F380362
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 275 | 146 | 550 | 233 |
Family's Representative Sequence
| Representative Sequence | 3300007076|Ga0075435_100030374|Ga0075435_1000303744 |
| Length | 267 |
| Sequence | MRPRHLRRVSTAPLLDPSPRLPLPXXXRLHYPSRIPFMTTPGKLIAVEGIDGSGKQTQVRLLAQALESRGHRVLPTGFPQYNSWFGKMVGQFLNGDFGPHHDPHFTALLYAGDRFECKGPIVAALEQGQIVLSDRYVGSNLAHQTARSSPEKRPEFRAWIEHLEYGIYGLPQEDLVLYLRVPPRQAQTLVARKSARSYTDSAHDILESDLRHLQSAADIYDQLARSTNWKSIECYDTRSNSMRPPEEIAQEVLAAVQPLLPPLQEKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 5 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 6 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 24 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 25 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 26 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 27 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 29 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 33 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 34 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 35 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 36 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 37 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 39 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 40 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 45 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 67 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 70 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 71 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 72 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 73 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 74 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 75 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 76 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 77 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 78 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 79 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 80 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 81 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 82 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 83 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 84 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 85 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 86 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 87 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 88 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 89 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 90 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 91 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 92 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 132 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 133 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 134 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 135 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 136 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 137 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 138 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 139 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 140 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 141 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 146 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.18 |
| Metatranscriptomes | 1.82 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.18 |
| Nodule | 0 |
| Rhizoplane | 4 |
| Rhizosphere | 93.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 26.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075435_100030374 | 3300007076 | Unclassified | 4248 |
| 2 | Ga0065707_10224011 | 3300005295 | Unclassified | 1197 |
| 3 | Ga0070666_10353789 | 3300005335 | Unclassified | 1051 |
| 4 | Ga0070703_10003568 | 3300005406 | Bacteria | 4420 |
| 5 | Ga0070709_10017112 | 3300005434 | Bacteria | 4151 |
| 6 | Ga0070709_10018275 | 3300005434 | Bacteria | 4034 |
| 7 | Ga0070709_10040436 | 3300005434 | Unclassified | 2867 |
| 8 | Ga0070709_10156163 | 3300005434 | Unclassified | 1582 |
| 9 | Ga0070709_10244306 | 3300005434 | Bacteria | 1290 |
| 10 | Ga0070713_100065721 | 3300005436 | Unclassified | 3048 |
| 11 | Ga0070710_10006158 | 3300005437 | Bacteria | 5739 |
| 12 | Ga0070711_100014360 | 3300005439 | Bacteria | 4991 |
| 13 | Ga0070711_100053705 | 3300005439 | Unclassified | 2778 |
| 14 | Ga0070711_100178045 | 3300005439 | Bacteria | 1626 |
| 15 | Ga0070705_100001028 | 3300005440 | Bacteria | 15539 |
| 16 | Ga0070705_100199891 | 3300005440 | Unclassified | 1369 |
| 17 | Ga0070694_100036499 | 3300005444 | Bacteria | 3256 |
| 18 | Ga0070694_100171366 | 3300005444 | Bacteria | 1599 |
| 19 | Ga0070708_100007988 | 3300005445 | Bacteria | 8476 |
| 20 | Ga0070708_100191143 | 3300005445 | Unclassified | 1914 |
| 21 | Ga0070708_100520299 | 3300005445 | Bacteria | 1122 |
| 22 | Ga0070706_100000406 | 3300005467 | Bacteria | 51991 |
| 23 | Ga0070706_100017419 | 3300005467 | Bacteria | 6630 |
| 24 | Ga0070707_100000151 | 3300005468 | Bacteria | 67008 |
| 25 | Ga0070707_100002663 | 3300005468 | Bacteria | 16974 |
| 26 | Ga0070707_100012541 | 3300005468 | Bacteria | 7916 |
| 27 | Ga0070707_100105902 | 3300005468 | Bacteria | 2727 |
| 28 | Ga0070707_100366493 | 3300005468 | Bacteria | 1400 |
| 29 | Ga0070707_100669276 | 3300005468 | Bacteria | 1001 |
| 30 | Ga0070707_100675742 | 3300005468 | Unclassified | 995 |
| 31 | Ga0070698_100032124 | 3300005471 | Bacteria | 5438 |
| 32 | Ga0070698_100035555 | 3300005471 | Bacteria | 5151 |
| 33 | Ga0070699_100015347 | 3300005518 | Bacteria | 6583 |
| 34 | Ga0070699_100097632 | 3300005518 | Bacteria | 2574 |
| 35 | Ga0070699_100303069 | 3300005518 | Bacteria | 1434 |
| 36 | Ga0070679_100023694 | 3300005530 | Bacteria | 6014 |
| 37 | Ga0070697_100000305 | 3300005536 | Bacteria | 39083 |
| 38 | Ga0070697_100002835 | 3300005536 | Bacteria | 13333 |
| 39 | Ga0070697_100096082 | 3300005536 | Bacteria | 2458 |
| 40 | Ga0070697_100120522 | 3300005536 | Bacteria | 2194 |
| 41 | Ga0070697_100140237 | 3300005536 | Unclassified | 2033 |
| 42 | Ga0070697_100511602 | 3300005536 | Unclassified | 1050 |
| 43 | Ga0070695_100154994 | 3300005545 | Bacteria | 1602 |
| 44 | Ga0070696_100001596 | 3300005546 | Bacteria | 14870 |
| 45 | Ga0070696_100065555 | 3300005546 | Bacteria | 2546 |
| 46 | Ga0070693_100001052 | 3300005547 | Bacteria | 12323 |
| 47 | Ga0070693_100013391 | 3300005547 | Bacteria | 4176 |
| 48 | Ga0070665_100044768 | 3300005548 | Bacteria | 4443 |
| 49 | Ga0070704_100018931 | 3300005549 | Bacteria | 4415 |
| 50 | Ga0068859_100280206 | 3300005617 | Bacteria | 1760 |
| 51 | Ga0068863_100023354 | 3300005841 | Bacteria | 5908 |
| 52 | Ga0068860_100060057 | 3300005843 | Unclassified | 3614 |
| 53 | Ga0081540_1081184 | 3300005983 | Unclassified | 1459 |
| 54 | Ga0070717_10024996 | 3300006028 | Bacteria | 4744 |
| 55 | Ga0070717_10094198 | 3300006028 | Bacteria | 2533 |
| 56 | Ga0075365_10000028 | 3300006038 | Bacteria | 58142 |
| 57 | Ga0070715_10123752 | 3300006163 | Bacteria | 1236 |
| 58 | Ga0070715_10143257 | 3300006163 | Unclassified | 1163 |
| 59 | Ga0070715_10171879 | 3300006163 | Bacteria | 1080 |
| 60 | Ga0070716_100003066 | 3300006173 | Bacteria | 7798 |
| 61 | Ga0070716_100087585 | 3300006173 | Bacteria | 1876 |
| 62 | Ga0070716_100221644 | 3300006173 | Unclassified | 1271 |
| 63 | Ga0070716_100255417 | 3300006173 | Bacteria | 1196 |
| 64 | Ga0070712_100120129 | 3300006175 | Unclassified | 1976 |
| 65 | Ga0070712_100219240 | 3300006175 | Unclassified | 1505 |
| 66 | Ga0070712_100298171 | 3300006175 | Unclassified | 1304 |
| 67 | Ga0070712_100444225 | 3300006175 | Unclassified | 1079 |
| 68 | Ga0075366_10360966 | 3300006195 | Bacteria | 892 |
| 69 | Ga0075428_100001376 | 3300006844 | Bacteria | 25857 |
| 70 | Ga0075433_10414413 | 3300006852 | Unclassified | 1188 |
| 71 | Ga0075434_101033156 | 3300006871 | Unclassified | 835 |
| 72 | Ga0075436_100020515 | 3300006914 | Bacteria | 4535 |
| 73 | Ga0075436_100579658 | 3300006914 | Bacteria | 825 |
| 74 | Ga0097620_100280205 | 3300006931 | Bacteria | 1760 |
| 75 | Ga0075435_100025679 | 3300007076 | Bacteria | 4588 |
| 76 | Ga0075435_100089520 | 3300007076 | Bacteria | 2538 |
| 77 | Ga0099794_10002738 | 3300007265 | Bacteria | 6578 |
| 78 | Ga0099794_10005297 | 3300007265 | Bacteria | 5162 |
| 79 | Ga0099794_10012908 | 3300007265 | Bacteria | 3622 |
| 80 | Ga0099794_10023765 | 3300007265 | Bacteria | 2807 |
| 81 | Ga0099794_10086259 | 3300007265 | Bacteria | 1554 |
| 82 | Ga0099795_10020471 | 3300007788 | Unclassified | 2156 |
| 83 | Ga0105247_10276122 | 3300009101 | Bacteria | 1158 |
| 84 | Ga0105247_10325009 | 3300009101 | Unclassified | 1074 |
| 85 | Ga0105247_10487447 | 3300009101 | Unclassified | 896 |
| 86 | Ga0105242_10189481 | 3300009176 | Unclassified | 1820 |
| 87 | Ga0105248_10028542 | 3300009177 | Bacteria | 6217 |
| 88 | Ga0105237_10183878 | 3300009545 | Unclassified | 2090 |
| 89 | Ga0099796_10078950 | 3300010159 | Unclassified | 1203 |
| 90 | Ga0105239_10244792 | 3300010375 | Unclassified | 2013 |
| 91 | Ga0157374_10158322 | 3300013296 | Bacteria | 2205 |
| 92 | Ga0157378_10000137 | 3300013297 | Bacteria | 69371 |
| 93 | Ga0157378_10004002 | 3300013297 | Bacteria | 13020 |
| 94 | Ga0157379_10112164 | 3300014968 | Unclassified | 2450 |
| 95 | Ga0157376_10000038 | 3300014969 | Bacteria | 134733 |
| 96 | Ga0157376_10000160 | 3300014969 | Bacteria | 46966 |
| 97 | Ga0207653_10004809 | 3300025885 | Bacteria | 4224 |
| 98 | Ga0207692_10023087 | 3300025898 | Bacteria | 2873 |
| 99 | Ga0207699_10008883 | 3300025906 | Bacteria | 4980 |
| 100 | Ga0207699_10019026 | 3300025906 | Bacteria | 3652 |
| 101 | Ga0207684_10004628 | 3300025910 | Bacteria | 12915 |
| 102 | Ga0207684_10027229 | 3300025910 | Bacteria | 4872 |
| 103 | Ga0207684_10035114 | 3300025910 | Bacteria | 4257 |
| 104 | Ga0207684_10230866 | 3300025910 | Bacteria | 1597 |
| 105 | Ga0207693_10198601 | 3300025915 | Unclassified | 1577 |
| 106 | Ga0207693_10229390 | 3300025915 | Unclassified | 1458 |
| 107 | Ga0207693_10259208 | 3300025915 | Unclassified | 1364 |
| 108 | Ga0207693_10416682 | 3300025915 | Unclassified | 1050 |
| 109 | Ga0207693_10587095 | 3300025915 | Bacteria | 868 |
| 110 | Ga0207663_10096822 | 3300025916 | Unclassified | 1972 |
| 111 | Ga0207663_10261617 | 3300025916 | Bacteria | 1278 |
| 112 | Ga0207646_10000019 | 3300025922 | Bacteria | 282855 |
| 113 | Ga0207646_10000039 | 3300025922 | Bacteria | 188453 |
| 114 | Ga0207646_10007285 | 3300025922 | Bacteria | 11271 |
| 115 | Ga0207646_10090926 | 3300025922 | Bacteria | 2732 |
| 116 | Ga0207646_10969955 | 3300025922 | Unclassified | 752 |
| 117 | Ga0207700_10063698 | 3300025928 | Bacteria | 2805 |
| 118 | Ga0207700_10272593 | 3300025928 | Unclassified | 1453 |
| 119 | Ga0207686_10213381 | 3300025934 | Unclassified | 1389 |
| 120 | Ga0207704_10162494 | 3300025938 | Unclassified | 1591 |
| 121 | Ga0207665_10000089 | 3300025939 | Bacteria | 59318 |
| 122 | Ga0207665_10003035 | 3300025939 | Bacteria | 11266 |
| 123 | Ga0207665_10029351 | 3300025939 | Unclassified | 3636 |
| 124 | Ga0207665_10055398 | 3300025939 | Unclassified | 2675 |
| 125 | Ga0207665_10068692 | 3300025939 | Unclassified | 2415 |
| 126 | Ga0207665_10107113 | 3300025939 | Bacteria | 1959 |
| 127 | Ga0207677_10475623 | 3300026023 | Unclassified | 1075 |
| 128 | Ga0207703_10483416 | 3300026035 | Unclassified | 1161 |
| 129 | Ga0207639_10005977 | 3300026041 | Bacteria | 8258 |
| 130 | Ga0207641_10004305 | 3300026088 | Bacteria | 12364 |
| 131 | Ga0209179_1016927 | 3300027512 | Unclassified | 1374 |
| 132 | Ga0265354_1000411 | 3300028016 | Bacteria | 7549 |
| 133 | Ga0265354_1001926 | 3300028016 | Unclassified | 2756 |
| 134 | Ga0268266_10000302 | 3300028379 | Bacteria | 78763 |
| 135 | Ga0268264_10687093 | 3300028381 | Bacteria | 1016 |
| 136 | Ga0265770_1000706 | 3300030878 | Unclassified | 4653 |
| 137 | Ga0265770_1002006 | 3300030878 | Bacteria | 2774 |
| 138 | Ga0265760_10011781 | 3300031090 | Unclassified | 2499 |
| 139 | Ga0265760_10019957 | 3300031090 | Bacteria | 1933 |
| 140 | Ga0265760_10024475 | 3300031090 | Unclassified | 1759 |
| 141 | Ga0307516_10075965 | 3300031730 | Bacteria | 3213 |
| 142 | Ga0373926_0011858 | 3300035083 | Bacteria | 2941 |
| 143 | Ga0373934_0003660 | 3300035086 | Bacteria | 5650 |
| 144 | Ga0373923_0009692 | 3300035111 | Bacteria | 3483 |
| 145 | Ga0373945_0148036 | 3300035116 | Unclassified | 950 |
| 146 | Ga0373953_0074140 | 3300035117 | Unclassified | 1407 |
| 147 | Ga0373954_0006400 | 3300035118 | Bacteria | 5136 |
| 148 | Ga0373954_0105743 | 3300035118 | Unclassified | 1359 |
| 149 | Ga0373957_0003681 | 3300035120 | Bacteria | 4576 |
| 150 | Ga0373946_0085084 | 3300035171 | Bacteria | 1392 |
| 151 | Ga0373955_0004246 | 3300035172 | Bacteria | 6328 |
| 152 | Ga0373955_0116673 | 3300035172 | Bacteria | 1548 |
| 153 | Ga0373955_0118434 | 3300035172 | Archaea | 1537 |
| 154 | Ga0373931_0082847 | 3300035691 | Unclassified | 1774 |
| 155 | Ga0373927_0004903 | 3300035695 | Bacteria | 9295 |
| 156 | Ga0373933_0002622 | 3300035724 | Bacteria | 10083 |
| 157 | Ga0373947_0003884 | 3300035725 | Bacteria | 8790 |
| 158 | Ga0373937_0005085 | 3300036401 | Bacteria | 11200 |
| 159 | Ga0373937_0011706 | 3300036401 | Unclassified | 7694 |
| 160 | Ga0373925_0001250 | 3300037068 | Bacteria | 22415 |
| 161 | Ga0373925_0279492 | 3300037068 | Bacteria | 1344 |
| 162 | Ga0373925_0399891 | 3300037068 | Unclassified | 1120 |
| 163 | Ga0395898_0609274 | 3300037466 | Bacteria | 1035 |
| 164 | Ga0451577_0064444 | 3300042876 | Bacteria | 3268 |
| 165 | Ga0451577_0140480 | 3300042876 | Unclassified | 2170 |
| 166 | Ga0451577_0292126 | 3300042876 | Bacteria | 1477 |
| 167 | Ga0453683_0001517 | 3300044673 | Bacteria | 19821 |
| 168 | Ga0453683_0003698 | 3300044673 | Bacteria | 11190 |
| 169 | Ga0453684_0007605 | 3300044712 | Bacteria | 19858 |
| 170 | Ga0453684_0407088 | 3300044712 | Unclassified | 1522 |
| 171 | Ga0451576_0008634 | 3300045051 | Bacteria | 11933 |
| 172 | Ga0495592_0051826 | 3300046454 | Bacteria | 3048 |
| 173 | Ga0495592_0058151 | 3300046454 | Bacteria | 2852 |
| 174 | Ga0495603_0016253 | 3300046455 | Bacteria | 4503 |
| 175 | Ga0495603_0061736 | 3300046455 | Bacteria | 2213 |
| 176 | Ga0495629_0011234 | 3300046459 | Bacteria | 6503 |
| 177 | Ga0495651_0001954 | 3300046462 | Bacteria | 15929 |
| 178 | Ga0495651_0012679 | 3300046462 | Bacteria | 6505 |
| 179 | Ga0495651_0036423 | 3300046462 | Bacteria | 3831 |
| 180 | Ga0495653_0004145 | 3300046463 | Bacteria | 11728 |
| 181 | Ga0495653_0133862 | 3300046463 | Bacteria | 1751 |
| 182 | Ga0495580_0009941 | 3300046472 | Bacteria | 7445 |
| 183 | Ga0495580_0053669 | 3300046472 | Unclassified | 2844 |
| 184 | Ga0495582_0006655 | 3300046473 | Bacteria | 6420 |
| 185 | Ga0495639_0017392 | 3300046475 | Bacteria | 3122 |
| 186 | Ga0495639_0136284 | 3300046475 | Bacteria | 1178 |
| 187 | Ga0495608_0005808 | 3300046511 | Bacteria | 8794 |
| 188 | Ga0495608_0006137 | 3300046511 | Bacteria | 8529 |
| 189 | Ga0495608_0058546 | 3300046511 | Bacteria | 2540 |
| 190 | Ga0495618_0111177 | 3300046514 | Bacteria | 1754 |
| 191 | Ga0495628_0000943 | 3300046516 | Bacteria | 26642 |
| 192 | Ga0495628_0026495 | 3300046516 | Bacteria | 4726 |
| 193 | Ga0495630_0003848 | 3300046517 | Bacteria | 10478 |
| 194 | Ga0495630_0023119 | 3300046517 | Bacteria | 4593 |
| 195 | Ga0495630_0051209 | 3300046517 | Bacteria | 3090 |
| 196 | Ga0495630_0264633 | 3300046517 | Unclassified | 1313 |
| 197 | Ga0495666_0043962 | 3300046526 | Bacteria | 2157 |
| 198 | Ga0495666_0160450 | 3300046526 | Bacteria | 1043 |
| 199 | Ga0495652_0000954 | 3300046529 | Bacteria | 33161 |
| 200 | Ga0495652_0006917 | 3300046529 | Bacteria | 10498 |
| 201 | Ga0495665_0001833 | 3300046531 | Bacteria | 11475 |
| 202 | Ga0495665_0071144 | 3300046531 | Unclassified | 1832 |
| 203 | Ga0495640_0044937 | 3300046533 | Unclassified | 3067 |
| 204 | Ga0495640_0208570 | 3300046533 | Bacteria | 1236 |
| 205 | Ga0495586_0041536 | 3300046535 | Bacteria | 2477 |
| 206 | Ga0495587_0000442 | 3300046536 | Bacteria | 29092 |
| 207 | Ga0495587_0015405 | 3300046536 | Bacteria | 4775 |
| 208 | Ga0495645_0006620 | 3300046543 | Bacteria | 8048 |
| 209 | Ga0495645_0019680 | 3300046543 | Bacteria | 4863 |
| 210 | Ga0495667_0032634 | 3300046559 | Bacteria | 3488 |
| 211 | Ga0495667_0171709 | 3300046559 | Bacteria | 1393 |
| 212 | Ga0495667_0201646 | 3300046559 | Unclassified | 1273 |
| 213 | Ga0495634_0098803 | 3300046642 | Bacteria | 1888 |
| 214 | Ga0495635_0016351 | 3300046663 | Bacteria | 5180 |
| 215 | Ga0495635_0203747 | 3300046663 | Bacteria | 1341 |
| 216 | Ga0495635_0236221 | 3300046663 | Bacteria | 1234 |
| 217 | Ga0495657_0007474 | 3300046675 | Bacteria | 8444 |
| 218 | Ga0495657_0013658 | 3300046675 | Bacteria | 5983 |
| 219 | Ga0495657_0381611 | 3300046675 | Unclassified | 831 |
| 220 | Ga0495599_0008189 | 3300046678 | Bacteria | 6352 |
| 221 | Ga0495599_0092951 | 3300046678 | Unclassified | 1882 |
| 222 | Ga0495599_0115103 | 3300046678 | Bacteria | 1673 |
| 223 | Ga0495623_0024046 | 3300046679 | Bacteria | 3930 |
| 224 | Ga0495623_0086645 | 3300046679 | Bacteria | 1930 |
| 225 | Ga0495623_0109746 | 3300046679 | Bacteria | 1673 |
| 226 | Ga0495658_0125747 | 3300046683 | Bacteria | 1555 |
| 227 | Ga0495613_0235461 | 3300046689 | Bacteria | 1281 |
| 228 | Ga0495624_0016108 | 3300046690 | Bacteria | 5034 |
| 229 | Ga0495624_0018580 | 3300046690 | Unclassified | 4648 |
| 230 | Ga0495581_0004099 | 3300047315 | Bacteria | 8385 |
| 231 | Ga0495604_0000979 | 3300047317 | Bacteria | 23812 |
| 232 | Ga0495604_0025851 | 3300047317 | Bacteria | 4675 |
| 233 | Ga0495604_0049947 | 3300047317 | Bacteria | 3248 |
| 234 | Ga0495674_0001505 | 3300047319 | Bacteria | 22860 |
| 235 | Ga0495674_0098896 | 3300047319 | Bacteria | 2484 |
| 236 | Ga0495674_0204938 | 3300047319 | Bacteria | 1635 |
| 237 | Ga0495676_0066214 | 3300047321 | Bacteria | 2801 |
| 238 | Ga0495676_0421521 | 3300047321 | Unclassified | 883 |
| 239 | Ga0495680_0000547 | 3300047322 | Bacteria | 42327 |
| 240 | Ga0495680_0030909 | 3300047322 | Bacteria | 4364 |
| 241 | Ga0495680_0058268 | 3300047322 | Unclassified | 2985 |
| 242 | Ga0495675_0000027 | 3300047444 | Bacteria | 106917 |
| 243 | Ga0495684_0032904 | 3300047471 | Bacteria | 3982 |
| 244 | Ga0495684_0034068 | 3300047471 | Bacteria | 3907 |
| 245 | Ga0495684_0039114 | 3300047471 | Bacteria | 3636 |
| 246 | Ga0495684_0072670 | 3300047471 | Unclassified | 2613 |
| 247 | Ga0495593_0022382 | 3300047673 | Bacteria | 3521 |
| 248 | Ga0495602_0002605 | 3300048088 | Bacteria | 18426 |
| 249 | Ga0495614_0013465 | 3300048089 | Unclassified | 3587 |
| 250 | Ga0495614_0092978 | 3300048089 | Bacteria | 1313 |
| 251 | Ga0496101_0206532 | 3300048904 | Bacteria | 1520 |
| 252 | Ga0496102_0029982 | 3300048905 | Bacteria | 4868 |
| 253 | Ga0496104_0336707 | 3300048907 | Bacteria | 1422 |
| 254 | Ga0496105_0540060 | 3300048908 | Bacteria | 911 |
| 255 | Ga0496107_0049414 | 3300048910 | Bacteria | 3031 |
| 256 | Ga0496112_0111106 | 3300048915 | Bacteria | 2711 |
| 257 | Ga0496114_0176171 | 3300048917 | Bacteria | 1866 |
| 258 | Ga0496114_0517493 | 3300048917 | Unclassified | 1055 |
| 259 | Ga0496115_0010963 | 3300048918 | Bacteria | 6786 |
| 260 | Ga0496115_0038188 | 3300048918 | Unclassified | 3809 |
| 261 | Ga0496115_0296664 | 3300048918 | Bacteria | 1325 |
| 262 | nmdc:mga0yw44_1_c1 | 3300050492 | Bacteria | 702221 |
| 263 | nmdc:mga0k408_35108_c1 | 3300050493 | Bacteria | 1557 |
| 264 | nmdc:mga0n895_11772_c1 | 3300050512 | Bacteria | 7821 |
| 265 | nmdc:mga0n895_33136_c1 | 3300050512 | Bacteria | 4963 |
| 266 | nmdc:mga0n895_956874_c1 | 3300050512 | Unclassified | 839 |
| 267 | nmdc:mga0rr50_33175_c1 | 3300050513 | Bacteria | 3686 |
| 268 | nmdc:mga0rr50_429698_c1 | 3300050513 | Bacteria | 1118 |
| 269 | nmdc:mga0rr50_597284_c1 | 3300050513 | Unclassified | 941 |
| 270 | nmdc:mga08x19_134_c1 | 3300050514 | Bacteria | 65861 |
| 271 | nmdc:mga08x19_24691_c1 | 3300050514 | Bacteria | 3739 |
| 272 | nmdc:mga0a205_224074_c1 | 3300050515 | Bacteria | 1765 |
| 273 | Ga0495619_0042841 | 3300053085 | Bacteria | 2966 |
| 274 | Ga0500555_000006 | 3300053103 | Bacteria | 304416 |
| 275 | Ga0500570_000296 | 3300053724 | Bacteria | 17461 |
| 276 | Ga0075435_100030374 | |||
| 277 | Ga0065707_10224011 | |||
| 278 | Ga0070666_10353789 | |||
| 279 | Ga0070703_10003568 | |||
| 280 | Ga0070709_10017112 | |||
| 281 | Ga0070709_10018275 | |||
| 282 | Ga0070709_10040436 | |||
| 283 | Ga0070709_10156163 | |||
| 284 | Ga0070709_10244306 | |||
| 285 | Ga0070713_100065721 | |||
| 286 | Ga0070710_10006158 | |||
| 287 | Ga0070711_100014360 | |||
| 288 | Ga0070711_100053705 | |||
| 289 | Ga0070711_100178045 | |||
| 290 | Ga0070705_100001028 | |||
| 291 | Ga0070705_100199891 | |||
| 292 | Ga0070694_100036499 | |||
| 293 | Ga0070694_100171366 | |||
| 294 | Ga0070708_100007988 | |||
| 295 | Ga0070708_100191143 | |||
| 296 | Ga0070708_100520299 | |||
| 297 | Ga0070706_100000406 | |||
| 298 | Ga0070706_100017419 | |||
| 299 | Ga0070707_100000151 | |||
| 300 | Ga0070707_100002663 | |||
| 301 | Ga0070707_100012541 | |||
| 302 | Ga0070707_100105902 | |||
| 303 | Ga0070707_100366493 | |||
| 304 | Ga0070707_100669276 | |||
| 305 | Ga0070707_100675742 | |||
| 306 | Ga0070698_100032124 | |||
| 307 | Ga0070698_100035555 | |||
| 308 | Ga0070699_100015347 | |||
| 309 | Ga0070699_100097632 | |||
| 310 | Ga0070699_100303069 | |||
| 311 | Ga0070679_100023694 | |||
| 312 | Ga0070697_100000305 | |||
| 313 | Ga0070697_100002835 | |||
| 314 | Ga0070697_100096082 | |||
| 315 | Ga0070697_100120522 | |||
| 316 | Ga0070697_100140237 | |||
| 317 | Ga0070697_100511602 | |||
| 318 | Ga0070695_100154994 | |||
| 319 | Ga0070696_100001596 | |||
| 320 | Ga0070696_100065555 | |||
| 321 | Ga0070693_100001052 | |||
| 322 | Ga0070693_100013391 | |||
| 323 | Ga0070665_100044768 | |||
| 324 | Ga0070704_100018931 | |||
| 325 | Ga0068859_100280206 | |||
| 326 | Ga0068863_100023354 | |||
| 327 | Ga0068860_100060057 | |||
| 328 | Ga0081540_1081184 | |||
| 329 | Ga0070717_10024996 | |||
| 330 | Ga0070717_10094198 | |||
| 331 | Ga0075365_10000028 | |||
| 332 | Ga0070715_10123752 | |||
| 333 | Ga0070715_10143257 | |||
| 334 | Ga0070715_10171879 | |||
| 335 | Ga0070716_100003066 | |||
| 336 | Ga0070716_100087585 | |||
| 337 | Ga0070716_100221644 | |||
| 338 | Ga0070716_100255417 | |||
| 339 | Ga0070712_100120129 | |||
| 340 | Ga0070712_100219240 | |||
| 341 | Ga0070712_100298171 | |||
| 342 | Ga0070712_100444225 | |||
| 343 | Ga0075366_10360966 | |||
| 344 | Ga0075428_100001376 | |||
| 345 | Ga0075433_10414413 | |||
| 346 | Ga0075434_101033156 | |||
| 347 | Ga0075436_100020515 | |||
| 348 | Ga0075436_100579658 | |||
| 349 | Ga0097620_100280205 | |||
| 350 | Ga0075435_100025679 | |||
| 351 | Ga0075435_100089520 | |||
| 352 | Ga0099794_10002738 | |||
| 353 | Ga0099794_10005297 | |||
| 354 | Ga0099794_10012908 | |||
| 355 | Ga0099794_10023765 | |||
| 356 | Ga0099794_10086259 | |||
| 357 | Ga0099795_10020471 | |||
| 358 | Ga0105247_10276122 | |||
| 359 | Ga0105247_10325009 | |||
| 360 | Ga0105247_10487447 | |||
| 361 | Ga0105242_10189481 | |||
| 362 | Ga0105248_10028542 | |||
| 363 | Ga0105237_10183878 | |||
| 364 | Ga0099796_10078950 | |||
| 365 | Ga0105239_10244792 | |||
| 366 | Ga0157374_10158322 | |||
| 367 | Ga0157378_10000137 | |||
| 368 | Ga0157378_10004002 | |||
| 369 | Ga0157379_10112164 | |||
| 370 | Ga0157376_10000038 | |||
| 371 | Ga0157376_10000160 | |||
| 372 | Ga0207653_10004809 | |||
| 373 | Ga0207692_10023087 | |||
| 374 | Ga0207699_10008883 | |||
| 375 | Ga0207699_10019026 | |||
| 376 | Ga0207684_10004628 | |||
| 377 | Ga0207684_10027229 | |||
| 378 | Ga0207684_10035114 | |||
| 379 | Ga0207684_10230866 | |||
| 380 | Ga0207693_10198601 | |||
| 381 | Ga0207693_10229390 | |||
| 382 | Ga0207693_10259208 | |||
| 383 | Ga0207693_10416682 | |||
| 384 | Ga0207693_10587095 | |||
| 385 | Ga0207663_10096822 | |||
| 386 | Ga0207663_10261617 | |||
| 387 | Ga0207646_10000019 | |||
| 388 | Ga0207646_10000039 | |||
| 389 | Ga0207646_10007285 | |||
| 390 | Ga0207646_10090926 | |||
| 391 | Ga0207646_10969955 | |||
| 392 | Ga0207700_10063698 | |||
| 393 | Ga0207700_10272593 | |||
| 394 | Ga0207686_10213381 | |||
| 395 | Ga0207704_10162494 | |||
| 396 | Ga0207665_10000089 | |||
| 397 | Ga0207665_10003035 | |||
| 398 | Ga0207665_10029351 | |||
| 399 | Ga0207665_10055398 | |||
| 400 | Ga0207665_10068692 | |||
| 401 | Ga0207665_10107113 | |||
| 402 | Ga0207677_10475623 | |||
| 403 | Ga0207703_10483416 | |||
| 404 | Ga0207639_10005977 | |||
| 405 | Ga0207641_10004305 | |||
| 406 | Ga0209179_1016927 | |||
| 407 | Ga0265354_1000411 | |||
| 408 | Ga0265354_1001926 | |||
| 409 | Ga0268266_10000302 | |||
| 410 | Ga0268264_10687093 | |||
| 411 | Ga0265770_1000706 | |||
| 412 | Ga0265770_1002006 | |||
| 413 | Ga0265760_10011781 | |||
| 414 | Ga0265760_10019957 | |||
| 415 | Ga0265760_10024475 | |||
| 416 | Ga0307516_10075965 | |||
| 417 | Ga0373926_0011858 | |||
| 418 | Ga0373934_0003660 | |||
| 419 | Ga0373923_0009692 | |||
| 420 | Ga0373945_0148036 | |||
| 421 | Ga0373953_0074140 | |||
| 422 | Ga0373954_0006400 | |||
| 423 | Ga0373954_0105743 | |||
| 424 | Ga0373957_0003681 | |||
| 425 | Ga0373946_0085084 | |||
| 426 | Ga0373955_0004246 | |||
| 427 | Ga0373955_0116673 | |||
| 428 | Ga0373955_0118434 | |||
| 429 | Ga0373931_0082847 | |||
| 430 | Ga0373927_0004903 | |||
| 431 | Ga0373933_0002622 | |||
| 432 | Ga0373947_0003884 | |||
| 433 | Ga0373937_0005085 | |||
| 434 | Ga0373937_0011706 | |||
| 435 | Ga0373925_0001250 | |||
| 436 | Ga0373925_0279492 | |||
| 437 | Ga0373925_0399891 | |||
| 438 | Ga0395898_0609274 | |||
| 439 | Ga0451577_0064444 | |||
| 440 | Ga0451577_0140480 | |||
| 441 | Ga0451577_0292126 | |||
| 442 | Ga0453683_0001517 | |||
| 443 | Ga0453683_0003698 | |||
| 444 | Ga0453684_0007605 | |||
| 445 | Ga0453684_0407088 | |||
| 446 | Ga0451576_0008634 | |||
| 447 | Ga0495592_0051826 | |||
| 448 | Ga0495592_0058151 | |||
| 449 | Ga0495603_0016253 | |||
| 450 | Ga0495603_0061736 | |||
| 451 | Ga0495629_0011234 | |||
| 452 | Ga0495651_0001954 | |||
| 453 | Ga0495651_0012679 | |||
| 454 | Ga0495651_0036423 | |||
| 455 | Ga0495653_0004145 | |||
| 456 | Ga0495653_0133862 | |||
| 457 | Ga0495580_0009941 | |||
| 458 | Ga0495580_0053669 | |||
| 459 | Ga0495582_0006655 | |||
| 460 | Ga0495639_0017392 | |||
| 461 | Ga0495639_0136284 | |||
| 462 | Ga0495608_0005808 | |||
| 463 | Ga0495608_0006137 | |||
| 464 | Ga0495608_0058546 | |||
| 465 | Ga0495618_0111177 | |||
| 466 | Ga0495628_0000943 | |||
| 467 | Ga0495628_0026495 | |||
| 468 | Ga0495630_0003848 | |||
| 469 | Ga0495630_0023119 | |||
| 470 | Ga0495630_0051209 | |||
| 471 | Ga0495630_0264633 | |||
| 472 | Ga0495666_0043962 | |||
| 473 | Ga0495666_0160450 | |||
| 474 | Ga0495652_0000954 | |||
| 475 | Ga0495652_0006917 | |||
| 476 | Ga0495665_0001833 | |||
| 477 | Ga0495665_0071144 | |||
| 478 | Ga0495640_0044937 | |||
| 479 | Ga0495640_0208570 | |||
| 480 | Ga0495586_0041536 | |||
| 481 | Ga0495587_0000442 | |||
| 482 | Ga0495587_0015405 | |||
| 483 | Ga0495645_0006620 | |||
| 484 | Ga0495645_0019680 | |||
| 485 | Ga0495667_0032634 | |||
| 486 | Ga0495667_0171709 | |||
| 487 | Ga0495667_0201646 | |||
| 488 | Ga0495634_0098803 | |||
| 489 | Ga0495635_0016351 | |||
| 490 | Ga0495635_0203747 | |||
| 491 | Ga0495635_0236221 | |||
| 492 | Ga0495657_0007474 | |||
| 493 | Ga0495657_0013658 | |||
| 494 | Ga0495657_0381611 | |||
| 495 | Ga0495599_0008189 | |||
| 496 | Ga0495599_0092951 | |||
| 497 | Ga0495599_0115103 | |||
| 498 | Ga0495623_0024046 | |||
| 499 | Ga0495623_0086645 | |||
| 500 | Ga0495623_0109746 | |||
| 501 | Ga0495658_0125747 | |||
| 502 | Ga0495613_0235461 | |||
| 503 | Ga0495624_0016108 | |||
| 504 | Ga0495624_0018580 | |||
| 505 | Ga0495581_0004099 | |||
| 506 | Ga0495604_0000979 | |||
| 507 | Ga0495604_0025851 | |||
| 508 | Ga0495604_0049947 | |||
| 509 | Ga0495674_0001505 | |||
| 510 | Ga0495674_0098896 | |||
| 511 | Ga0495674_0204938 | |||
| 512 | Ga0495676_0066214 | |||
| 513 | Ga0495676_0421521 | |||
| 514 | Ga0495680_0000547 | |||
| 515 | Ga0495680_0030909 | |||
| 516 | Ga0495680_0058268 | |||
| 517 | Ga0495675_0000027 | |||
| 518 | Ga0495684_0032904 | |||
| 519 | Ga0495684_0034068 | |||
| 520 | Ga0495684_0039114 | |||
| 521 | Ga0495684_0072670 | |||
| 522 | Ga0495593_0022382 | |||
| 523 | Ga0495602_0002605 | |||
| 524 | Ga0495614_0013465 | |||
| 525 | Ga0495614_0092978 | |||
| 526 | Ga0496101_0206532 | |||
| 527 | Ga0496102_0029982 | |||
| 528 | Ga0496104_0336707 | |||
| 529 | Ga0496105_0540060 | |||
| 530 | Ga0496107_0049414 | |||
| 531 | Ga0496112_0111106 | |||
| 532 | Ga0496114_0176171 | |||
| 533 | Ga0496114_0517493 | |||
| 534 | Ga0496115_0010963 | |||
| 535 | Ga0496115_0038188 | |||
| 536 | Ga0496115_0296664 | |||
| 537 | nmdc:mga0yw44_1_c1 | |||
| 538 | nmdc:mga0k408_35108_c1 | |||
| 539 | nmdc:mga0n895_11772_c1 | |||
| 540 | nmdc:mga0n895_33136_c1 | |||
| 541 | nmdc:mga0n895_956874_c1 | |||
| 542 | nmdc:mga0rr50_33175_c1 | |||
| 543 | nmdc:mga0rr50_429698_c1 | |||
| 544 | nmdc:mga0rr50_597284_c1 | |||
| 545 | nmdc:mga08x19_134_c1 | |||
| 546 | nmdc:mga08x19_24691_c1 | |||
| 547 | nmdc:mga0a205_224074_c1 | |||
| 548 | Ga0495619_0042841 | |||
| 549 | Ga0500555_000006 | |||
| 550 | Ga0500570_000296 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2wwi-assembly2.cif.gz_B | plasmodium falciparum thymidylate kinase in complex with aztmp and adp | 0.911 | 3 | 221 |
| 2wwf-assembly1.cif.gz_A | plasmodium falciparum thymidylate kinase in complex with tmp and adp | 0.8992 | 2 | 222 |
| 2yog-assembly2.cif.gz_B | plasmodium falciparum thymidylate kinase in complex with a (thio)urea- alpha-deoxythymidine inhibitor | 0.8986 | 2 | 224 |
| 2yoh-assembly2.cif.gz_B | plasmodium falciparum thymidylate kinase in complex with a urea-alpha- deoxythymidine inhibitor | 0.896 | 3 | 224 |
| 7fgq-assembly1.cif.gz_A-2 | crystal structure of thymidylate kinase with tmp and its low-resolution (saxs) solution structure from brugia malayi | 0.8946 | 3 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4DE18_126_348_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9363 | 1 | 226 | 3.40.50.300 |
| af_Q4DE18_126_348_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9323 | 1 | 226 | 3.40.50.300 |
| af_Q57741_3_187_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9027 | 5 | 224 | 3.40.50.300 |
| 2yohA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.892 | 3 | 222 | 3.40.50.300 |
| af_Q57741_3_187_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8889 | 5 | 224 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9CEH1-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9934 | 1 | 225 |
GO:0004798
GO:0005524 GO:0005737 GO:0006227 GO:0006233 GO:0006235 |
| AF-A0A7C2VE91-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9931 | 4 | 225 |
GO:0004798
GO:0005524 GO:0005737 GO:0006227 GO:0006233 GO:0006235 |
| AF-A0A1Q6YCH3-F1-model_v4 | Thymidylate kinase-like domain-containing protein | 0.9891 | 23 | 224 |
GO:0004798
GO:0005737 GO:0006227 GO:0006233 GO:0006235 |
| AF-A0A1Q8ATJ6-F1-model_v4 | Thymidylate kinase-like domain-containing protein | 0.9874 | 12 | 228 |
GO:0006261
|
| AF-A0A2E7S493-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9844 | 5 | 223 |
GO:0004798
GO:0005524 GO:0005829 GO:0006227 GO:0006233 GO:0006235 |