F380362

General Info

Members Datasets Scaffolds Average Seq Length
275 146 550 233

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100030374|Ga0075435_1000303744
Length 267
Sequence MRPRHLRRVSTAPLLDPSPRLPLPXXXRLHYPSRIPFMTTPGKLIAVEGIDGSGKQTQVRLLAQALESRGHRVLPTGFPQYNSWFGKMVGQFLNGDFGPHHDPHFTALLYAGDRFECKGPIVAALEQGQIVLSDRYVGSNLAHQTARSSPEKRPEFRAWIEHLEYGIYGLPQEDLVLYLRVPPRQAQTLVARKSARSYTDSAHDILESDLRHLQSAADIYDQLARSTNWKSIECYDTRSNSMRPPEEIAQEVLAAVQPLLPPLQEKR

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
72 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
73 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
74 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
76 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
77 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
78 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
79 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
80 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
81 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
89 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
99 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
100 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
116 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
120 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
139 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
145 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
146 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 1.82
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.18
Nodule 0
Rhizoplane 4
Rhizosphere 93.45
Stem 0
Stem Tuber 0
Unclassified 26.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100030374 3300007076 Unclassified 4248
2 Ga0065707_10224011 3300005295 Unclassified 1197
3 Ga0070666_10353789 3300005335 Unclassified 1051
4 Ga0070703_10003568 3300005406 Bacteria 4420
5 Ga0070709_10017112 3300005434 Bacteria 4151
6 Ga0070709_10018275 3300005434 Bacteria 4034
7 Ga0070709_10040436 3300005434 Unclassified 2867
8 Ga0070709_10156163 3300005434 Unclassified 1582
9 Ga0070709_10244306 3300005434 Bacteria 1290
10 Ga0070713_100065721 3300005436 Unclassified 3048
11 Ga0070710_10006158 3300005437 Bacteria 5739
12 Ga0070711_100014360 3300005439 Bacteria 4991
13 Ga0070711_100053705 3300005439 Unclassified 2778
14 Ga0070711_100178045 3300005439 Bacteria 1626
15 Ga0070705_100001028 3300005440 Bacteria 15539
16 Ga0070705_100199891 3300005440 Unclassified 1369
17 Ga0070694_100036499 3300005444 Bacteria 3256
18 Ga0070694_100171366 3300005444 Bacteria 1599
19 Ga0070708_100007988 3300005445 Bacteria 8476
20 Ga0070708_100191143 3300005445 Unclassified 1914
21 Ga0070708_100520299 3300005445 Bacteria 1122
22 Ga0070706_100000406 3300005467 Bacteria 51991
23 Ga0070706_100017419 3300005467 Bacteria 6630
24 Ga0070707_100000151 3300005468 Bacteria 67008
25 Ga0070707_100002663 3300005468 Bacteria 16974
26 Ga0070707_100012541 3300005468 Bacteria 7916
27 Ga0070707_100105902 3300005468 Bacteria 2727
28 Ga0070707_100366493 3300005468 Bacteria 1400
29 Ga0070707_100669276 3300005468 Bacteria 1001
30 Ga0070707_100675742 3300005468 Unclassified 995
31 Ga0070698_100032124 3300005471 Bacteria 5438
32 Ga0070698_100035555 3300005471 Bacteria 5151
33 Ga0070699_100015347 3300005518 Bacteria 6583
34 Ga0070699_100097632 3300005518 Bacteria 2574
35 Ga0070699_100303069 3300005518 Bacteria 1434
36 Ga0070679_100023694 3300005530 Bacteria 6014
37 Ga0070697_100000305 3300005536 Bacteria 39083
38 Ga0070697_100002835 3300005536 Bacteria 13333
39 Ga0070697_100096082 3300005536 Bacteria 2458
40 Ga0070697_100120522 3300005536 Bacteria 2194
41 Ga0070697_100140237 3300005536 Unclassified 2033
42 Ga0070697_100511602 3300005536 Unclassified 1050
43 Ga0070695_100154994 3300005545 Bacteria 1602
44 Ga0070696_100001596 3300005546 Bacteria 14870
45 Ga0070696_100065555 3300005546 Bacteria 2546
46 Ga0070693_100001052 3300005547 Bacteria 12323
47 Ga0070693_100013391 3300005547 Bacteria 4176
48 Ga0070665_100044768 3300005548 Bacteria 4443
49 Ga0070704_100018931 3300005549 Bacteria 4415
50 Ga0068859_100280206 3300005617 Bacteria 1760
51 Ga0068863_100023354 3300005841 Bacteria 5908
52 Ga0068860_100060057 3300005843 Unclassified 3614
53 Ga0081540_1081184 3300005983 Unclassified 1459
54 Ga0070717_10024996 3300006028 Bacteria 4744
55 Ga0070717_10094198 3300006028 Bacteria 2533
56 Ga0075365_10000028 3300006038 Bacteria 58142
57 Ga0070715_10123752 3300006163 Bacteria 1236
58 Ga0070715_10143257 3300006163 Unclassified 1163
59 Ga0070715_10171879 3300006163 Bacteria 1080
60 Ga0070716_100003066 3300006173 Bacteria 7798
61 Ga0070716_100087585 3300006173 Bacteria 1876
62 Ga0070716_100221644 3300006173 Unclassified 1271
63 Ga0070716_100255417 3300006173 Bacteria 1196
64 Ga0070712_100120129 3300006175 Unclassified 1976
65 Ga0070712_100219240 3300006175 Unclassified 1505
66 Ga0070712_100298171 3300006175 Unclassified 1304
67 Ga0070712_100444225 3300006175 Unclassified 1079
68 Ga0075366_10360966 3300006195 Bacteria 892
69 Ga0075428_100001376 3300006844 Bacteria 25857
70 Ga0075433_10414413 3300006852 Unclassified 1188
71 Ga0075434_101033156 3300006871 Unclassified 835
72 Ga0075436_100020515 3300006914 Bacteria 4535
73 Ga0075436_100579658 3300006914 Bacteria 825
74 Ga0097620_100280205 3300006931 Bacteria 1760
75 Ga0075435_100025679 3300007076 Bacteria 4588
76 Ga0075435_100089520 3300007076 Bacteria 2538
77 Ga0099794_10002738 3300007265 Bacteria 6578
78 Ga0099794_10005297 3300007265 Bacteria 5162
79 Ga0099794_10012908 3300007265 Bacteria 3622
80 Ga0099794_10023765 3300007265 Bacteria 2807
81 Ga0099794_10086259 3300007265 Bacteria 1554
82 Ga0099795_10020471 3300007788 Unclassified 2156
83 Ga0105247_10276122 3300009101 Bacteria 1158
84 Ga0105247_10325009 3300009101 Unclassified 1074
85 Ga0105247_10487447 3300009101 Unclassified 896
86 Ga0105242_10189481 3300009176 Unclassified 1820
87 Ga0105248_10028542 3300009177 Bacteria 6217
88 Ga0105237_10183878 3300009545 Unclassified 2090
89 Ga0099796_10078950 3300010159 Unclassified 1203
90 Ga0105239_10244792 3300010375 Unclassified 2013
91 Ga0157374_10158322 3300013296 Bacteria 2205
92 Ga0157378_10000137 3300013297 Bacteria 69371
93 Ga0157378_10004002 3300013297 Bacteria 13020
94 Ga0157379_10112164 3300014968 Unclassified 2450
95 Ga0157376_10000038 3300014969 Bacteria 134733
96 Ga0157376_10000160 3300014969 Bacteria 46966
97 Ga0207653_10004809 3300025885 Bacteria 4224
98 Ga0207692_10023087 3300025898 Bacteria 2873
99 Ga0207699_10008883 3300025906 Bacteria 4980
100 Ga0207699_10019026 3300025906 Bacteria 3652
101 Ga0207684_10004628 3300025910 Bacteria 12915
102 Ga0207684_10027229 3300025910 Bacteria 4872
103 Ga0207684_10035114 3300025910 Bacteria 4257
104 Ga0207684_10230866 3300025910 Bacteria 1597
105 Ga0207693_10198601 3300025915 Unclassified 1577
106 Ga0207693_10229390 3300025915 Unclassified 1458
107 Ga0207693_10259208 3300025915 Unclassified 1364
108 Ga0207693_10416682 3300025915 Unclassified 1050
109 Ga0207693_10587095 3300025915 Bacteria 868
110 Ga0207663_10096822 3300025916 Unclassified 1972
111 Ga0207663_10261617 3300025916 Bacteria 1278
112 Ga0207646_10000019 3300025922 Bacteria 282855
113 Ga0207646_10000039 3300025922 Bacteria 188453
114 Ga0207646_10007285 3300025922 Bacteria 11271
115 Ga0207646_10090926 3300025922 Bacteria 2732
116 Ga0207646_10969955 3300025922 Unclassified 752
117 Ga0207700_10063698 3300025928 Bacteria 2805
118 Ga0207700_10272593 3300025928 Unclassified 1453
119 Ga0207686_10213381 3300025934 Unclassified 1389
120 Ga0207704_10162494 3300025938 Unclassified 1591
121 Ga0207665_10000089 3300025939 Bacteria 59318
122 Ga0207665_10003035 3300025939 Bacteria 11266
123 Ga0207665_10029351 3300025939 Unclassified 3636
124 Ga0207665_10055398 3300025939 Unclassified 2675
125 Ga0207665_10068692 3300025939 Unclassified 2415
126 Ga0207665_10107113 3300025939 Bacteria 1959
127 Ga0207677_10475623 3300026023 Unclassified 1075
128 Ga0207703_10483416 3300026035 Unclassified 1161
129 Ga0207639_10005977 3300026041 Bacteria 8258
130 Ga0207641_10004305 3300026088 Bacteria 12364
131 Ga0209179_1016927 3300027512 Unclassified 1374
132 Ga0265354_1000411 3300028016 Bacteria 7549
133 Ga0265354_1001926 3300028016 Unclassified 2756
134 Ga0268266_10000302 3300028379 Bacteria 78763
135 Ga0268264_10687093 3300028381 Bacteria 1016
136 Ga0265770_1000706 3300030878 Unclassified 4653
137 Ga0265770_1002006 3300030878 Bacteria 2774
138 Ga0265760_10011781 3300031090 Unclassified 2499
139 Ga0265760_10019957 3300031090 Bacteria 1933
140 Ga0265760_10024475 3300031090 Unclassified 1759
141 Ga0307516_10075965 3300031730 Bacteria 3213
142 Ga0373926_0011858 3300035083 Bacteria 2941
143 Ga0373934_0003660 3300035086 Bacteria 5650
144 Ga0373923_0009692 3300035111 Bacteria 3483
145 Ga0373945_0148036 3300035116 Unclassified 950
146 Ga0373953_0074140 3300035117 Unclassified 1407
147 Ga0373954_0006400 3300035118 Bacteria 5136
148 Ga0373954_0105743 3300035118 Unclassified 1359
149 Ga0373957_0003681 3300035120 Bacteria 4576
150 Ga0373946_0085084 3300035171 Bacteria 1392
151 Ga0373955_0004246 3300035172 Bacteria 6328
152 Ga0373955_0116673 3300035172 Bacteria 1548
153 Ga0373955_0118434 3300035172 Archaea 1537
154 Ga0373931_0082847 3300035691 Unclassified 1774
155 Ga0373927_0004903 3300035695 Bacteria 9295
156 Ga0373933_0002622 3300035724 Bacteria 10083
157 Ga0373947_0003884 3300035725 Bacteria 8790
158 Ga0373937_0005085 3300036401 Bacteria 11200
159 Ga0373937_0011706 3300036401 Unclassified 7694
160 Ga0373925_0001250 3300037068 Bacteria 22415
161 Ga0373925_0279492 3300037068 Bacteria 1344
162 Ga0373925_0399891 3300037068 Unclassified 1120
163 Ga0395898_0609274 3300037466 Bacteria 1035
164 Ga0451577_0064444 3300042876 Bacteria 3268
165 Ga0451577_0140480 3300042876 Unclassified 2170
166 Ga0451577_0292126 3300042876 Bacteria 1477
167 Ga0453683_0001517 3300044673 Bacteria 19821
168 Ga0453683_0003698 3300044673 Bacteria 11190
169 Ga0453684_0007605 3300044712 Bacteria 19858
170 Ga0453684_0407088 3300044712 Unclassified 1522
171 Ga0451576_0008634 3300045051 Bacteria 11933
172 Ga0495592_0051826 3300046454 Bacteria 3048
173 Ga0495592_0058151 3300046454 Bacteria 2852
174 Ga0495603_0016253 3300046455 Bacteria 4503
175 Ga0495603_0061736 3300046455 Bacteria 2213
176 Ga0495629_0011234 3300046459 Bacteria 6503
177 Ga0495651_0001954 3300046462 Bacteria 15929
178 Ga0495651_0012679 3300046462 Bacteria 6505
179 Ga0495651_0036423 3300046462 Bacteria 3831
180 Ga0495653_0004145 3300046463 Bacteria 11728
181 Ga0495653_0133862 3300046463 Bacteria 1751
182 Ga0495580_0009941 3300046472 Bacteria 7445
183 Ga0495580_0053669 3300046472 Unclassified 2844
184 Ga0495582_0006655 3300046473 Bacteria 6420
185 Ga0495639_0017392 3300046475 Bacteria 3122
186 Ga0495639_0136284 3300046475 Bacteria 1178
187 Ga0495608_0005808 3300046511 Bacteria 8794
188 Ga0495608_0006137 3300046511 Bacteria 8529
189 Ga0495608_0058546 3300046511 Bacteria 2540
190 Ga0495618_0111177 3300046514 Bacteria 1754
191 Ga0495628_0000943 3300046516 Bacteria 26642
192 Ga0495628_0026495 3300046516 Bacteria 4726
193 Ga0495630_0003848 3300046517 Bacteria 10478
194 Ga0495630_0023119 3300046517 Bacteria 4593
195 Ga0495630_0051209 3300046517 Bacteria 3090
196 Ga0495630_0264633 3300046517 Unclassified 1313
197 Ga0495666_0043962 3300046526 Bacteria 2157
198 Ga0495666_0160450 3300046526 Bacteria 1043
199 Ga0495652_0000954 3300046529 Bacteria 33161
200 Ga0495652_0006917 3300046529 Bacteria 10498
201 Ga0495665_0001833 3300046531 Bacteria 11475
202 Ga0495665_0071144 3300046531 Unclassified 1832
203 Ga0495640_0044937 3300046533 Unclassified 3067
204 Ga0495640_0208570 3300046533 Bacteria 1236
205 Ga0495586_0041536 3300046535 Bacteria 2477
206 Ga0495587_0000442 3300046536 Bacteria 29092
207 Ga0495587_0015405 3300046536 Bacteria 4775
208 Ga0495645_0006620 3300046543 Bacteria 8048
209 Ga0495645_0019680 3300046543 Bacteria 4863
210 Ga0495667_0032634 3300046559 Bacteria 3488
211 Ga0495667_0171709 3300046559 Bacteria 1393
212 Ga0495667_0201646 3300046559 Unclassified 1273
213 Ga0495634_0098803 3300046642 Bacteria 1888
214 Ga0495635_0016351 3300046663 Bacteria 5180
215 Ga0495635_0203747 3300046663 Bacteria 1341
216 Ga0495635_0236221 3300046663 Bacteria 1234
217 Ga0495657_0007474 3300046675 Bacteria 8444
218 Ga0495657_0013658 3300046675 Bacteria 5983
219 Ga0495657_0381611 3300046675 Unclassified 831
220 Ga0495599_0008189 3300046678 Bacteria 6352
221 Ga0495599_0092951 3300046678 Unclassified 1882
222 Ga0495599_0115103 3300046678 Bacteria 1673
223 Ga0495623_0024046 3300046679 Bacteria 3930
224 Ga0495623_0086645 3300046679 Bacteria 1930
225 Ga0495623_0109746 3300046679 Bacteria 1673
226 Ga0495658_0125747 3300046683 Bacteria 1555
227 Ga0495613_0235461 3300046689 Bacteria 1281
228 Ga0495624_0016108 3300046690 Bacteria 5034
229 Ga0495624_0018580 3300046690 Unclassified 4648
230 Ga0495581_0004099 3300047315 Bacteria 8385
231 Ga0495604_0000979 3300047317 Bacteria 23812
232 Ga0495604_0025851 3300047317 Bacteria 4675
233 Ga0495604_0049947 3300047317 Bacteria 3248
234 Ga0495674_0001505 3300047319 Bacteria 22860
235 Ga0495674_0098896 3300047319 Bacteria 2484
236 Ga0495674_0204938 3300047319 Bacteria 1635
237 Ga0495676_0066214 3300047321 Bacteria 2801
238 Ga0495676_0421521 3300047321 Unclassified 883
239 Ga0495680_0000547 3300047322 Bacteria 42327
240 Ga0495680_0030909 3300047322 Bacteria 4364
241 Ga0495680_0058268 3300047322 Unclassified 2985
242 Ga0495675_0000027 3300047444 Bacteria 106917
243 Ga0495684_0032904 3300047471 Bacteria 3982
244 Ga0495684_0034068 3300047471 Bacteria 3907
245 Ga0495684_0039114 3300047471 Bacteria 3636
246 Ga0495684_0072670 3300047471 Unclassified 2613
247 Ga0495593_0022382 3300047673 Bacteria 3521
248 Ga0495602_0002605 3300048088 Bacteria 18426
249 Ga0495614_0013465 3300048089 Unclassified 3587
250 Ga0495614_0092978 3300048089 Bacteria 1313
251 Ga0496101_0206532 3300048904 Bacteria 1520
252 Ga0496102_0029982 3300048905 Bacteria 4868
253 Ga0496104_0336707 3300048907 Bacteria 1422
254 Ga0496105_0540060 3300048908 Bacteria 911
255 Ga0496107_0049414 3300048910 Bacteria 3031
256 Ga0496112_0111106 3300048915 Bacteria 2711
257 Ga0496114_0176171 3300048917 Bacteria 1866
258 Ga0496114_0517493 3300048917 Unclassified 1055
259 Ga0496115_0010963 3300048918 Bacteria 6786
260 Ga0496115_0038188 3300048918 Unclassified 3809
261 Ga0496115_0296664 3300048918 Bacteria 1325
262 nmdc:mga0yw44_1_c1 3300050492 Bacteria 702221
263 nmdc:mga0k408_35108_c1 3300050493 Bacteria 1557
264 nmdc:mga0n895_11772_c1 3300050512 Bacteria 7821
265 nmdc:mga0n895_33136_c1 3300050512 Bacteria 4963
266 nmdc:mga0n895_956874_c1 3300050512 Unclassified 839
267 nmdc:mga0rr50_33175_c1 3300050513 Bacteria 3686
268 nmdc:mga0rr50_429698_c1 3300050513 Bacteria 1118
269 nmdc:mga0rr50_597284_c1 3300050513 Unclassified 941
270 nmdc:mga08x19_134_c1 3300050514 Bacteria 65861
271 nmdc:mga08x19_24691_c1 3300050514 Bacteria 3739
272 nmdc:mga0a205_224074_c1 3300050515 Bacteria 1765
273 Ga0495619_0042841 3300053085 Bacteria 2966
274 Ga0500555_000006 3300053103 Bacteria 304416
275 Ga0500570_000296 3300053724 Bacteria 17461
276 Ga0075435_100030374
277 Ga0065707_10224011
278 Ga0070666_10353789
279 Ga0070703_10003568
280 Ga0070709_10017112
281 Ga0070709_10018275
282 Ga0070709_10040436
283 Ga0070709_10156163
284 Ga0070709_10244306
285 Ga0070713_100065721
286 Ga0070710_10006158
287 Ga0070711_100014360
288 Ga0070711_100053705
289 Ga0070711_100178045
290 Ga0070705_100001028
291 Ga0070705_100199891
292 Ga0070694_100036499
293 Ga0070694_100171366
294 Ga0070708_100007988
295 Ga0070708_100191143
296 Ga0070708_100520299
297 Ga0070706_100000406
298 Ga0070706_100017419
299 Ga0070707_100000151
300 Ga0070707_100002663
301 Ga0070707_100012541
302 Ga0070707_100105902
303 Ga0070707_100366493
304 Ga0070707_100669276
305 Ga0070707_100675742
306 Ga0070698_100032124
307 Ga0070698_100035555
308 Ga0070699_100015347
309 Ga0070699_100097632
310 Ga0070699_100303069
311 Ga0070679_100023694
312 Ga0070697_100000305
313 Ga0070697_100002835
314 Ga0070697_100096082
315 Ga0070697_100120522
316 Ga0070697_100140237
317 Ga0070697_100511602
318 Ga0070695_100154994
319 Ga0070696_100001596
320 Ga0070696_100065555
321 Ga0070693_100001052
322 Ga0070693_100013391
323 Ga0070665_100044768
324 Ga0070704_100018931
325 Ga0068859_100280206
326 Ga0068863_100023354
327 Ga0068860_100060057
328 Ga0081540_1081184
329 Ga0070717_10024996
330 Ga0070717_10094198
331 Ga0075365_10000028
332 Ga0070715_10123752
333 Ga0070715_10143257
334 Ga0070715_10171879
335 Ga0070716_100003066
336 Ga0070716_100087585
337 Ga0070716_100221644
338 Ga0070716_100255417
339 Ga0070712_100120129
340 Ga0070712_100219240
341 Ga0070712_100298171
342 Ga0070712_100444225
343 Ga0075366_10360966
344 Ga0075428_100001376
345 Ga0075433_10414413
346 Ga0075434_101033156
347 Ga0075436_100020515
348 Ga0075436_100579658
349 Ga0097620_100280205
350 Ga0075435_100025679
351 Ga0075435_100089520
352 Ga0099794_10002738
353 Ga0099794_10005297
354 Ga0099794_10012908
355 Ga0099794_10023765
356 Ga0099794_10086259
357 Ga0099795_10020471
358 Ga0105247_10276122
359 Ga0105247_10325009
360 Ga0105247_10487447
361 Ga0105242_10189481
362 Ga0105248_10028542
363 Ga0105237_10183878
364 Ga0099796_10078950
365 Ga0105239_10244792
366 Ga0157374_10158322
367 Ga0157378_10000137
368 Ga0157378_10004002
369 Ga0157379_10112164
370 Ga0157376_10000038
371 Ga0157376_10000160
372 Ga0207653_10004809
373 Ga0207692_10023087
374 Ga0207699_10008883
375 Ga0207699_10019026
376 Ga0207684_10004628
377 Ga0207684_10027229
378 Ga0207684_10035114
379 Ga0207684_10230866
380 Ga0207693_10198601
381 Ga0207693_10229390
382 Ga0207693_10259208
383 Ga0207693_10416682
384 Ga0207693_10587095
385 Ga0207663_10096822
386 Ga0207663_10261617
387 Ga0207646_10000019
388 Ga0207646_10000039
389 Ga0207646_10007285
390 Ga0207646_10090926
391 Ga0207646_10969955
392 Ga0207700_10063698
393 Ga0207700_10272593
394 Ga0207686_10213381
395 Ga0207704_10162494
396 Ga0207665_10000089
397 Ga0207665_10003035
398 Ga0207665_10029351
399 Ga0207665_10055398
400 Ga0207665_10068692
401 Ga0207665_10107113
402 Ga0207677_10475623
403 Ga0207703_10483416
404 Ga0207639_10005977
405 Ga0207641_10004305
406 Ga0209179_1016927
407 Ga0265354_1000411
408 Ga0265354_1001926
409 Ga0268266_10000302
410 Ga0268264_10687093
411 Ga0265770_1000706
412 Ga0265770_1002006
413 Ga0265760_10011781
414 Ga0265760_10019957
415 Ga0265760_10024475
416 Ga0307516_10075965
417 Ga0373926_0011858
418 Ga0373934_0003660
419 Ga0373923_0009692
420 Ga0373945_0148036
421 Ga0373953_0074140
422 Ga0373954_0006400
423 Ga0373954_0105743
424 Ga0373957_0003681
425 Ga0373946_0085084
426 Ga0373955_0004246
427 Ga0373955_0116673
428 Ga0373955_0118434
429 Ga0373931_0082847
430 Ga0373927_0004903
431 Ga0373933_0002622
432 Ga0373947_0003884
433 Ga0373937_0005085
434 Ga0373937_0011706
435 Ga0373925_0001250
436 Ga0373925_0279492
437 Ga0373925_0399891
438 Ga0395898_0609274
439 Ga0451577_0064444
440 Ga0451577_0140480
441 Ga0451577_0292126
442 Ga0453683_0001517
443 Ga0453683_0003698
444 Ga0453684_0007605
445 Ga0453684_0407088
446 Ga0451576_0008634
447 Ga0495592_0051826
448 Ga0495592_0058151
449 Ga0495603_0016253
450 Ga0495603_0061736
451 Ga0495629_0011234
452 Ga0495651_0001954
453 Ga0495651_0012679
454 Ga0495651_0036423
455 Ga0495653_0004145
456 Ga0495653_0133862
457 Ga0495580_0009941
458 Ga0495580_0053669
459 Ga0495582_0006655
460 Ga0495639_0017392
461 Ga0495639_0136284
462 Ga0495608_0005808
463 Ga0495608_0006137
464 Ga0495608_0058546
465 Ga0495618_0111177
466 Ga0495628_0000943
467 Ga0495628_0026495
468 Ga0495630_0003848
469 Ga0495630_0023119
470 Ga0495630_0051209
471 Ga0495630_0264633
472 Ga0495666_0043962
473 Ga0495666_0160450
474 Ga0495652_0000954
475 Ga0495652_0006917
476 Ga0495665_0001833
477 Ga0495665_0071144
478 Ga0495640_0044937
479 Ga0495640_0208570
480 Ga0495586_0041536
481 Ga0495587_0000442
482 Ga0495587_0015405
483 Ga0495645_0006620
484 Ga0495645_0019680
485 Ga0495667_0032634
486 Ga0495667_0171709
487 Ga0495667_0201646
488 Ga0495634_0098803
489 Ga0495635_0016351
490 Ga0495635_0203747
491 Ga0495635_0236221
492 Ga0495657_0007474
493 Ga0495657_0013658
494 Ga0495657_0381611
495 Ga0495599_0008189
496 Ga0495599_0092951
497 Ga0495599_0115103
498 Ga0495623_0024046
499 Ga0495623_0086645
500 Ga0495623_0109746
501 Ga0495658_0125747
502 Ga0495613_0235461
503 Ga0495624_0016108
504 Ga0495624_0018580
505 Ga0495581_0004099
506 Ga0495604_0000979
507 Ga0495604_0025851
508 Ga0495604_0049947
509 Ga0495674_0001505
510 Ga0495674_0098896
511 Ga0495674_0204938
512 Ga0495676_0066214
513 Ga0495676_0421521
514 Ga0495680_0000547
515 Ga0495680_0030909
516 Ga0495680_0058268
517 Ga0495675_0000027
518 Ga0495684_0032904
519 Ga0495684_0034068
520 Ga0495684_0039114
521 Ga0495684_0072670
522 Ga0495593_0022382
523 Ga0495602_0002605
524 Ga0495614_0013465
525 Ga0495614_0092978
526 Ga0496101_0206532
527 Ga0496102_0029982
528 Ga0496104_0336707
529 Ga0496105_0540060
530 Ga0496107_0049414
531 Ga0496112_0111106
532 Ga0496114_0176171
533 Ga0496114_0517493
534 Ga0496115_0010963
535 Ga0496115_0038188
536 Ga0496115_0296664
537 nmdc:mga0yw44_1_c1
538 nmdc:mga0k408_35108_c1
539 nmdc:mga0n895_11772_c1
540 nmdc:mga0n895_33136_c1
541 nmdc:mga0n895_956874_c1
542 nmdc:mga0rr50_33175_c1
543 nmdc:mga0rr50_429698_c1
544 nmdc:mga0rr50_597284_c1
545 nmdc:mga08x19_134_c1
546 nmdc:mga08x19_24691_c1
547 nmdc:mga0a205_224074_c1
548 Ga0495619_0042841
549 Ga0500555_000006
550 Ga0500570_000296

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02223

Thymidylate_kin

Thymidylate kinase

47

241

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wwi-assembly2.cif.gz_B plasmodium falciparum thymidylate kinase in complex with aztmp and adp 0.911 3 221
2wwf-assembly1.cif.gz_A plasmodium falciparum thymidylate kinase in complex with tmp and adp 0.8992 2 222
2yog-assembly2.cif.gz_B plasmodium falciparum thymidylate kinase in complex with a (thio)urea- alpha-deoxythymidine inhibitor 0.8986 2 224
2yoh-assembly2.cif.gz_B plasmodium falciparum thymidylate kinase in complex with a urea-alpha- deoxythymidine inhibitor 0.896 3 224
7fgq-assembly1.cif.gz_A-2 crystal structure of thymidylate kinase with tmp and its low-resolution (saxs) solution structure from brugia malayi 0.8946 3 231
ID Description Score Start End Superfamily
af_Q4DE18_126_348_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9363 1 226 3.40.50.300
af_Q4DE18_126_348_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9323 1 226 3.40.50.300
af_Q57741_3_187_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9027 5 224 3.40.50.300
2yohA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.892 3 222 3.40.50.300
af_Q57741_3_187_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8889 5 224 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2V9CEH1-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9934 1 225 GO:0004798
GO:0005524
GO:0005737
GO:0006227
GO:0006233
GO:0006235
AF-A0A7C2VE91-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9931 4 225 GO:0004798
GO:0005524
GO:0005737
GO:0006227
GO:0006233
GO:0006235
AF-A0A1Q6YCH3-F1-model_v4 Thymidylate kinase-like domain-containing protein 0.9891 23 224 GO:0004798
GO:0005737
GO:0006227
GO:0006233
GO:0006235
AF-A0A1Q8ATJ6-F1-model_v4 Thymidylate kinase-like domain-containing protein 0.9874 12 228 GO:0006261
AF-A0A2E7S493-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9844 5 223 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235

Map