 Ga0316593_100145973 275
216 3300032168 Ga0316593_10050826 Ga0316593_100508262 275
217 3300033524 Ga0316592_1000196 Ga0316592_10001963 275
218 3300033524 Ga0316592_1000819 Ga0316592_10008194 275
219 3300033524 Ga0316592_1010652 Ga0316592_10106522 275
220 3300033524 Ga0316592_1011704 Ga0316592_10117041 275
221 3300033524 Ga0316592_1016334 Ga0316592_10163342 275
222 3300033528 Ga0316588_1000244 Ga0316588_10002444 275
223 3300033528 Ga0316588_1016509 Ga0316588_10165092 275
224 3300033528 Ga0316588_1020262 Ga0316588_10202623 275
225 3300033529 Ga0316587_1003718 Ga0316587_10037182 275
226 3300033529 Ga0316587_1009193 Ga0316587_10091932 275
227 3300033541 Ga0316596_1001118 Ga0316596_10011182 275
228 3300033541 Ga0316596_1001502 Ga0316596_10015022 275
229 3300033541 Ga0316596_1004574 Ga0316596_10045744 275
230 3300033541 Ga0316596_1016855 Ga0316596_10168552 275
231 3300035398 Ga0316574_0012134 Ga0316574_0012134_3330_4187 275
232 3300036647 Ga0316582_0019217 Ga0316582_0019217_1843_2700 275
233 3300036647 Ga0316582_0024323 Ga0316582_0024323_2345_3211 275
234 3300036647 Ga0316582_0042218 Ga0316582_0042218_865_1728 275
235 3300036647 Ga0316582_0079893 Ga0316582_0079893_229_1086 275
236 3300036647 Ga0316582_0316050 Ga0316582_0316050_123_980 275
237 3300036712 Ga0316584_0004278 Ga0316584_0004278_8383_9240 275
238 3300036712 Ga0316584_0012746 Ga0316584_0012746_2163_3020 275
239 3300036712 Ga0316584_0013479 Ga0316584_0013479_1151_2008 275
240 3300036712 Ga0316584_0042411 Ga0316584_0042411_1247_2104 275
241 3300036712 Ga0316584_0054976 Ga0316584_0054976_603_1466 275
242 3300036712 Ga0316584_0067309 Ga0316584_0067309_1341_2198 275
243 3300031727 Ga0316576_10000575 Ga0316576_1000057510 276
244 3300031727 Ga0316576_10072400 Ga0316576_100724002 276
245 3300031728 Ga0316578_10020855 Ga0316578_100208554 276
246 3300031733 Ga0316577_10085620 Ga0316577_100856202 276
247 3300033541 Ga0316596_1023426 Ga0316596_10234262 276
248 3300035398 Ga0316574_0019831 Ga0316574_0019831_405_1286 276
249 3300041411 Ga0439466_0000781 Ga0439466_0000781_9874_10758 276
250 3300042016 Ga0439463_000173 Ga0439463_000173_606_1490 276
251 iso_pu_bacteria 2512047018 2512323550 276
252 iso_pu_bacteria 2582580891 2583791586 276
253 iso_pu_bacteria 2597489887 2597857790 276
254 iso_pu_bacteria 2599185185 2599484822 276
255 iso_pu_bacteria 2599185257 2599802453 276
256 iso_pu_bacteria 2600254931 2600367693 276
257 iso_pu_bacteria 2671180172 2671769928 276
258 iso_pu_bacteria 2740892503 2743737253 276
259 iso_pu_bacteria 2984286254 2984289776 276
260 iso_pu_bacteria 8015687852 8015690484 276
261 iso_pu_bacteria 8055770955 8055773612 276
262 3300003781 Ga0055536_1000032 Ga0055536_100003295 277
263 3300003791 Ga0055530_10000029 Ga0055530_1000002995 277
264 3300003791 Ga0055530_10000062 Ga0055530_1000006265 277
265 3300003792 Ga0055540_1000166 Ga0055540_100016637 277
266 3300025292 Ga0209676_1000003 Ga0209676_10000031029 277
267 3300025298 Ga0209050_1000004 Ga0209050_10000041011 277
268 3300025303 Ga0209051_1000052 Ga0209051_1000052244 277
269 3300031727 Ga0316576_10010987 Ga0316576_100109877 277
270 3300031727 Ga0316576_10155144 Ga0316576_101551442 277
271 3300033524 Ga0316592_1026589 Ga0316592_10265892 277
272 3300046557 Ga0495622_0019220 Ga0495622_0019220_2117_3058 278
273 3300003320 rootH2_10157153 rootH2_101571532 279
274 3300003323 rootH1_10022214 rootH1_1002221416 279
275 3300049667 Ga0501230_031625 Ga0501230_031625_106_945 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05114

DUF692

Protein of unknown function (DUF692)

33

295

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bww-assembly1.cif.gz_A crystal structure of a duf692 family protein (hs_1138) from haemophilus somnus 129pt at 2.20 a resolution 0.939 13 278
3bww-assembly1.cif.gz_A crystal structure of a duf692 family protein (hs_1138) from haemophilus somnus 129pt at 2.20 a resolution 0.885 13 278
7dz9-assembly1.cif.gz_A mbnabc complex 0.8607 13 276
7dz9-assembly1.cif.gz_A mbnabc complex 0.8577 13 276
7dz9-assembly2.cif.gz_B mbnabc complex 0.8343 13 276
ID Description Score Start End Superfamily
3bwwA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9405 13 278 3.20.20.150
3bwwA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8887 13 278 3.20.20.150
3wqoA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.6506 12 278 3.20.20.150
3aamA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.65 14 277 3.20.20.150
3vnmD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.6448 13 279 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A7C5G3X7-F1-model_v4 DUF692 family protein 0.9983 173 279
AF-A0A3C0JGH9-F1-model_v4 DUF692 domain-containing protein 0.998 168 278
AF-A0A290TR95-F1-model_v4 deleted 0.9854 159 278
AF-A0A0F8VS96-F1-model_v4 Uncharacterized protein 0.9851 186 278
AF-A0A661EYT2-F1-model_v4 DUF692 domain-containing protein 0.9825 130 277

Feature Viewer

pLDDT pTM Quality
89.22 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map