F380478

General Info

Members Datasets Scaffolds Average Seq Length
275 211 550 246

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10495805|Ga0207693_104958051
Length 284
Sequence MARVPTACGRGVVGTAARWRYAALAHPTISEMKVTNLNGGIAWVTGAGTGIGEAGALALARDGMTVVLTGRRKEPLEDVAKRIAANGGKAQVEIADVADAKAVRRAADAIAAAFGRLDVLVNNAGLNVPERRWAKLKPEGIEKIIGANLTGAFLVVQAALPLMRERGGVMIHTSSWAGRFIGPISGPAYMAAKHGVVAMSHSINLEEGRNGIRSSVLCPGEVATPILRYRDPPEKPEDIARMLQSEDMGELIAFIARQPPHVCVNEVVISPTHNRGYLKLMEGR

Samples

Sample ID Description Type Environment
1 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
100 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
106 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
107 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
111 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
114 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
126 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
140 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
167 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
188 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
189 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 2818991467 Bosea vestrisii 3192 Isolate Unclassified
209 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
210 2854911287 Brucella lupini LUP21 Isolate Unclassified
211 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 0
Isolates 1.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.73
Nodule 0.36
Rhizoplane 2.18
Rhizosphere 85.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207693_10495805 3300025915 Bacteria 953
2 JGI25151J46595_10000044 3300003187 Bacteria 170418
3 Ga0070683_100351556 3300005329 Bacteria 1404
4 Ga0070677_10010690 3300005333 Bacteria 3145
5 Ga0068868_100117914 3300005338 Bacteria 2163
6 Ga0070687_100132414 3300005343 Bacteria 1441
7 Ga0070687_100202203 3300005343 Bacteria 1204
8 Ga0070669_100063934 3300005353 Bacteria 2709
9 Ga0070675_100012368 3300005354 Bacteria 6689
10 Ga0070671_100055271 3300005355 Bacteria 3303
11 Ga0070674_100016368 3300005356 Bacteria 4647
12 Ga0070674_100180477 3300005356 Bacteria 1616
13 Ga0070659_100171188 3300005366 Bacteria 1779
14 Ga0070667_100152469 3300005367 Bacteria 2031
15 Ga0070710_10095392 3300005437 Bacteria 1762
16 Ga0070711_100099672 3300005439 Bacteria 2111
17 Ga0070678_100011832 3300005456 Bacteria 5398
18 Ga0070662_100076406 3300005457 Bacteria 2483
19 Ga0068867_100294407 3300005459 Bacteria 1336
20 Ga0068867_100447217 3300005459 Bacteria 1100
21 Ga0070698_100250708 3300005471 Bacteria 1703
22 Ga0070679_100061167 3300005530 Bacteria 3753
23 Ga0068853_100438725 3300005539 Bacteria 1227
24 Ga0070704_100004356 3300005549 Bacteria 8176
25 Ga0070664_100257029 3300005564 Bacteria 1571
26 Ga0070702_100170351 3300005615 Bacteria 1416
27 Ga0068859_100082743 3300005617 Bacteria 3252
28 Ga0068864_100231375 3300005618 Bacteria 1709
29 Ga0068866_10162039 3300005718 Bacteria 1305
30 Ga0068870_10075358 3300005840 Bacteria 1851
31 Ga0068863_100279751 3300005841 Bacteria 1616
32 Ga0068858_100106587 3300005842 Bacteria 2616
33 Ga0068862_100278695 3300005844 Bacteria 1532
34 Ga0081540_1149672 3300005983 Bacteria 923
35 Ga0081539_10003922 3300005985 Bacteria 17277
36 Ga0070717_10270960 3300006028 Bacteria 1504
37 Ga0075364_10017423 3300006051 Bacteria 4487
38 Ga0070716_100217782 3300006173 Bacteria 1281
39 Ga0075362_10012671 3300006177 Bacteria 3356
40 Ga0075366_10000625 3300006195 Bacteria 16631
41 Ga0075428_100002146 3300006844 Bacteria 21306
42 Ga0075430_100200319 3300006846 Bacteria 1658
43 Ga0075431_100000132 3300006847 Bacteria 49934
44 Ga0075434_100028302 3300006871 Bacteria 5504
45 Ga0075429_100002461 3300006880 Bacteria 15577
46 Ga0075429_100416117 3300006880 Bacteria 1177
47 Ga0075436_100023951 3300006914 Bacteria 4195
48 Ga0075436_100120975 3300006914 Bacteria 1831
49 Ga0097620_100082748 3300006931 Bacteria 3252
50 Ga0075435_100003830 3300007076 Bacteria 10261
51 Ga0099794_10056318 3300007265 Bacteria 1902
52 Ga0099795_10001167 3300007788 Bacteria 5507
53 Ga0111539_10000933 3300009094 Bacteria 38278
54 Ga0105245_10178601 3300009098 Bacteria 2027
55 Ga0114129_10000280 3300009147 Bacteria 58505
56 Ga0105243_10155443 3300009148 Bacteria 1966
57 Ga0105243_10569577 3300009148 Bacteria 1085
58 Ga0105242_10175416 3300009176 Bacteria 1887
59 Ga0105238_10282305 3300009551 Bacteria 1642
60 Ga0157370_10070806 3300013104 Bacteria 3291
61 Ga0157378_10386477 3300013297 Bacteria 1376
62 Ga0163162_10311863 3300013306 Bacteria 1705
63 Ga0163162_11277881 3300013306 Bacteria 834
64 Ga0157372_10074742 3300013307 Bacteria 3822
65 Ga0163163_10136661 3300014325 Bacteria 2492
66 Ga0163163_10408129 3300014325 Bacteria 1417
67 Ga0157380_10096099 3300014326 Bacteria 2456
68 Ga0157380_10141778 3300014326 Bacteria 2066
69 Ga0157380_10408917 3300014326 Bacteria 1290
70 Ga0213876_10091279 3300021384 Bacteria 1613
71 Ga0213876_10099097 3300021384 Bacteria 1545
72 Ga0213875_10001033 3300021388 Bacteria 19652
73 Ga0213875_10001923 3300021388 Bacteria 12863
74 Ga0213875_10004991 3300021388 Bacteria 7198
75 Ga0209025_1000014 3300025294 Bacteria 865448
76 Ga0207682_10002344 3300025893 Bacteria 8541
77 Ga0207692_10160153 3300025898 Bacteria 1296
78 Ga0207642_10099564 3300025899 Bacteria 1456
79 Ga0207710_10028801 3300025900 Bacteria 2412
80 Ga0207685_10231453 3300025905 Bacteria 884
81 Ga0207699_10252891 3300025906 Bacteria 1215
82 Ga0207645_10061697 3300025907 Bacteria 2395
83 Ga0207643_10065970 3300025908 Bacteria 2075
84 Ga0207654_10055372 3300025911 Bacteria 2296
85 Ga0207693_10052970 3300025915 Bacteria 3184
86 Ga0207660_10182789 3300025917 Bacteria 1629
87 Ga0207662_10017932 3300025918 Bacteria 4009
88 Ga0207662_10167624 3300025918 Bacteria 1407
89 Ga0207652_10037527 3300025921 Bacteria 4101
90 Ga0207681_10146222 3300025923 Bacteria 1766
91 Ga0207681_10254955 3300025923 Bacteria 1371
92 Ga0207694_10333895 3300025924 Bacteria 1253
93 Ga0207687_10322446 3300025927 Bacteria 1251
94 Ga0207664_10280696 3300025929 Bacteria 1461
95 Ga0207690_10187579 3300025932 Bacteria 1561
96 Ga0207706_10024727 3300025933 Bacteria 5383
97 Ga0207706_10425981 3300025933 Bacteria 1149
98 Ga0207709_10192083 3300025935 Bacteria 1451
99 Ga0207709_10215292 3300025935 Bacteria 1382
100 Ga0207670_10095988 3300025936 Bacteria 2107
101 Ga0207665_10020621 3300025939 Bacteria 4331
102 Ga0207665_10031282 3300025939 Bacteria 3521
103 Ga0207665_10037334 3300025939 Bacteria 3233
104 Ga0207665_10088838 3300025939 Bacteria 2139
105 Ga0207691_10008519 3300025940 Bacteria 9849
106 Ga0207689_10199780 3300025942 Bacteria 1650
107 Ga0207661_10265063 3300025944 Bacteria 1531
108 Ga0207679_10450710 3300025945 Bacteria 1141
109 Ga0207651_10338905 3300025960 Bacteria 1262
110 Ga0207703_10564946 3300026035 Bacteria 1074
111 Ga0207708_10085256 3300026075 Bacteria 2430
112 Ga0207702_10390266 3300026078 Bacteria 1340
113 Ga0207648_10003173 3300026089 Bacteria 17320
114 Ga0207676_10097707 3300026095 Bacteria 2426
115 Ga0207676_10376775 3300026095 Bacteria 1320
116 Ga0207674_10366731 3300026116 Bacteria 1392
117 Ga0207675_100193644 3300026118 Bacteria 1951
118 Ga0207675_100853412 3300026118 Bacteria 926
119 Ga0207683_10001401 3300026121 Bacteria 21763
120 Ga0207683_10387027 3300026121 Bacteria 1286
121 Ga0207683_10798848 3300026121 Bacteria 876
122 Ga0207698_10453075 3300026142 Bacteria 1239
123 Ga0207428_10003035 3300027907 Bacteria 16519
124 Ga0265330_10019331 3300031235 Bacteria 3123
125 Ga0265320_10079487 3300031240 Bacteria 1532
126 Ga0265325_10064224 3300031241 Bacteria 1856
127 Ga0265340_10218762 3300031247 Bacteria 853
128 Ga0265313_10021695 3300031595 Bacteria 3505
129 Ga0265342_10013991 3300031712 Bacteria 5345
130 Ga0316576_10019180 3300031727 Bacteria 4685
131 Ga0316578_10054414 3300031728 Bacteria 2347
132 Ga0316577_10107396 3300031733 Bacteria 1566
133 Ga0373934_0000044 3300035086 Bacteria 41857
134 Ga0373934_0000391 3300035086 Bacteria 15305
135 Ga0373936_0013565 3300035113 Bacteria 3110
136 Ga0373953_0005028 3300035117 Bacteria 4260
137 Ga0373954_0003733 3300035118 Bacteria 6490
138 Ga0373954_0036904 3300035118 Bacteria 2270
139 Ga0373954_0055096 3300035118 Bacteria 1870
140 Ga0373956_0000003 3300035119 Bacteria 81669
141 Ga0373957_0005284 3300035120 Bacteria 3996
142 Ga0373957_0005368 3300035120 Bacteria 3968
143 Ga0373946_0011661 3300035171 Bacteria 3286
144 Ga0373955_0013208 3300035172 Bacteria 3985
145 Ga0373955_0020045 3300035172 Bacteria 3354
146 Ga0373935_0036414 3300035692 Bacteria 3076
147 Ga0373927_0007084 3300035695 Bacteria 7605
148 Ga0373933_0000107 3300035724 Bacteria 53134
149 Ga0373933_0001423 3300035724 Bacteria 14035
150 Ga0373933_0016236 3300035724 Bacteria 4160
151 Ga0373947_0202502 3300035725 Bacteria 1299
152 Ga0373937_0046346 3300036401 Bacteria 3975
153 Ga0373937_0384943 3300036401 Bacteria 1330
154 Ga0316584_0002374 3300036712 Bacteria 11888
155 Ga0373925_0009673 3300037068 Bacteria 7014
156 Ga0436364_0027321 3300037853 Bacteria 2217
157 Ga0436364_0124138 3300037853 Bacteria 39695
158 Ga0436364_0362401 3300037853 Bacteria 15824
159 Ga0436364_0604335 3300037853 Bacteria 1854
160 Ga0436364_0659865 3300037853 Bacteria 47070
161 Ga0436364_1310858 3300037853 Bacteria 803
162 Ga0436365_0288788 3300039437 Bacteria 2083
163 Ga0436365_0489070 3300039437 Bacteria 1010
164 Ga0436365_0740315 3300039437 Bacteria 4124
165 Ga0436365_0923124 3300039437 Bacteria 1607
166 Ga0439453_0064285 3300041408 Bacteria 765
167 Ga0439446_0106605 3300042156 Bacteria 890
168 Ga0495592_0002632 3300046454 Bacteria 12689
169 Ga0495592_0004704 3300046454 Bacteria 10015
170 Ga0495592_0267069 3300046454 Bacteria 1124
171 Ga0495638_0014615 3300046460 Bacteria 5298
172 Ga0495641_0001105 3300046461 Bacteria 23196
173 Ga0495651_0000105 3300046462 Bacteria 61688
174 Ga0495651_0019307 3300046462 Bacteria 5283
175 Ga0495653_0033920 3300046463 Bacteria 4040
176 Ga0495605_0082846 3300046474 Bacteria 1498
177 Ga0495639_0004586 3300046475 Bacteria 5927
178 Ga0495662_0093788 3300046476 Bacteria 1465
179 Ga0495608_0022815 3300046511 Bacteria 4293
180 Ga0495618_0135642 3300046514 Bacteria 1574
181 Ga0495628_0006322 3300046516 Bacteria 10348
182 Ga0495628_0043271 3300046516 Bacteria 3588
183 Ga0495628_0051087 3300046516 Bacteria 3269
184 Ga0495630_0007499 3300046517 Bacteria 7796
185 Ga0495630_0147436 3300046517 Bacteria 1790
186 Ga0495663_0062850 3300046525 Bacteria 1170
187 Ga0495666_0024216 3300046526 Bacteria 2999
188 Ga0495652_0037267 3300046529 Bacteria 4219
189 Ga0495652_0124436 3300046529 Bacteria 2051
190 Ga0495652_0186939 3300046529 Bacteria 1584
191 Ga0495640_0013687 3300046533 Bacteria 6163
192 Ga0495587_0009256 3300046536 Bacteria 6321
193 Ga0495598_0005897 3300046537 Bacteria 2739
194 Ga0495621_0006560 3300046539 Bacteria 3405
195 Ga0495621_0073478 3300046539 Bacteria 1264
196 Ga0495645_0027047 3300046543 Bacteria 4166
197 Ga0495667_0006961 3300046559 Bacteria 7671
198 Ga0495656_0013956 3300046615 Bacteria 3001
199 Ga0495668_0159696 3300046616 Bacteria 1235
200 Ga0495634_0135860 3300046642 Bacteria 1564
201 Ga0495635_0021565 3300046663 Bacteria 4490
202 Ga0495657_0003049 3300046675 Bacteria 13865
203 Ga0495657_0027284 3300046675 Bacteria 4033
204 Ga0495599_0001707 3300046678 Bacteria 12704
205 Ga0495599_0001790 3300046678 Bacteria 12465
206 Ga0495599_0132876 3300046678 Bacteria 1545
207 Ga0495647_0074413 3300046681 Bacteria 1365
208 Ga0495658_0055667 3300046683 Bacteria 2253
209 Ga0495613_0071610 3300046689 Bacteria 2526
210 Ga0495624_0058646 3300046690 Bacteria 2417
211 Ga0495600_0027489 3300046809 Bacteria 3675
212 Ga0495604_0025365 3300047317 Bacteria 4724
213 Ga0495674_0000463 3300047319 Bacteria 36736
214 Ga0495680_0019856 3300047322 Bacteria 5664
215 Ga0495675_0244440 3300047444 Bacteria 1079
216 Ga0495675_0309177 3300047444 Bacteria 937
217 Ga0495685_010257 3300047447 Bacteria 3140
218 Ga0495685_075369 3300047447 Bacteria 1127
219 Ga0495684_0001586 3300047471 Bacteria 18214
220 Ga0495593_0064696 3300047673 Bacteria 1909
221 Ga0495614_0068312 3300048089 Bacteria 1530
222 Ga0495615_0007589 3300048090 Bacteria 2064
223 Ga0495615_0009507 3300048090 Bacteria 1916
224 Ga0496100_0181720 3300048903 Bacteria 1521
225 Ga0496102_0105883 3300048905 Bacteria 2617
226 Ga0496106_0632817 3300048909 Bacteria 856
227 Ga0496113_0686281 3300048916 Bacteria 818
228 Ga0496114_0614704 3300048917 Bacteria 958
229 Ga0496115_0088541 3300048918 Bacteria 2528
230 Ga0496118_0125983 3300048921 Bacteria 1658
231 Ga0496123_0004314 3300048926 Bacteria 15093
232 Ga0496123_0028368 3300048926 Bacteria 4145
233 Ga0501033_0236398 3300049570 Bacteria 1297
234 Ga0501034_0450212 3300049571 Bacteria 1205
235 Ga0501037_0005071 3300049573 Bacteria 9583
236 Ga0501043_0545396 3300049579 Bacteria 862
237 Ga0501046_0029243 3300049580 Bacteria 4481
238 Ga0501047_0038745 3300049581 Bacteria 4611
239 Ga0501047_0179242 3300049581 Bacteria 1985
240 Ga0501069_0033882 3300049585 Bacteria 2813
241 Ga0501070_0079701 3300049586 Bacteria 2710
242 Ga0501072_0004650 3300049588 Bacteria 10450
243 Ga0501073_0117082 3300049589 Bacteria 1847
244 Ga0501073_0224252 3300049589 Bacteria 1298
245 Ga0501083_0065352 3300049744 Bacteria 2423
246 nmdc:mga03683_81866_c1 3300050489 Bacteria 1395
247 nmdc:mga03683_8689_c1 3300050489 Bacteria 3581
248 nmdc:mga00v17_4025_c2 3300050491 Bacteria 4609
249 nmdc:mga0k408_2143_c1 3300050493 Bacteria 10581
250 nmdc:mga06z11_87763_c1 3300050494 Bacteria 1683
251 nmdc:mga05p37_223_c1 3300050507 Bacteria 57418
252 nmdc:mga09592_1434_c1 3300050508 Bacteria 19112
253 nmdc:mga0qj67_26868_c1 3300050509 Bacteria 4458
254 nmdc:mga06r32_186_c1 3300050510 Bacteria 49161
255 nmdc:mga06r32_994938_c1 3300050510 Bacteria 791
256 nmdc:mga08y16_3000_c1 3300050511 Bacteria 17414
257 nmdc:mga08y16_67441_c1 3300050511 Bacteria 3732
258 nmdc:mga0n895_7828_c1 3300050512 Bacteria 9209
259 nmdc:mga0rr50_3247_c1 3300050513 Bacteria 9316
260 nmdc:mga08x19_11635_c1 3300050514 Bacteria 5296
261 Ga0495601_0010085 3300053077 Bacteria 5609
262 Ga0495601_0026240 3300053077 Bacteria 3596
263 Ga0495612_0020328 3300053078 Bacteria 2661
264 Ga0495612_0162933 3300053078 Bacteria 974
265 Ga0495595_0026886 3300053084 Bacteria 2559
266 Ga0495619_0000944 3300053085 Bacteria 19038
267 Ga0500594_0033907 3300053118 Bacteria 1361
268 Ga0500616_0139068 3300053153 Bacteria 1137
269 Ga0500636_0011687 3300053177 Bacteria 5140
270 Ga0501084_0141572 3300054114 Bacteria 2025
271 Ga0501082_0000007 3300060353 Bacteria 126506
272 2819721746 2818991467 Bacteria 5893227
273 2835313381 2835312727 Bacteria 7413381
274 2854913349 2854911287 Bacteria 5582813
275 3003671963 3003665799 Bacteria 7279786
276 Ga0207693_10495805
277 JGI25151J46595_10000044
278 Ga0070683_100351556
279 Ga0070677_10010690
280 Ga0068868_100117914
281 Ga0070687_100132414
282 Ga0070687_100202203
283 Ga0070669_100063934
284 Ga0070675_100012368
285 Ga0070671_100055271
286 Ga0070674_100016368
287 Ga0070674_100180477
288 Ga0070659_100171188
289 Ga0070667_100152469
290 Ga0070710_10095392
291 Ga0070711_100099672
292 Ga0070678_100011832
293 Ga0070662_100076406
294 Ga0068867_100294407
295 Ga0068867_100447217
296 Ga0070698_100250708
297 Ga0070679_100061167
298 Ga0068853_100438725
299 Ga0070704_100004356
300 Ga0070664_100257029
301 Ga0070702_100170351
302 Ga0068859_100082743
303 Ga0068864_100231375
304 Ga0068866_10162039
305 Ga0068870_10075358
306 Ga0068863_100279751
307 Ga0068858_100106587
308 Ga0068862_100278695
309 Ga0081540_1149672
310 Ga0081539_10003922
311 Ga0070717_10270960
312 Ga0075364_10017423
313 Ga0070716_100217782
314 Ga0075362_10012671
315 Ga0075366_10000625
316 Ga0075428_100002146
317 Ga0075430_100200319
318 Ga0075431_100000132
319 Ga0075434_100028302
320 Ga0075429_100002461
321 Ga0075429_100416117
322 Ga0075436_100023951
323 Ga0075436_100120975
324 Ga0097620_100082748
325 Ga0075435_100003830
326 Ga0099794_10056318
327 Ga0099795_10001167
328 Ga0111539_10000933
329 Ga0105245_10178601
330 Ga0114129_10000280
331 Ga0105243_10155443
332 Ga0105243_10569577
333 Ga0105242_10175416
334 Ga0105238_10282305
335 Ga0157370_10070806
336 Ga0157378_10386477
337 Ga0163162_10311863
338 Ga0163162_11277881
339 Ga0157372_10074742
340 Ga0163163_10136661
341 Ga0163163_10408129
342 Ga0157380_10096099
343 Ga0157380_10141778
344 Ga0157380_10408917
345 Ga0213876_10091279
346 Ga0213876_10099097
347 Ga0213875_10001033
348 Ga0213875_10001923
349 Ga0213875_10004991
350 Ga0209025_1000014
351 Ga0207682_10002344
352 Ga0207692_10160153
353 Ga0207642_10099564
354 Ga0207710_10028801
355 Ga0207685_10231453
356 Ga0207699_10252891
357 Ga0207645_10061697
358 Ga0207643_10065970
359 Ga0207654_10055372
360 Ga0207693_10052970
361 Ga0207660_10182789
362 Ga0207662_10017932
363 Ga0207662_10167624
364 Ga0207652_10037527
365 Ga0207681_10146222
366 Ga0207681_10254955
367 Ga0207694_10333895
368 Ga0207687_10322446
369 Ga0207664_10280696
370 Ga0207690_10187579
371 Ga0207706_10024727
372 Ga0207706_10425981
373 Ga0207709_10192083
374 Ga0207709_10215292
375 Ga0207670_10095988
376 Ga0207665_10020621
377 Ga0207665_10031282
378 Ga0207665_10037334
379 Ga0207665_10088838
380 Ga0207691_10008519
381 Ga0207689_10199780
382 Ga0207661_10265063
383 Ga0207679_10450710
384 Ga0207651_10338905
385 Ga0207703_10564946
386 Ga0207708_10085256
387 Ga0207702_10390266
388 Ga0207648_10003173
389 Ga0207676_10097707
390 Ga0207676_10376775
391 Ga0207674_10366731
392 Ga0207675_100193644
393 Ga0207675_100853412
394 Ga0207683_10001401
395 Ga0207683_10387027
396 Ga0207683_10798848
397 Ga0207698_10453075
398 Ga0207428_10003035
399 Ga0265330_10019331
400 Ga0265320_10079487
401 Ga0265325_10064224
402 Ga0265340_10218762
403 Ga0265313_10021695
404 Ga0265342_10013991
405 Ga0316576_10019180
406 Ga0316578_10054414
407 Ga0316577_10107396
408 Ga0373934_0000044
409 Ga0373934_0000391
410 Ga0373936_0013565
411 Ga0373953_0005028
412 Ga0373954_0003733
413 Ga0373954_0036904
414 Ga0373954_0055096
415 Ga0373956_0000003
416 Ga0373957_0005284
417 Ga0373957_0005368
418 Ga0373946_0011661
419 Ga0373955_0013208
420 Ga0373955_0020045
421 Ga0373935_0036414
422 Ga0373927_0007084
423 Ga0373933_0000107
424 Ga0373933_0001423
425 Ga0373933_0016236
426 Ga0373947_0202502
427 Ga0373937_0046346
428 Ga0373937_0384943
429 Ga0316584_0002374
430 Ga0373925_0009673
431 Ga0436364_0027321
432 Ga0436364_0124138
433 Ga0436364_0362401
434 Ga0436364_0604335
435 Ga0436364_0659865
436 Ga0436364_1310858
437 Ga0436365_0288788
438 Ga0436365_0489070
439 Ga0436365_0740315
440 Ga0436365_0923124
441 Ga0439453_0064285
442 Ga0439446_0106605
443 Ga0495592_0002632
444 Ga0495592_0004704
445 Ga0495592_0267069
446 Ga0495638_0014615
447 Ga0495641_0001105
448 Ga0495651_0000105
449 Ga0495651_0019307
450 Ga0495653_0033920
451 Ga0495605_0082846
452 Ga0495639_0004586
453 Ga0495662_0093788
454 Ga0495608_0022815
455 Ga0495618_0135642
456 Ga0495628_0006322
457 Ga0495628_0043271
458 Ga0495628_0051087
459 Ga0495630_0007499
460 Ga0495630_0147436
461 Ga0495663_0062850
462 Ga0495666_0024216
463 Ga0495652_0037267
464 Ga0495652_0124436
465 Ga0495652_0186939
466 Ga0495640_0013687
467 Ga0495587_0009256
468 Ga0495598_0005897
469 Ga0495621_0006560
470 Ga0495621_0073478
471 Ga0495645_0027047
472 Ga0495667_0006961
473 Ga0495656_0013956
474 Ga0495668_0159696
475 Ga0495634_0135860
476 Ga0495635_0021565
477 Ga0495657_0003049
478 Ga0495657_0027284
479 Ga0495599_0001707
480 Ga0495599_0001790
481 Ga0495599_0132876
482 Ga0495647_0074413
483 Ga0495658_0055667
484 Ga0495613_0071610
485 Ga0495624_0058646
486 Ga0495600_0027489
487 Ga0495604_0025365
488 Ga0495674_0000463
489 Ga0495680_0019856
490 Ga0495675_0244440
491 Ga0495675_0309177
492 Ga0495685_010257
493 Ga0495685_075369
494 Ga0495684_0001586
495 Ga0495593_0064696
496 Ga0495614_0068312
497 Ga0495615_0007589
498 Ga0495615_0009507
499 Ga0496100_0181720
500 Ga0496102_0105883
501 Ga0496106_0632817
502 Ga0496113_0686281
503 Ga0496114_0614704
504 Ga0496115_0088541
505 Ga0496118_0125983
506 Ga0496123_0004314
507 Ga0496123_0028368
508 Ga0501033_0236398
509 Ga0501034_0450212
510 Ga0501037_0005071
511 Ga0501043_0545396
512 Ga0501046_0029243
513 Ga0501047_0038745
514 Ga0501047_0179242
515 Ga0501069_0033882
516 Ga0501070_0079701
517 Ga0501072_0004650
518 Ga0501073_0117082
519 Ga0501073_0224252
520 Ga0501083_0065352
521 nmdc:mga03683_81866_c1
522 nmdc:mga03683_8689_c1
523 nmdc:mga00v17_4025_c2
524 nmdc:mga0k408_2143_c1
525 nmdc:mga06z11_87763_c1
526 nmdc:mga05p37_223_c1
527 nmdc:mga09592_1434_c1
528 nmdc:mga0qj67_26868_c1
529 nmdc:mga06r32_186_c1
530 nmdc:mga06r32_994938_c1
531 nmdc:mga08y16_3000_c1
532 nmdc:mga08y16_67441_c1
533 nmdc:mga0n895_7828_c1
534 nmdc:mga0rr50_3247_c1
535 nmdc:mga08x19_11635_c1
536 Ga0495601_0010085
537 Ga0495601_0026240
538 Ga0495612_0020328
539 Ga0495612_0162933
540 Ga0495595_0026886
541 Ga0495619_0000944
542 Ga0500594_0033907
543 Ga0500616_0139068
544 Ga0500636_0011687
545 Ga0501084_0141572
546 Ga0501082_0000007
547 2819721746
548 2835313381
549 2854913349
550 3003671963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

40

235

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

46

267

0.9

PF08659

KR

KR domain

40

213

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3asu-assembly1.cif.gz_B-2 crystal structure of serine dehydrogenase from escherichia coli 0.9461 12 239
3tfo-assembly1.cif.gz_D crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9432 11 242
2nwq-assembly1.cif.gz_D short chain dehydrogenase from pseudomonas aeruginosa 0.9348 11 241
3asu-assembly1.cif.gz_A-2 crystal structure of serine dehydrogenase from escherichia coli 0.9346 12 239
3tfo-assembly1.cif.gz_C crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9325 11 242
ID Description Score Start End Superfamily
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9525 10 57 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9403 2 81 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9394 2 190 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9387 8 199 3.40.50.720
af_O01758_69_340_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9322 11 197 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A543MYW1-F1-model_v4 deleted 0.9745 2 245
AF-A0A2E9Y2A6-F1-model_v4 Oxidoreductase 0.9715 6 242 GO:0016020
AF-A0A1I3IU12-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG 0.9706 7 242 GO:0016020
GO:0016491
AF-A0A2D9HTJ3-F1-model_v4 3-oxoacyl-ACP reductase 0.9704 8 243 GO:0016616
AF-M3D6T1-F1-model_v4 Oxidoreductase 0.9699 2 243 GO:0016020

Map