F380516

General Info

Members Datasets Scaffolds Average Seq Length
275 147 550 250

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10142076|Ga0265338_101420764
Length 258
Sequence VLSASPLLLAHTHSPYAWQADVDTTVVIPVLGLLYLYAVGRYGAARREILCFGGSLTLLAIAFWTPLHHLGLHYLLTAHLLQNVLLAEWAPLLAVLGISGAMARSLARSRSWRFLVNPAVALPVWLIDYYTWHVPPVYDAALRHQEWLIHIEHACYFGTGILFWWPLVQNEPRRLASGARAMYAFAAFVLASPLGLLLALLPKPAYPFYVHVTRRIWGLSPLADQEIAGVTMASEQAIVLFLVFGYWFRRFLAEEGAL

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
34 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
58 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
59 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
60 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
61 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
62 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
63 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
64 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
65 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
70 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
71 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
87 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
101 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
105 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
106 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
107 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
108 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
109 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
110 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
111 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
144 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.82
Rhizosphere 85.82
Stem 0
Stem Tuber 0
Unclassified 6.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10142076 3300028800 Bacteria 1879
2 Ga0070658_10002700 3300005327 Bacteria 14759
3 Ga0070658_10096479 3300005327 Unclassified 2441
4 Ga0070683_100000408 3300005329 Bacteria 29693
5 Ga0070683_100135569 3300005329 Bacteria 2331
6 Ga0070680_100002781 3300005336 Bacteria 12987
7 Ga0070680_100033966 3300005336 Bacteria 4113
8 Ga0070660_100004001 3300005339 Bacteria 10172
9 Ga0070660_100016358 3300005339 Bacteria 5383
10 Ga0070660_100017110 3300005339 Bacteria 5279
11 Ga0070660_100157481 3300005339 Bacteria 1829
12 Ga0070660_100392682 3300005339 Bacteria 1146
13 Ga0070661_100043452 3300005344 Bacteria 3282
14 Ga0070671_100108543 3300005355 Bacteria 2330
15 Ga0070659_100163371 3300005366 Bacteria 1822
16 Ga0070667_100002035 3300005367 Bacteria 17921
17 Ga0070711_100230821 3300005439 Bacteria 1443
18 Ga0070681_10006108 3300005458 Bacteria 11687
19 Ga0070681_10082870 3300005458 Unclassified 3162
20 Ga0070681_10106773 3300005458 Bacteria 2741
21 Ga0070681_10115772 3300005458 Bacteria 2618
22 Ga0070679_100044362 3300005530 Bacteria 4430
23 Ga0070679_100046504 3300005530 Bacteria 4325
24 Ga0070679_100126012 3300005530 Bacteria 2543
25 Ga0070679_100202069 3300005530 Bacteria 1953
26 Ga0070679_100316027 3300005530 Bacteria 1511
27 Ga0070684_100024426 3300005535 Bacteria 5071
28 Ga0070684_100133972 3300005535 Bacteria 2236
29 Ga0070684_100410266 3300005535 Bacteria 1250
30 Ga0068853_100243031 3300005539 Bacteria 1650
31 Ga0070665_100072677 3300005548 Bacteria 3446
32 Ga0068855_100008420 3300005563 Bacteria 12474
33 Ga0068855_100054046 3300005563 Bacteria 4722
34 Ga0068855_100077508 3300005563 Bacteria 3856
35 Ga0068855_100145403 3300005563 Bacteria 2699
36 Ga0068855_100317853 3300005563 Unclassified 1722
37 Ga0068855_100717527 3300005563 Bacteria 1069
38 Ga0068857_100017763 3300005577 Bacteria 6235
39 Ga0068857_100191285 3300005577 Bacteria 1864
40 Ga0068856_100125320 3300005614 Bacteria 2572
41 Ga0068852_100345241 3300005616 Bacteria 1452
42 Ga0070712_100379876 3300006175 Bacteria 1163
43 Ga0070712_100549424 3300006175 Unclassified 973
44 Ga0075435_100017357 3300007076 Bacteria 5447
45 Ga0105240_10053057 3300009093 Bacteria 5093
46 Ga0105240_10144963 3300009093 Bacteria 2835
47 Ga0105240_10278351 3300009093 Unclassified 1923
48 Ga0105240_10293360 3300009093 Unclassified 1863
49 Ga0105241_10222778 3300009174 Bacteria 1586
50 Ga0105242_10092934 3300009176 Bacteria 2542
51 Ga0105238_10142066 3300009551 Bacteria 2377
52 Ga0105238_10142779 3300009551 Bacteria 2371
53 Ga0157370_10002580 3300013104 Bacteria 21763
54 Ga0157370_10017006 3300013104 Bacteria 7349
55 Ga0157369_10004685 3300013105 Bacteria 16081
56 Ga0157369_10405940 3300013105 Bacteria 1413
57 Ga0157369_10586086 3300013105 Bacteria 1152
58 Ga0157374_10194808 3300013296 Bacteria 1983
59 Ga0157378_10165045 3300013297 Bacteria 2074
60 Ga0157372_10100458 3300013307 Bacteria 3301
61 Ga0157372_10125387 3300013307 Bacteria 2952
62 Ga0157372_11497140 3300013307 Bacteria 777
63 Ga0157375_10100688 3300013308 Bacteria 2971
64 Ga0182008_10156370 3300014497 Bacteria 1145
65 Ga0182007_10032786 3300015262 Unclassified 1763
66 Ga0206353_11403674 3300020082 Unclassified 1719
67 Ga0207685_10072345 3300025905 Unclassified 1401
68 Ga0207699_10139257 3300025906 Bacteria 1593
69 Ga0207705_10091205 3300025909 Unclassified 2232
70 Ga0207705_10153719 3300025909 Bacteria 1725
71 Ga0207705_10238035 3300025909 Bacteria 1386
72 Ga0207654_10124797 3300025911 Bacteria 1621
73 Ga0207707_10006694 3300025912 Bacteria 10057
74 Ga0207707_10045335 3300025912 Unclassified 3832
75 Ga0207707_10188786 3300025912 Bacteria 1798
76 Ga0207695_10252214 3300025913 Bacteria 1664
77 Ga0207671_10207100 3300025914 Bacteria 1533
78 Ga0207693_10312420 3300025915 Bacteria 1231
79 Ga0207693_10526755 3300025915 Bacteria 922
80 Ga0207663_10124868 3300025916 Bacteria 1769
81 Ga0207663_10320175 3300025916 Bacteria 1165
82 Ga0207660_10010856 3300025917 Bacteria 5921
83 Ga0207660_10021575 3300025917 Bacteria 4332
84 Ga0207660_10159198 3300025917 Bacteria 1741
85 Ga0207657_10000536 3300025919 Bacteria 40425
86 Ga0207657_10002980 3300025919 Bacteria 18154
87 Ga0207657_10003696 3300025919 Bacteria 16270
88 Ga0207652_10010087 3300025921 Bacteria 7610
89 Ga0207652_10119857 3300025921 Unclassified 2340
90 Ga0207652_10143746 3300025921 Bacteria 2134
91 Ga0207694_10027861 3300025924 Bacteria 4304
92 Ga0207694_10139178 3300025924 Bacteria 1951
93 Ga0207690_10136656 3300025932 Bacteria 1800
94 Ga0207665_10234586 3300025939 Bacteria 1349
95 Ga0207665_10397651 3300025939 Bacteria 1049
96 Ga0207661_10387593 3300025944 Bacteria 1265
97 Ga0207667_10026127 3300025949 Bacteria 6383
98 Ga0207667_10057447 3300025949 Bacteria 4084
99 Ga0207667_10137242 3300025949 Bacteria 2518
100 Ga0207658_10010913 3300025986 Bacteria 6184
101 Ga0207678_10042448 3300026067 Bacteria 3939
102 Ga0207702_10454164 3300026078 Bacteria 1244
103 Ga0207702_10664953 3300026078 Bacteria 1025
104 Ga0207674_10186165 3300026116 Bacteria 2027
105 Ga0268266_10056461 3300028379 Bacteria 3378
106 Ga0265319_1007549 3300028563 Bacteria 4871
107 Ga0265334_10019086 3300028573 Bacteria 2824
108 Ga0265334_10131019 3300028573 Bacteria 892
109 Ga0265318_10003152 3300028577 Bacteria 8435
110 Ga0265322_10003049 3300028654 Bacteria 5102
111 Ga0265338_10029410 3300028800 Bacteria 5447
112 Ga0265338_10357133 3300028800 Bacteria 1049
113 Ga0265320_10044305 3300031240 Bacteria 2193
114 Ga0265325_10017735 3300031241 Bacteria 3955
115 Ga0265340_10025317 3300031247 Bacteria 3006
116 Ga0265340_10040450 3300031247 Bacteria 2297
117 Ga0265339_10035690 3300031249 Bacteria 2788
118 Ga0265327_10015201 3300031251 Bacteria 4985
119 Ga0265316_10026475 3300031344 Bacteria 4822
120 Ga0265313_10015890 3300031595 Bacteria 4355
121 Ga0265314_10004440 3300031711 Bacteria 13022
122 Ga0265342_10163141 3300031712 Bacteria 1231
123 Ga0373926_0069073 3300035083 Bacteria 1296
124 Ga0373936_0012113 3300035113 Bacteria 3275
125 Ga0373946_0044131 3300035171 Bacteria 1840
126 Ga0373935_0040101 3300035692 Bacteria 2938
127 Ga0373925_0017622 3300037068 Bacteria 5181
128 Ga0395899_0098380 3300037312 Bacteria 2113
129 Ga0395900_0022210 3300037418 Bacteria 6491
130 Ga0395900_0058821 3300037418 Bacteria 3957
131 Ga0395900_0069635 3300037418 Bacteria 3616
132 Ga0395898_0100203 3300037466 Bacteria 2782
133 Ga0395898_0145015 3300037466 Bacteria 2273
134 Ga0395905_0027533 3300037471 Bacteria 5361
135 Ga0395905_0153757 3300037471 Bacteria 2164
136 Ga0395905_0684694 3300037471 Bacteria 928
137 Ga0395901_0000391 3300038443 Bacteria 52295
138 Ga0395901_0015480 3300038443 Bacteria 7767
139 Ga0395901_0030411 3300038443 Bacteria 5563
140 Ga0395901_0032018 3300038443 Bacteria 5425
141 Ga0395901_0058209 3300038443 Bacteria 4020
142 Ga0395901_0155804 3300038443 Bacteria 2399
143 Ga0395901_0570980 3300038443 Bacteria 1144
144 Ga0436365_1042021 3300039437 Bacteria 1026
145 Ga0466965_0225862 3300044683 Bacteria 999
146 Ga0466966_0017022 3300044684 Bacteria 4805
147 Ga0466966_0047519 3300044684 Unclassified 2736
148 Ga0466961_0019052 3300044693 Bacteria 4415
149 Ga0466961_0035844 3300044693 Bacteria 3185
150 Ga0466961_0097923 3300044693 Unclassified 1849
151 Ga0466961_0145368 3300044693 Bacteria 1483
152 Ga0466963_0006587 3300044694 Bacteria 6885
153 Ga0466963_0094160 3300044694 Bacteria 2043
154 Ga0466963_0191335 3300044694 Bacteria 1429
155 Ga0466964_0003884 3300044706 Bacteria 5491
156 Ga0466964_0034675 3300044706 Bacteria 2014
157 Ga0466964_0125326 3300044706 Bacteria 1163
158 Ga0466964_0131600 3300044706 Bacteria 1140
159 Ga0466971_0000497 3300044719 Bacteria 15441
160 Ga0466971_0052828 3300044719 Unclassified 1830
161 Ga0466970_0120292 3300044765 Unclassified 1438
162 Ga0466970_0281429 3300044765 Bacteria 935
163 Ga0466957_0000254 3300044842 Bacteria 25608
164 Ga0466957_0506102 3300044842 Bacteria 838
165 Ga0466959_0003265 3300045049 Bacteria 10566
166 Ga0466959_0010536 3300045049 Bacteria 6615
167 Ga0466959_0014790 3300045049 Bacteria 5680
168 Ga0466958_0006371 3300045836 Bacteria 6418
169 Ga0466958_0076385 3300045836 Bacteria 2056
170 Ga0466958_0097997 3300045836 Unclassified 1820
171 Ga0466967_0008881 3300045976 Bacteria 7411
172 Ga0466967_0010175 3300045976 Bacteria 7036
173 Ga0466967_0011052 3300045976 Bacteria 6813
174 Ga0466967_0023164 3300045976 Bacteria 5084
175 Ga0466967_0041177 3300045976 Bacteria 3981
176 Ga0466967_0049779 3300045976 Bacteria 3666
177 Ga0466967_0090021 3300045976 Bacteria 2787
178 Ga0466967_0104137 3300045976 Bacteria 2597
179 Ga0466967_0129002 3300045976 Bacteria 2345
180 Ga0466967_0448586 3300045976 Bacteria 1260
181 Ga0495592_0048774 3300046454 Bacteria 3149
182 Ga0495641_0072540 3300046461 Bacteria 1545
183 Ga0495651_0004916 3300046462 Bacteria 10225
184 Ga0495651_0133523 3300046462 Bacteria 1809
185 Ga0495653_0018452 3300046463 Bacteria 5664
186 Ga0495664_0109319 3300046477 Bacteria 1668
187 Ga0495664_0142724 3300046477 Bacteria 1452
188 Ga0495608_0006919 3300046511 Bacteria 8033
189 Ga0495628_0018710 3300046516 Bacteria 5733
190 Ga0495630_0017785 3300046517 Bacteria 5212
191 Ga0495630_0024791 3300046517 Bacteria 4434
192 Ga0495630_0205279 3300046517 Bacteria 1504
193 Ga0495666_0051757 3300046526 Bacteria 1972
194 Ga0495652_0101580 3300046529 Bacteria 2331
195 Ga0495652_0159863 3300046529 Bacteria 1750
196 Ga0495587_0006983 3300046536 Bacteria 7331
197 Ga0495667_0004853 3300046559 Bacteria 9089
198 Ga0495667_0013935 3300046559 Bacteria 5429
199 Ga0495634_0026528 3300046642 Bacteria 4042
200 Ga0495635_0035029 3300046663 Bacteria 3481
201 Ga0495657_0012016 3300046675 Bacteria 6444
202 Ga0495599_0032524 3300046678 Bacteria 3274
203 Ga0495623_0016913 3300046679 Bacteria 4711
204 Ga0495613_0040225 3300046689 Bacteria 3465
205 Ga0495670_0272733 3300046691 Unclassified 904
206 Ga0495600_0010814 3300046809 Bacteria 5674
207 Ga0495604_0016458 3300047317 Bacteria 5912
208 Ga0495604_0021186 3300047317 Bacteria 5189
209 Ga0495674_0004121 3300047319 Bacteria 14030
210 Ga0495674_0027431 3300047319 Bacteria 5205
211 Ga0495676_0038842 3300047321 Bacteria 3950
212 Ga0495680_0000579 3300047322 Bacteria 41049
213 Ga0495680_0019469 3300047322 Bacteria 5726
214 Ga0495675_0017589 3300047444 Bacteria 4532
215 Ga0495675_0230774 3300047444 Bacteria 1117
216 Ga0495684_0062826 3300047471 Bacteria 2824
217 Ga0495602_0162147 3300048088 Bacteria 1744
218 Ga0496100_0014658 3300048903 Bacteria 4557
219 Ga0496100_0031111 3300048903 Bacteria 3315
220 Ga0496100_0036218 3300048903 Bacteria 3110
221 Ga0496100_0103040 3300048903 Bacteria 1970
222 Ga0496101_0000525 3300048904 Bacteria 23841
223 Ga0496101_0015055 3300048904 Bacteria 5206
224 Ga0496101_0018138 3300048904 Bacteria 4780
225 Ga0496101_0029399 3300048904 Bacteria 3843
226 Ga0496101_0047044 3300048904 Bacteria 3096
227 Ga0496102_0014657 3300048905 Bacteria 6814
228 Ga0496102_0097289 3300048905 Bacteria 2730
229 Ga0496104_0001433 3300048907 Bacteria 20613
230 Ga0496104_0159219 3300048907 Bacteria 2166
231 Ga0496105_0000518 3300048908 Bacteria 25457
232 Ga0496106_0000511 3300048909 Bacteria 27475
233 Ga0496106_0009440 3300048909 Bacteria 7211
234 Ga0496107_0021693 3300048910 Bacteria 4538
235 Ga0496107_0028285 3300048910 Bacteria 3982
236 Ga0496108_0029587 3300048911 Bacteria 4537
237 Ga0496109_0067961 3300048912 Bacteria 3265
238 Ga0496110_0005079 3300048913 Bacteria 10283
239 Ga0496112_0020931 3300048915 Bacteria 6211
240 Ga0496112_0034854 3300048915 Bacteria 4899
241 Ga0496112_0036574 3300048915 Bacteria 4789
242 Ga0496112_0047272 3300048915 Bacteria 4221
243 Ga0496112_0118093 3300048915 Bacteria 2622
244 Ga0496113_0023444 3300048916 Bacteria 4376
245 Ga0496113_0110630 3300048916 Unclassified 2138
246 Ga0496113_0121933 3300048916 Bacteria 2039
247 Ga0496114_0001382 3300048917 Bacteria 18379
248 Ga0496114_0034480 3300048917 Bacteria 4176
249 Ga0496114_0105410 3300048917 Bacteria 2411
250 Ga0496114_0115971 3300048917 Bacteria 2299
251 Ga0496114_0339216 3300048917 Bacteria 1329
252 Ga0496115_0013520 3300048918 Bacteria 6175
253 Ga0496115_0056792 3300048918 Bacteria 3146
254 Ga0496115_0182908 3300048918 Bacteria 1732
255 Ga0496115_0531427 3300048918 Bacteria 942
256 Ga0501038_0465152 3300049574 Bacteria 971
257 Ga0501046_0261599 3300049580 Bacteria 1271
258 Ga0501047_0036664 3300049581 Bacteria 4740
259 Ga0501067_0095808 3300049583 Bacteria 1648
260 Ga0501069_0000709 3300049585 Bacteria 15565
261 Ga0501069_0214342 3300049585 Bacteria 1118
262 Ga0501069_0270515 3300049585 Bacteria 993
263 Ga0501070_0002853 3300049586 Bacteria 15068
264 Ga0501070_0263987 3300049586 Bacteria 1407
265 Ga0501074_0313235 3300049590 Bacteria 1115
266 Ga0501080_0037278 3300049742 Bacteria 4540
267 Ga0501080_0401957 3300049742 Bacteria 1232
268 nmdc:mga0n895_406376_c1 3300050512 Bacteria 1377
269 nmdc:mga0rr50_29560_c1 3300050513 Bacteria 3867
270 Ga0495601_0076928 3300053077 Bacteria 2137
271 Ga0495655_0001140 3300053083 Bacteria 4102
272 Ga0495619_0005583 3300053085 Bacteria 7981
273 Ga0495619_0039421 3300053085 Bacteria 3084
274 Ga0466962_0005460 3300061719 Bacteria 6110
275 Ga0530510_0092636 3300061734 Bacteria 2206
276 Ga0265338_10142076
277 Ga0070658_10002700
278 Ga0070658_10096479
279 Ga0070683_100000408
280 Ga0070683_100135569
281 Ga0070680_100002781
282 Ga0070680_100033966
283 Ga0070660_100004001
284 Ga0070660_100016358
285 Ga0070660_100017110
286 Ga0070660_100157481
287 Ga0070660_100392682
288 Ga0070661_100043452
289 Ga0070671_100108543
290 Ga0070659_100163371
291 Ga0070667_100002035
292 Ga0070711_100230821
293 Ga0070681_10006108
294 Ga0070681_10082870
295 Ga0070681_10106773
296 Ga0070681_10115772
297 Ga0070679_100044362
298 Ga0070679_100046504
299 Ga0070679_100126012
300 Ga0070679_100202069
301 Ga0070679_100316027
302 Ga0070684_100024426
303 Ga0070684_100133972
304 Ga0070684_100410266
305 Ga0068853_100243031
306 Ga0070665_100072677
307 Ga0068855_100008420
308 Ga0068855_100054046
309 Ga0068855_100077508
310 Ga0068855_100145403
311 Ga0068855_100317853
312 Ga0068855_100717527
313 Ga0068857_100017763
314 Ga0068857_100191285
315 Ga0068856_100125320
316 Ga0068852_100345241
317 Ga0070712_100379876
318 Ga0070712_100549424
319 Ga0075435_100017357
320 Ga0105240_10053057
321 Ga0105240_10144963
322 Ga0105240_10278351
323 Ga0105240_10293360
324 Ga0105241_10222778
325 Ga0105242_10092934
326 Ga0105238_10142066
327 Ga0105238_10142779
328 Ga0157370_10002580
329 Ga0157370_10017006
330 Ga0157369_10004685
331 Ga0157369_10405940
332 Ga0157369_10586086
333 Ga0157374_10194808
334 Ga0157378_10165045
335 Ga0157372_10100458
336 Ga0157372_10125387
337 Ga0157372_11497140
338 Ga0157375_10100688
339 Ga0182008_10156370
340 Ga0182007_10032786
341 Ga0206353_11403674
342 Ga0207685_10072345
343 Ga0207699_10139257
344 Ga0207705_10091205
345 Ga0207705_10153719
346 Ga0207705_10238035
347 Ga0207654_10124797
348 Ga0207707_10006694
349 Ga0207707_10045335
350 Ga0207707_10188786
351 Ga0207695_10252214
352 Ga0207671_10207100
353 Ga0207693_10312420
354 Ga0207693_10526755
355 Ga0207663_10124868
356 Ga0207663_10320175
357 Ga0207660_10010856
358 Ga0207660_10021575
359 Ga0207660_10159198
360 Ga0207657_10000536
361 Ga0207657_10002980
362 Ga0207657_10003696
363 Ga0207652_10010087
364 Ga0207652_10119857
365 Ga0207652_10143746
366 Ga0207694_10027861
367 Ga0207694_10139178
368 Ga0207690_10136656
369 Ga0207665_10234586
370 Ga0207665_10397651
371 Ga0207661_10387593
372 Ga0207667_10026127
373 Ga0207667_10057447
374 Ga0207667_10137242
375 Ga0207658_10010913
376 Ga0207678_10042448
377 Ga0207702_10454164
378 Ga0207702_10664953
379 Ga0207674_10186165
380 Ga0268266_10056461
381 Ga0265319_1007549
382 Ga0265334_10019086
383 Ga0265334_10131019
384 Ga0265318_10003152
385 Ga0265322_10003049
386 Ga0265338_10029410
387 Ga0265338_10357133
388 Ga0265320_10044305
389 Ga0265325_10017735
390 Ga0265340_10025317
391 Ga0265340_10040450
392 Ga0265339_10035690
393 Ga0265327_10015201
394 Ga0265316_10026475
395 Ga0265313_10015890
396 Ga0265314_10004440
397 Ga0265342_10163141
398 Ga0373926_0069073
399 Ga0373936_0012113
400 Ga0373946_0044131
401 Ga0373935_0040101
402 Ga0373925_0017622
403 Ga0395899_0098380
404 Ga0395900_0022210
405 Ga0395900_0058821
406 Ga0395900_0069635
407 Ga0395898_0100203
408 Ga0395898_0145015
409 Ga0395905_0027533
410 Ga0395905_0153757
411 Ga0395905_0684694
412 Ga0395901_0000391
413 Ga0395901_0015480
414 Ga0395901_0030411
415 Ga0395901_0032018
416 Ga0395901_0058209
417 Ga0395901_0155804
418 Ga0395901_0570980
419 Ga0436365_1042021
420 Ga0466965_0225862
421 Ga0466966_0017022
422 Ga0466966_0047519
423 Ga0466961_0019052
424 Ga0466961_0035844
425 Ga0466961_0097923
426 Ga0466961_0145368
427 Ga0466963_0006587
428 Ga0466963_0094160
429 Ga0466963_0191335
430 Ga0466964_0003884
431 Ga0466964_0034675
432 Ga0466964_0125326
433 Ga0466964_0131600
434 Ga0466971_0000497
435 Ga0466971_0052828
436 Ga0466970_0120292
437 Ga0466970_0281429
438 Ga0466957_0000254
439 Ga0466957_0506102
440 Ga0466959_0003265
441 Ga0466959_0010536
442 Ga0466959_0014790
443 Ga0466958_0006371
444 Ga0466958_0076385
445 Ga0466958_0097997
446 Ga0466967_0008881
447 Ga0466967_0010175
448 Ga0466967_0011052
449 Ga0466967_0023164
450 Ga0466967_0041177
451 Ga0466967_0049779
452 Ga0466967_0090021
453 Ga0466967_0104137
454 Ga0466967_0129002
455 Ga0466967_0448586
456 Ga0495592_0048774
457 Ga0495641_0072540
458 Ga0495651_0004916
459 Ga0495651_0133523
460 Ga0495653_0018452
461 Ga0495664_0109319
462 Ga0495664_0142724
463 Ga0495608_0006919
464 Ga0495628_0018710
465 Ga0495630_0017785
466 Ga0495630_0024791
467 Ga0495630_0205279
468 Ga0495666_0051757
469 Ga0495652_0101580
470 Ga0495652_0159863
471 Ga0495587_0006983
472 Ga0495667_0004853
473 Ga0495667_0013935
474 Ga0495634_0026528
475 Ga0495635_0035029
476 Ga0495657_0012016
477 Ga0495599_0032524
478 Ga0495623_0016913
479 Ga0495613_0040225
480 Ga0495670_0272733
481 Ga0495600_0010814
482 Ga0495604_0016458
483 Ga0495604_0021186
484 Ga0495674_0004121
485 Ga0495674_0027431
486 Ga0495676_0038842
487 Ga0495680_0000579
488 Ga0495680_0019469
489 Ga0495675_0017589
490 Ga0495675_0230774
491 Ga0495684_0062826
492 Ga0495602_0162147
493 Ga0496100_0014658
494 Ga0496100_0031111
495 Ga0496100_0036218
496 Ga0496100_0103040
497 Ga0496101_0000525
498 Ga0496101_0015055
499 Ga0496101_0018138
500 Ga0496101_0029399
501 Ga0496101_0047044
502 Ga0496102_0014657
503 Ga0496102_0097289
504 Ga0496104_0001433
505 Ga0496104_0159219
506 Ga0496105_0000518
507 Ga0496106_0000511
508 Ga0496106_0009440
509 Ga0496107_0021693
510 Ga0496107_0028285
511 Ga0496108_0029587
512 Ga0496109_0067961
513 Ga0496110_0005079
514 Ga0496112_0020931
515 Ga0496112_0034854
516 Ga0496112_0036574
517 Ga0496112_0047272
518 Ga0496112_0118093
519 Ga0496113_0023444
520 Ga0496113_0110630
521 Ga0496113_0121933
522 Ga0496114_0001382
523 Ga0496114_0034480
524 Ga0496114_0105410
525 Ga0496114_0115971
526 Ga0496114_0339216
527 Ga0496115_0013520
528 Ga0496115_0056792
529 Ga0496115_0182908
530 Ga0496115_0531427
531 Ga0501038_0465152
532 Ga0501046_0261599
533 Ga0501047_0036664
534 Ga0501067_0095808
535 Ga0501069_0000709
536 Ga0501069_0214342
537 Ga0501069_0270515
538 Ga0501070_0002853
539 Ga0501070_0263987
540 Ga0501074_0313235
541 Ga0501080_0037278
542 Ga0501080_0401957
543 nmdc:mga0n895_406376_c1
544 nmdc:mga0rr50_29560_c1
545 Ga0495601_0076928
546 Ga0495655_0001140
547 Ga0495619_0005583
548 Ga0495619_0039421
549 Ga0466962_0005460
550 Ga0530510_0092636

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09678

Caa3_CtaG

Cytochrome c oxidase caa3 assembly factor (Caa3_CtaG)

33

254

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4w6v-assembly1.cif.gz_A crystal structure of a peptide transporter from yersinia enterocolitica at 3 a resolution 0.3889 70 246
4o5m-assembly1.cif.gz_A x-ray crystal structure of isovaleryl-coa dehydrogenase from brucella suis 0.3652 73 246
3wvo-assembly2.cif.gz_C crystal structure of thermobifida fusca cse1 0.3307 81 232
3wvo-assembly1.cif.gz_A crystal structure of thermobifida fusca cse1 0.3304 81 236
5uxg-assembly2.cif.gz_B protein 84 with aldehyde deformylating oxygenase activity from sulfolobus tokodaii (monoclinic) 0.3176 85 237
ID Description Score Start End Superfamily
af_A5PLC6_77_206_1.20.58.120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;BAG domain 0.47 156 247 1.20.58.120
af_P78369_1_191_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.47 138 236 1.20.140.150
af_A0A178VGS0_23_184_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4693 114 248 1.20.140.150
af_Q9VUF9_1_175_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4597 106 249 1.20.1070.10
af_O54942_1_184_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4502 138 232 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A7W0P9X8-F1-model_v4 Cytochrome c oxidase assembly protein 0.9706 14 176 GO:0005886
AF-A0A7V9RA45-F1-model_v4 Cytochrome c oxidase assembly protein 0.9574 28 250 GO:0005886
AF-A0A538I9E4-F1-model_v4 Cytochrome c oxidase assembly protein 0.9528 17 248 GO:0005886
AF-A0A7V9FZ41-F1-model_v4 Cytochrome c oxidase assembly protein 0.9526 16 248 GO:0005886
AF-A0A0K2SHT0-F1-model_v4 Membrane protein 0.9421 14 247 GO:0005886

Map