F380354
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 275 | 141 | 275 | 92 |
Family's Representative Sequence
| Representative Sequence | 3300006871|Ga0075434_100735259|Ga0075434_1007352592 |
| Length | 89 |
| Sequence | MTVAEAIRAKLDQAFAPAALDIVDESHLHAGHAGHRPGISTHFRVAIVSSAFAGKARVERQRMIYAALDELMGKPIHALALSAKAPGER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 30 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 31 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 32 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 34 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 35 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 36 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 52 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 53 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 91 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 92 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 93 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 94 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 95 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 96 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 97 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 98 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 99 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 100 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 101 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 102 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 103 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 104 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 105 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 106 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 107 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 108 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 109 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 110 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 111 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 112 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 113 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 114 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 115 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 116 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 117 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 118 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 119 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 133 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 135 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 136 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 139 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.64 |
| Metatranscriptomes | 0.36 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.09 |
| Nodule | 0 |
| Rhizoplane | 2.91 |
| Rhizosphere | 95.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10004367 | 3300001990 | Bacteria | 4933 |
| 2 | JGI24737J22298_10023183 | 3300001990 | Bacteria | 1970 |
| 3 | JGI24735J21928_10044683 | 3300002067 | Bacteria | 1287 |
| 4 | Ga0065712_10415715 | 3300005290 | Unclassified | 717 |
| 5 | Ga0070658_10014808 | 3300005327 | Bacteria | 6249 |
| 6 | Ga0070658_10029453 | 3300005327 | Bacteria | 4410 |
| 7 | Ga0070658_10050965 | 3300005327 | Unclassified | 3355 |
| 8 | Ga0070658_10297203 | 3300005327 | Bacteria | 1376 |
| 9 | Ga0070658_10674837 | 3300005327 | Bacteria | 897 |
| 10 | Ga0068869_100883750 | 3300005334 | Bacteria | 772 |
| 11 | Ga0070682_100594387 | 3300005337 | Bacteria | 873 |
| 12 | Ga0068868_100270907 | 3300005338 | Unclassified | 1434 |
| 13 | Ga0070660_100008386 | 3300005339 | Bacteria | 7224 |
| 14 | Ga0070660_100408234 | 3300005339 | Bacteria | 1124 |
| 15 | Ga0070691_10384953 | 3300005341 | Bacteria | 787 |
| 16 | Ga0070661_100068373 | 3300005344 | Bacteria | 2610 |
| 17 | Ga0070661_100122099 | 3300005344 | Bacteria | 1952 |
| 18 | Ga0070661_100156281 | 3300005344 | Bacteria | 1725 |
| 19 | Ga0070661_100991027 | 3300005344 | Bacteria | 697 |
| 20 | Ga0070669_100297665 | 3300005353 | Bacteria | 1297 |
| 21 | Ga0070669_100538430 | 3300005353 | Bacteria | 972 |
| 22 | Ga0070675_100047934 | 3300005354 | Unclassified | 3503 |
| 23 | Ga0070671_100343727 | 3300005355 | Bacteria | 1273 |
| 24 | Ga0070659_100004168 | 3300005366 | Bacteria | 10307 |
| 25 | Ga0070659_100446342 | 3300005366 | Bacteria | 1097 |
| 26 | Ga0070659_101097388 | 3300005366 | Bacteria | 701 |
| 27 | Ga0070714_100063953 | 3300005435 | Bacteria | 3165 |
| 28 | Ga0070714_100362869 | 3300005435 | Bacteria | 1362 |
| 29 | Ga0070714_101311915 | 3300005435 | Bacteria | 706 |
| 30 | Ga0070713_100312456 | 3300005436 | Bacteria | 1449 |
| 31 | Ga0070713_100857183 | 3300005436 | Bacteria | 872 |
| 32 | Ga0070713_101307384 | 3300005436 | Bacteria | 703 |
| 33 | Ga0070663_100088930 | 3300005455 | Bacteria | 2285 |
| 34 | Ga0070663_101027330 | 3300005455 | Bacteria | 718 |
| 35 | Ga0070681_10115276 | 3300005458 | Bacteria | 2625 |
| 36 | Ga0070681_11404162 | 3300005458 | Bacteria | 622 |
| 37 | Ga0070684_100066457 | 3300005535 | Bacteria | 3165 |
| 38 | Ga0068853_100054647 | 3300005539 | Bacteria | 3442 |
| 39 | Ga0068853_100335957 | 3300005539 | Bacteria | 1403 |
| 40 | Ga0070672_100030442 | 3300005543 | Bacteria | 4054 |
| 41 | Ga0070672_100045048 | 3300005543 | Bacteria | 3410 |
| 42 | Ga0070686_100181186 | 3300005544 | Unclassified | 1497 |
| 43 | Ga0070693_101158030 | 3300005547 | Unclassified | 592 |
| 44 | Ga0070665_100082886 | 3300005548 | Bacteria | 3212 |
| 45 | Ga0068855_100202022 | 3300005563 | Bacteria | 2237 |
| 46 | Ga0070664_100464922 | 3300005564 | Bacteria | 1163 |
| 47 | Ga0070664_100628838 | 3300005564 | Bacteria | 997 |
| 48 | Ga0068857_100064127 | 3300005577 | Bacteria | 3266 |
| 49 | Ga0068857_100864132 | 3300005577 | Bacteria | 866 |
| 50 | Ga0068852_100012940 | 3300005616 | Bacteria | 6363 |
| 51 | Ga0068852_102152073 | 3300005616 | Unclassified | 579 |
| 52 | Ga0068864_100885491 | 3300005618 | Bacteria | 881 |
| 53 | Ga0068864_100901576 | 3300005618 | Unclassified | 873 |
| 54 | Ga0068851_10934452 | 3300005834 | Bacteria | 545 |
| 55 | Ga0068863_100004532 | 3300005841 | Bacteria | 13698 |
| 56 | Ga0068863_100023410 | 3300005841 | Bacteria | 5899 |
| 57 | Ga0068863_101542038 | 3300005841 | Unclassified | 673 |
| 58 | Ga0070716_100334925 | 3300006173 | Bacteria | 1065 |
| 59 | Ga0075366_10304034 | 3300006195 | Bacteria | 976 |
| 60 | Ga0075434_100735259 | 3300006871 | Bacteria | 1004 |
| 61 | Ga0068865_100150441 | 3300006881 | Bacteria | 1765 |
| 62 | Ga0105240_10443824 | 3300009093 | Bacteria | 1453 |
| 63 | Ga0105240_11731925 | 3300009093 | Bacteria | 652 |
| 64 | Ga0105248_10175120 | 3300009177 | Bacteria | 2418 |
| 65 | Ga0105237_10124924 | 3300009545 | Bacteria | 2567 |
| 66 | Ga0105238_10052960 | 3300009551 | Bacteria | 4079 |
| 67 | Ga0105238_11191701 | 3300009551 | Bacteria | 786 |
| 68 | Ga0105238_12149903 | 3300009551 | Bacteria | 593 |
| 69 | Ga0105239_11271492 | 3300010375 | Unclassified | 849 |
| 70 | Ga0105239_11868061 | 3300010375 | Unclassified | 696 |
| 71 | Ga0105246_10086339 | 3300011119 | Unclassified | 2249 |
| 72 | Ga0105246_10219001 | 3300011119 | Unclassified | 1491 |
| 73 | Ga0105246_11712984 | 3300011119 | Unclassified | 598 |
| 74 | Ga0157373_10038247 | 3300013100 | Bacteria | 3440 |
| 75 | Ga0157373_10045910 | 3300013100 | Bacteria | 3118 |
| 76 | Ga0157373_10588428 | 3300013100 | Unclassified | 809 |
| 77 | Ga0157371_10062001 | 3300013102 | Bacteria | 2651 |
| 78 | Ga0157371_10327060 | 3300013102 | Unclassified | 1113 |
| 79 | Ga0157371_10714977 | 3300013102 | Bacteria | 751 |
| 80 | Ga0157370_10036715 | 3300013104 | Bacteria | 4754 |
| 81 | Ga0157370_10972533 | 3300013104 | Bacteria | 769 |
| 82 | Ga0157369_11714584 | 3300013105 | Unclassified | 638 |
| 83 | Ga0157378_10183627 | 3300013297 | Unclassified | 1969 |
| 84 | Ga0157372_10251000 | 3300013307 | Bacteria | 2054 |
| 85 | Ga0157372_10642743 | 3300013307 | Bacteria | 1236 |
| 86 | Ga0157375_10270351 | 3300013308 | Unclassified | 1862 |
| 87 | Ga0163163_10061314 | 3300014325 | Bacteria | 3726 |
| 88 | Ga0157377_10329516 | 3300014745 | Bacteria | 1017 |
| 89 | Ga0206354_11140010 | 3300020081 | Bacteria | 660 |
| 90 | Ga0213875_10028084 | 3300021388 | Bacteria | 2675 |
| 91 | Ga0207656_10531033 | 3300025321 | Bacteria | 598 |
| 92 | Ga0207656_10546005 | 3300025321 | Unclassified | 590 |
| 93 | Ga0207682_10132835 | 3300025893 | Bacteria | 1112 |
| 94 | Ga0207680_10102510 | 3300025903 | Unclassified | 1841 |
| 95 | Ga0207645_10021744 | 3300025907 | Bacteria | 4179 |
| 96 | Ga0207705_10080708 | 3300025909 | Bacteria | 2370 |
| 97 | Ga0207705_10198309 | 3300025909 | Bacteria | 1520 |
| 98 | Ga0207705_10284398 | 3300025909 | Bacteria | 1266 |
| 99 | Ga0207705_10477380 | 3300025909 | Unclassified | 968 |
| 100 | Ga0207707_10607767 | 3300025912 | Bacteria | 925 |
| 101 | Ga0207695_10634184 | 3300025913 | Bacteria | 950 |
| 102 | Ga0207693_10025496 | 3300025915 | Bacteria | 4687 |
| 103 | Ga0207657_10001331 | 3300025919 | Bacteria | 26231 |
| 104 | Ga0207657_10753858 | 3300025919 | Unclassified | 754 |
| 105 | Ga0207649_10073556 | 3300025920 | Bacteria | 2190 |
| 106 | Ga0207649_10780096 | 3300025920 | Bacteria | 745 |
| 107 | Ga0207694_10291753 | 3300025924 | Bacteria | 1341 |
| 108 | Ga0207659_10075124 | 3300025926 | Bacteria | 2479 |
| 109 | Ga0207687_10803455 | 3300025927 | Bacteria | 802 |
| 110 | Ga0207700_10182828 | 3300025928 | Bacteria | 1757 |
| 111 | Ga0207700_10259242 | 3300025928 | Bacteria | 1488 |
| 112 | Ga0207664_10040821 | 3300025929 | Bacteria | 3611 |
| 113 | Ga0207664_10192661 | 3300025929 | Bacteria | 1755 |
| 114 | Ga0207664_10249100 | 3300025929 | Bacteria | 1550 |
| 115 | Ga0207644_10303138 | 3300025931 | Bacteria | 1288 |
| 116 | Ga0207690_10020330 | 3300025932 | Bacteria | 4101 |
| 117 | Ga0207690_10206881 | 3300025932 | Bacteria | 1494 |
| 118 | Ga0207706_10065213 | 3300025933 | Bacteria | 3206 |
| 119 | Ga0207670_10533313 | 3300025936 | Bacteria | 957 |
| 120 | Ga0207704_10185023 | 3300025938 | Unclassified | 1509 |
| 121 | Ga0207665_10057146 | 3300025939 | Bacteria | 2635 |
| 122 | Ga0207691_10006922 | 3300025940 | Bacteria | 10935 |
| 123 | Ga0207711_10116099 | 3300025941 | Bacteria | 2386 |
| 124 | Ga0207661_10072414 | 3300025944 | Bacteria | 2819 |
| 125 | Ga0207667_10040963 | 3300025949 | Bacteria | 4929 |
| 126 | Ga0207667_10257361 | 3300025949 | Bacteria | 1785 |
| 127 | Ga0207667_10624771 | 3300025949 | Bacteria | 1085 |
| 128 | Ga0207677_10099400 | 3300026023 | Bacteria | 2136 |
| 129 | Ga0207703_11220906 | 3300026035 | Unclassified | 723 |
| 130 | Ga0207639_10737416 | 3300026041 | Bacteria | 915 |
| 131 | Ga0207639_10828586 | 3300026041 | Bacteria | 863 |
| 132 | Ga0207678_10048543 | 3300026067 | Bacteria | 3669 |
| 133 | Ga0207678_10659838 | 3300026067 | Bacteria | 919 |
| 134 | Ga0207702_10395588 | 3300026078 | Bacteria | 1332 |
| 135 | Ga0207702_11439589 | 3300026078 | Unclassified | 683 |
| 136 | Ga0207641_10015935 | 3300026088 | Bacteria | 6154 |
| 137 | Ga0207641_11041223 | 3300026088 | Bacteria | 816 |
| 138 | Ga0207648_10101502 | 3300026089 | Bacteria | 2521 |
| 139 | Ga0207676_11849675 | 3300026095 | Unclassified | 602 |
| 140 | Ga0207674_10001210 | 3300026116 | Bacteria | 33627 |
| 141 | Ga0207674_10346342 | 3300026116 | Bacteria | 1437 |
| 142 | Ga0207683_11796757 | 3300026121 | Bacteria | 562 |
| 143 | Ga0207698_10006895 | 3300026142 | Bacteria | 7107 |
| 144 | Ga0207698_11298329 | 3300026142 | Bacteria | 742 |
| 145 | Ga0268266_10367597 | 3300028379 | Bacteria | 1354 |
| 146 | Ga0307405_11785644 | 3300031731 | Bacteria | 546 |
| 147 | Ga0307413_10039367 | 3300031824 | Bacteria | 2749 |
| 148 | Ga0307413_10068694 | 3300031824 | Bacteria | 2220 |
| 149 | Ga0307413_11716724 | 3300031824 | Bacteria | 560 |
| 150 | Ga0307410_10032482 | 3300031852 | Bacteria | 3359 |
| 151 | Ga0307410_10526931 | 3300031852 | Bacteria | 976 |
| 152 | Ga0307406_10121564 | 3300031901 | Bacteria | 1816 |
| 153 | Ga0307407_10022319 | 3300031903 | Bacteria | 3281 |
| 154 | Ga0307407_10232175 | 3300031903 | Bacteria | 1253 |
| 155 | Ga0307407_10235222 | 3300031903 | Bacteria | 1247 |
| 156 | Ga0307407_11095995 | 3300031903 | Bacteria | 619 |
| 157 | Ga0307412_10170308 | 3300031911 | Bacteria | 1627 |
| 158 | Ga0307412_10515554 | 3300031911 | Bacteria | 998 |
| 159 | Ga0307409_100035249 | 3300031995 | Bacteria | 3664 |
| 160 | Ga0307409_100123383 | 3300031995 | Bacteria | 2198 |
| 161 | Ga0307409_100451671 | 3300031995 | Bacteria | 1241 |
| 162 | Ga0307409_100647012 | 3300031995 | Bacteria | 1050 |
| 163 | Ga0307409_101244583 | 3300031995 | Bacteria | 768 |
| 164 | Ga0307416_100192425 | 3300032002 | Bacteria | 1925 |
| 165 | Ga0307416_100887396 | 3300032002 | Bacteria | 991 |
| 166 | Ga0307416_102239481 | 3300032002 | Bacteria | 647 |
| 167 | Ga0307414_10020386 | 3300032004 | Bacteria | 4132 |
| 168 | Ga0307414_10024392 | 3300032004 | Bacteria | 3856 |
| 169 | Ga0307414_10063804 | 3300032004 | Bacteria | 2620 |
| 170 | Ga0307414_10523606 | 3300032004 | Bacteria | 1052 |
| 171 | Ga0307411_10011718 | 3300032005 | Bacteria | 4748 |
| 172 | Ga0307411_10074609 | 3300032005 | Bacteria | 2312 |
| 173 | Ga0307411_10109865 | 3300032005 | Bacteria | 1970 |
| 174 | Ga0307411_10138748 | 3300032005 | Bacteria | 1789 |
| 175 | Ga0307411_10588312 | 3300032005 | Bacteria | 955 |
| 176 | Ga0307415_100014111 | 3300032126 | Bacteria | 4685 |
| 177 | Ga0307415_100159083 | 3300032126 | Bacteria | 1748 |
| 178 | Ga0307415_100315783 | 3300032126 | Bacteria | 1301 |
| 179 | Ga0373924_0392610 | 3300035410 | Unclassified | 620 |
| 180 | Ga0395899_0060159 | 3300037312 | Bacteria | 2798 |
| 181 | Ga0395899_0082662 | 3300037312 | Bacteria | 2335 |
| 182 | Ga0395899_0125977 | 3300037312 | Bacteria | 1832 |
| 183 | Ga0395899_0129664 | 3300037312 | Bacteria | 1801 |
| 184 | Ga0395899_0190353 | 3300037312 | Bacteria | 1436 |
| 185 | Ga0395899_0465480 | 3300037312 | Unclassified | 825 |
| 186 | Ga0395899_0572412 | 3300037312 | Bacteria | 723 |
| 187 | Ga0395899_0747302 | 3300037312 | Unclassified | 609 |
| 188 | Ga0395900_0035979 | 3300037418 | Bacteria | 5102 |
| 189 | Ga0395900_0047163 | 3300037418 | Bacteria | 4436 |
| 190 | Ga0395900_0052316 | 3300037418 | Bacteria | 4204 |
| 191 | Ga0395900_0070159 | 3300037418 | Bacteria | 3602 |
| 192 | Ga0395900_0115232 | 3300037418 | Bacteria | 2758 |
| 193 | Ga0395900_0148263 | 3300037418 | Bacteria | 2398 |
| 194 | Ga0395900_0233923 | 3300037418 | Bacteria | 1846 |
| 195 | Ga0395900_0702889 | 3300037418 | Bacteria | 944 |
| 196 | Ga0395900_0835274 | 3300037418 | Unclassified | 847 |
| 197 | Ga0395900_0941565 | 3300037418 | Bacteria | 786 |
| 198 | Ga0395898_0083531 | 3300037466 | Bacteria | 3078 |
| 199 | Ga0395898_0584232 | 3300037466 | Bacteria | 1059 |
| 200 | Ga0395898_0681126 | 3300037466 | Bacteria | 970 |
| 201 | Ga0395898_0735591 | 3300037466 | Bacteria | 928 |
| 202 | Ga0395905_0000187 | 3300037471 | Bacteria | 98895 |
| 203 | Ga0395905_0086921 | 3300037471 | Bacteria | 2931 |
| 204 | Ga0395905_0092499 | 3300037471 | Bacteria | 2836 |
| 205 | Ga0395905_0093297 | 3300037471 | Bacteria | 2823 |
| 206 | Ga0395905_0202930 | 3300037471 | Bacteria | 1858 |
| 207 | Ga0395905_0237772 | 3300037471 | Bacteria | 1702 |
| 208 | Ga0395905_0289923 | 3300037471 | Bacteria | 1523 |
| 209 | Ga0395905_0374582 | 3300037471 | Bacteria | 1317 |
| 210 | Ga0395905_0567991 | 3300037471 | Bacteria | 1036 |
| 211 | Ga0395905_0736003 | 3300037471 | Bacteria | 888 |
| 212 | Ga0395905_0741535 | 3300037471 | Bacteria | 884 |
| 213 | Ga0395905_0749990 | 3300037471 | Unclassified | 878 |
| 214 | Ga0395905_0917688 | 3300037471 | Bacteria | 779 |
| 215 | Ga0395905_0964762 | 3300037471 | Bacteria | 755 |
| 216 | Ga0436364_0030565 | 3300037853 | Bacteria | 2675 |
| 217 | Ga0395901_0046370 | 3300038443 | Bacteria | 4514 |
| 218 | Ga0395901_0079691 | 3300038443 | Bacteria | 3419 |
| 219 | Ga0395901_0306836 | 3300038443 | Bacteria | 1644 |
| 220 | Ga0395901_0778562 | 3300038443 | Bacteria | 947 |
| 221 | Ga0395901_0870888 | 3300038443 | Bacteria | 884 |
| 222 | Ga0395901_0960768 | 3300038443 | Bacteria | 832 |
| 223 | Ga0395901_1216318 | 3300038443 | Unclassified | 718 |
| 224 | Ga0451804_0681598 | 3300041463 | Bacteria | 666 |
| 225 | Ga0451807_0650239 | 3300041486 | Bacteria | 612 |
| 226 | Ga0439455_0011708 | 3300042012 | Bacteria | 1955 |
| 227 | Ga0439455_0077726 | 3300042012 | Bacteria | 899 |
| 228 | Ga0439458_0000009 | 3300042157 | Bacteria | 29761 |
| 229 | Ga0466972_0102614 | 3300044658 | Bacteria | 1353 |
| 230 | Ga0466972_0444140 | 3300044658 | Unclassified | 609 |
| 231 | Ga0466966_0233315 | 3300044684 | Bacteria | 1110 |
| 232 | Ga0466966_0251515 | 3300044684 | Bacteria | 1064 |
| 233 | Ga0466966_0940807 | 3300044684 | Unclassified | 521 |
| 234 | Ga0466963_0014070 | 3300044694 | Bacteria | 4929 |
| 235 | Ga0466963_0115871 | 3300044694 | Bacteria | 1841 |
| 236 | Ga0466963_0709839 | 3300044694 | Unclassified | 710 |
| 237 | Ga0466957_0333555 | 3300044842 | Bacteria | 1026 |
| 238 | Ga0466960_0096813 | 3300044901 | Bacteria | 1513 |
| 239 | Ga0466960_0507003 | 3300044901 | Bacteria | 707 |
| 240 | Ga0466959_0049790 | 3300045049 | Bacteria | 3077 |
| 241 | Ga0466959_0521048 | 3300045049 | Bacteria | 803 |
| 242 | Ga0466967_0332142 | 3300045976 | Bacteria | 1468 |
| 243 | Ga0466967_1488060 | 3300045976 | Bacteria | 674 |
| 244 | Ga0466967_2511431 | 3300045976 | Bacteria | 510 |
| 245 | Ga0495631_0298179 | 3300046518 | Bacteria | 686 |
| 246 | Ga0495643_0261294 | 3300046522 | Bacteria | 804 |
| 247 | Ga0495663_0002468 | 3300046525 | Bacteria | 5560 |
| 248 | Ga0495663_0006033 | 3300046525 | Bacteria | 3352 |
| 249 | Ga0495642_0157571 | 3300046528 | Bacteria | 984 |
| 250 | Ga0495598_0001445 | 3300046537 | Bacteria | 4708 |
| 251 | Ga0495621_0006529 | 3300046539 | Bacteria | 3411 |
| 252 | Ga0495633_0062564 | 3300046558 | Bacteria | 1742 |
| 253 | Ga0495625_0259481 | 3300046660 | Bacteria | 1125 |
| 254 | Ga0495669_0011969 | 3300046684 | Bacteria | 3688 |
| 255 | Ga0495669_0012596 | 3300046684 | Unclassified | 3602 |
| 256 | Ga0495669_0013226 | 3300046684 | Bacteria | 3515 |
| 257 | Ga0495669_0618940 | 3300046684 | Bacteria | 527 |
| 258 | Ga0495670_0627667 | 3300046691 | Bacteria | 585 |
| 259 | Ga0495687_095039 | 3300047443 | Bacteria | 1132 |
| 260 | Ga0495677_0013471 | 3300047445 | Bacteria | 2977 |
| 261 | Ga0495677_0015055 | 3300047445 | Bacteria | 2811 |
| 262 | Ga0495685_074146 | 3300047447 | Bacteria | 1138 |
| 263 | Ga0496107_0030540 | 3300048910 | Bacteria | 3841 |
| 264 | Ga0496107_0418940 | 3300048910 | Bacteria | 996 |
| 265 | Ga0496109_0072363 | 3300048912 | Unclassified | 3167 |
| 266 | Ga0496109_0266225 | 3300048912 | Bacteria | 1615 |
| 267 | Ga0496110_0215501 | 3300048913 | Unclassified | 1746 |
| 268 | Ga0496114_0321229 | 3300048917 | Unclassified | 1368 |
| 269 | Ga0501075_0195241 | 3300049591 | Bacteria | 1544 |
| 270 | Ga0501077_0136442 | 3300049593 | Bacteria | 1556 |
| 271 | nmdc:mga0k408_290419_c1 | 3300050493 | Bacteria | 976 |
| 272 | nmdc:mga0k408_373651_c1 | 3300050493 | Bacteria | 849 |
| 273 | Ga0501084_0700493 | 3300054114 | Bacteria | 854 |
| 274 | Ga0501082_1856869 | 3300060353 | Bacteria | 525 |
| 275 | Ga0466962_0510525 | 3300061719 | Bacteria | 609 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10674837 | Ga0070658_106748372 | 82 |
| 2 | 3300005337 | Ga0070682_100594387 | Ga0070682_1005943872 | 82 |
| 3 | 3300005436 | Ga0070713_100857183 | Ga0070713_1008571832 | 82 |
| 4 | 3300005455 | Ga0070663_100088930 | Ga0070663_1000889304 | 82 |
| 5 | 3300005458 | Ga0070681_11404162 | Ga0070681_114041622 | 82 |
| 6 | 3300005543 | Ga0070672_100045048 | Ga0070672_1000450482 | 82 |
| 7 | 3300005618 | Ga0068864_100901576 | Ga0068864_1009015762 | 82 |
| 8 | 3300011119 | Ga0105246_10086339 | Ga0105246_100863392 | 82 |
| 9 | 3300013102 | Ga0157371_10062001 | Ga0157371_100620012 | 82 |
| 10 | 3300025909 | Ga0207705_10198309 | Ga0207705_101983092 | 82 |
| 11 | 3300025926 | Ga0207659_10075124 | Ga0207659_100751244 | 82 |
| 12 | 3300025931 | Ga0207644_10303138 | Ga0207644_103031381 | 82 |
| 13 | 3300026121 | Ga0207683_11796757 | Ga0207683_117967571 | 82 |
| 14 | 3300037471 | Ga0395905_0237772 | Ga0395905_0237772_1442_1690 | 82 |
| 15 | 3300046684 | Ga0495669_0618940 | Ga0495669_0618940_123_371 | 82 |
| 16 | 3300046691 | Ga0495670_0627667 | Ga0495670_0627667_28_276 | 82 |
| 17 | 3300047443 | Ga0495687_095039 | Ga0495687_095039_20_268 | 82 |
| 18 | 3300048912 | Ga0496109_0266225 | Ga0496109_0266225_1346_1594 | 82 |
| 19 | 3300005327 | Ga0070658_10029453 | Ga0070658_100294531 | 83 |
| 20 | 3300005327 | Ga0070658_10297203 | Ga0070658_102972032 | 83 |
| 21 | 3300005334 | Ga0068869_100883750 | Ga0068869_1008837501 | 83 |
| 22 | 3300005344 | Ga0070661_100122099 | Ga0070661_1001220994 | 83 |
| 23 | 3300005436 | Ga0070713_100312456 | Ga0070713_1003124562 | 83 |
| 24 | 3300005539 | Ga0068853_100054647 | Ga0068853_1000546472 | 83 |
| 25 | 3300005564 | Ga0070664_100464922 | Ga0070664_1004649223 | 83 |
| 26 | 3300005616 | Ga0068852_102152073 | Ga0068852_1021520732 | 83 |
| 27 | 3300009093 | Ga0105240_10443824 | Ga0105240_104438242 | 83 |
| 28 | 3300009545 | Ga0105237_10124924 | Ga0105237_101249245 | 83 |
| 29 | 3300010375 | Ga0105239_11868061 | Ga0105239_118680612 | 83 |
| 30 | 3300013100 | Ga0157373_10038247 | Ga0157373_100382474 | 83 |
| 31 | 3300013100 | Ga0157373_10588428 | Ga0157373_105884282 | 83 |
| 32 | 3300013104 | Ga0157370_10972533 | Ga0157370_109725331 | 83 |
| 33 | 3300013105 | Ga0157369_11714584 | Ga0157369_117145842 | 83 |
| 34 | 3300013307 | Ga0157372_10251000 | Ga0157372_102510003 | 83 |
| 35 | 3300025321 | Ga0207656_10546005 | Ga0207656_105460052 | 83 |
| 36 | 3300025907 | Ga0207645_10021744 | Ga0207645_100217442 | 83 |
| 37 | 3300025909 | Ga0207705_10284398 | Ga0207705_102843983 | 83 |
| 38 | 3300025913 | Ga0207695_10634184 | Ga0207695_106341842 | 83 |
| 39 | 3300025927 | Ga0207687_10803455 | Ga0207687_108034552 | 83 |
| 40 | 3300025928 | Ga0207700_10259242 | Ga0207700_102592423 | 83 |
| 41 | 3300025949 | Ga0207667_10257361 | Ga0207667_102573612 | 83 |
| 42 | 3300026023 | Ga0207677_10099400 | Ga0207677_100994003 | 83 |
| 43 | 3300026067 | Ga0207678_10659838 | Ga0207678_106598381 | 83 |
| 44 | 3300031731 | Ga0307405_11785644 | Ga0307405_117856442 | 83 |
| 45 | 3300031903 | Ga0307407_10235222 | Ga0307407_102352222 | 83 |
| 46 | 3300032002 | Ga0307416_102239481 | Ga0307416_1022394812 | 83 |
| 47 | 3300037312 | Ga0395899_0129664 | Ga0395899_0129664_1517_1768 | 83 |
| 48 | 3300037312 | Ga0395899_0572412 | Ga0395899_0572412_456_707 | 83 |
| 49 | 3300037312 | Ga0395899_0747302 | Ga0395899_0747302_133_390 | 83 |
| 50 | 3300037418 | Ga0395900_0052316 | Ga0395900_0052316_417_668 | 83 |
| 51 | 3300037418 | Ga0395900_0148263 | Ga0395900_0148263_997_1248 | 83 |
| 52 | 3300037418 | Ga0395900_0835274 | Ga0395900_0835274_68_319 | 83 |
| 53 | 3300037466 | Ga0395898_0584232 | Ga0395898_0584232_558_809 | 83 |
| 54 | 3300037466 | Ga0395898_0681126 | Ga0395898_0681126_216_467 | 83 |
| 55 | 3300037471 | Ga0395905_0567991 | Ga0395905_0567991_754_1005 | 83 |
| 56 | 3300037471 | Ga0395905_0749990 | Ga0395905_0749990_560_811 | 83 |
| 57 | 3300044684 | Ga0466966_0251515 | Ga0466966_0251515_267_518 | 83 |
| 58 | 3300044694 | Ga0466963_0014070 | Ga0466963_0014070_2442_2693 | 83 |
| 59 | 3300044694 | Ga0466963_0709839 | Ga0466963_0709839_61_318 | 83 |
| 60 | 3300044901 | Ga0466960_0507003 | Ga0466960_0507003_29_307 | 83 |
| 61 | 3300045049 | Ga0466959_0049790 | Ga0466959_0049790_1527_1778 | 83 |
| 62 | 3300045049 | Ga0466959_0521048 | Ga0466959_0521048_54_305 | 83 |
| 63 | 3300045976 | Ga0466967_2511431 | Ga0466967_2511431_92_343 | 83 |
| 64 | 3300046660 | Ga0495625_0259481 | Ga0495625_0259481_848_1102 | 83 |
| 65 | 3300061719 | Ga0466962_0510525 | Ga0466962_0510525_158_409 | 83 |
| 66 | 3300049591 | Ga0501075_0195241 | Ga0501075_0195241_1039_1305 | 88 |
| 67 | 3300049593 | Ga0501077_0136442 | Ga0501077_0136442_776_1042 | 88 |
| 68 | 3300054114 | Ga0501084_0700493 | Ga0501084_0700493_339_605 | 88 |
| 69 | 3300060353 | Ga0501082_1856869 | Ga0501082_1856869_147_413 | 88 |
| 70 | 3300006871 | Ga0075434_100735259 | Ga0075434_1007352592 | 89 |
| 71 | 3300035410 | Ga0373924_0392610 | Ga0373924_0392610_15_299 | 89 |
| 72 | 3300025936 | Ga0207670_10533313 | Ga0207670_105333131 | 92 |
| 73 | 3300026142 | Ga0207698_11298329 | Ga0207698_112983292 | 92 |
| 74 | 3300005339 | Ga0070660_100008386 | Ga0070660_1000083866 | 93 |
| 75 | 3300005455 | Ga0070663_101027330 | Ga0070663_1010273302 | 93 |
| 76 | 3300005564 | Ga0070664_100628838 | Ga0070664_1006288382 | 93 |
| 77 | 3300020081 | Ga0206354_11140010 | Ga0206354_111400102 | 93 |
| 78 | 3300025893 | Ga0207682_10132835 | Ga0207682_101328352 | 93 |
| 79 | 3300025909 | Ga0207705_10080708 | Ga0207705_100807082 | 93 |
| 80 | 3300025919 | Ga0207657_10001331 | Ga0207657_1000133126 | 93 |
| 81 | 3300025932 | Ga0207690_10206881 | Ga0207690_102068812 | 93 |
| 82 | 3300026041 | Ga0207639_10737416 | Ga0207639_107374162 | 93 |
| 83 | 3300026067 | Ga0207678_10048543 | Ga0207678_100485433 | 93 |
| 84 | 3300005290 | Ga0065712_10415715 | Ga0065712_104157151 | 94 |
| 85 | 3300005327 | Ga0070658_10014808 | Ga0070658_100148081 | 94 |
| 86 | 3300005327 | Ga0070658_10050965 | Ga0070658_100509653 | 94 |
| 87 | 3300005338 | Ga0068868_100270907 | Ga0068868_1002709073 | 94 |
| 88 | 3300005344 | Ga0070661_100068373 | Ga0070661_1000683733 | 94 |
| 89 | 3300005344 | Ga0070661_100156281 | Ga0070661_1001562814 | 94 |
| 90 | 3300005353 | Ga0070669_100297665 | Ga0070669_1002976652 | 94 |
| 91 | 3300005354 | Ga0070675_100047934 | Ga0070675_1000479342 | 94 |
| 92 | 3300005355 | Ga0070671_100343727 | Ga0070671_1003437271 | 94 |
| 93 | 3300005366 | Ga0070659_100446342 | Ga0070659_1004463423 | 94 |
| 94 | 3300005458 | Ga0070681_10115276 | Ga0070681_101152764 | 94 |
| 95 | 3300005543 | Ga0070672_100030442 | Ga0070672_1000304424 | 94 |
| 96 | 3300005544 | Ga0070686_100181186 | Ga0070686_1001811862 | 94 |
| 97 | 3300005547 | Ga0070693_101158030 | Ga0070693_1011580301 | 94 |
| 98 | 3300005563 | Ga0068855_100202022 | Ga0068855_1002020223 | 94 |
| 99 | 3300005577 | Ga0068857_100864132 | Ga0068857_1008641322 | 94 |
| 100 | 3300005616 | Ga0068852_100012940 | Ga0068852_1000129403 | 94 |
| 101 | 3300005834 | Ga0068851_10934452 | Ga0068851_109344522 | 94 |
| 102 | 3300005841 | Ga0068863_100004532 | Ga0068863_10000453215 | 94 |
| 103 | 3300005841 | Ga0068863_101542038 | Ga0068863_1015420382 | 94 |
| 104 | 3300006173 | Ga0070716_100334925 | Ga0070716_1003349252 | 94 |
| 105 | 3300006881 | Ga0068865_100150441 | Ga0068865_1001504413 | 94 |
| 106 | 3300009177 | Ga0105248_10175120 | Ga0105248_101751202 | 94 |
| 107 | 3300009551 | Ga0105238_10052960 | Ga0105238_100529604 | 94 |
| 108 | 3300009551 | Ga0105238_12149903 | Ga0105238_121499031 | 94 |
| 109 | 3300010375 | Ga0105239_11271492 | Ga0105239_112714922 | 94 |
| 110 | 3300011119 | Ga0105246_10219001 | Ga0105246_102190012 | 94 |
| 111 | 3300013100 | Ga0157373_10045910 | Ga0157373_100459104 | 94 |
| 112 | 3300013102 | Ga0157371_10327060 | Ga0157371_103270602 | 94 |
| 113 | 3300013102 | Ga0157371_10714977 | Ga0157371_107149772 | 94 |
| 114 | 3300013104 | Ga0157370_10036715 | Ga0157370_100367152 | 94 |
| 115 | 3300013308 | Ga0157375_10270351 | Ga0157375_102703512 | 94 |
| 116 | 3300021388 | Ga0213875_10028084 | Ga0213875_100280842 | 94 |
| 117 | 3300025321 | Ga0207656_10531033 | Ga0207656_105310332 | 94 |
| 118 | 3300025903 | Ga0207680_10102510 | Ga0207680_101025102 | 94 |
| 119 | 3300025909 | Ga0207705_10477380 | Ga0207705_104773802 | 94 |
| 120 | 3300025912 | Ga0207707_10607767 | Ga0207707_106077672 | 94 |
| 121 | 3300025915 | Ga0207693_10025496 | Ga0207693_100254967 | 94 |
| 122 | 3300025920 | Ga0207649_10073556 | Ga0207649_100735563 | 94 |
| 123 | 3300025920 | Ga0207649_10780096 | Ga0207649_107800962 | 94 |
| 124 | 3300025924 | Ga0207694_10291753 | Ga0207694_102917532 | 94 |
| 125 | 3300025928 | Ga0207700_10182828 | Ga0207700_101828282 | 94 |
| 126 | 3300025938 | Ga0207704_10185023 | Ga0207704_101850231 | 94 |
| 127 | 3300025939 | Ga0207665_10057146 | Ga0207665_100571462 | 94 |
| 128 | 3300025940 | Ga0207691_10006922 | Ga0207691_100069227 | 94 |
| 129 | 3300025941 | Ga0207711_10116099 | Ga0207711_101160992 | 94 |
| 130 | 3300025949 | Ga0207667_10624771 | Ga0207667_106247712 | 94 |
| 131 | 3300026035 | Ga0207703_11220906 | Ga0207703_112209061 | 94 |
| 132 | 3300026078 | Ga0207702_11439589 | Ga0207702_114395892 | 94 |
| 133 | 3300026088 | Ga0207641_10015935 | Ga0207641_100159354 | 94 |
| 134 | 3300026088 | Ga0207641_11041223 | Ga0207641_110412232 | 94 |
| 135 | 3300026089 | Ga0207648_10101502 | Ga0207648_101015024 | 94 |
| 136 | 3300026095 | Ga0207676_11849675 | Ga0207676_118496752 | 94 |
| 137 | 3300026116 | Ga0207674_10346342 | Ga0207674_103463422 | 94 |
| 138 | 3300026142 | Ga0207698_10006895 | Ga0207698_100068958 | 94 |
| 139 | 3300031903 | Ga0307407_11095995 | Ga0307407_110959952 | 94 |
| 140 | 3300031995 | Ga0307409_100451671 | Ga0307409_1004516712 | 94 |
| 141 | 3300031995 | Ga0307409_100647012 | Ga0307409_1006470122 | 94 |
| 142 | 3300031995 | Ga0307409_101244583 | Ga0307409_1012445832 | 94 |
| 143 | 3300032004 | Ga0307414_10020386 | Ga0307414_100203863 | 94 |
| 144 | 3300032005 | Ga0307411_10588312 | Ga0307411_105883122 | 94 |
| 145 | 3300037312 | Ga0395899_0060159 | Ga0395899_0060159_109_393 | 94 |
| 146 | 3300037312 | Ga0395899_0082662 | Ga0395899_0082662_397_681 | 94 |
| 147 | 3300037312 | Ga0395899_0125977 | Ga0395899_0125977_1213_1497 | 94 |
| 148 | 3300037312 | Ga0395899_0190353 | Ga0395899_0190353_1010_1294 | 94 |
| 149 | 3300037312 | Ga0395899_0465480 | Ga0395899_0465480_397_681 | 94 |
| 150 | 3300037418 | Ga0395900_0035979 | Ga0395900_0035979_4455_4739 | 94 |
| 151 | 3300037418 | Ga0395900_0047163 | Ga0395900_0047163_276_560 | 94 |
| 152 | 3300037418 | Ga0395900_0070159 | Ga0395900_0070159_982_1266 | 94 |
| 153 | 3300037418 | Ga0395900_0115232 | Ga0395900_0115232_2378_2662 | 94 |
| 154 | 3300037418 | Ga0395900_0233923 | Ga0395900_0233923_839_1123 | 94 |
| 155 | 3300037418 | Ga0395900_0702889 | Ga0395900_0702889_530_814 | 94 |
| 156 | 3300037418 | Ga0395900_0941565 | Ga0395900_0941565_34_318 | 94 |
| 157 | 3300037466 | Ga0395898_0083531 | Ga0395898_0083531_493_777 | 94 |
| 158 | 3300037466 | Ga0395898_0735591 | Ga0395898_0735591_581_865 | 94 |
| 159 | 3300037471 | Ga0395905_0000187 | Ga0395905_0000187_37829_38113 | 94 |
| 160 | 3300037471 | Ga0395905_0086921 | Ga0395905_0086921_2484_2768 | 94 |
| 161 | 3300037471 | Ga0395905_0092499 | Ga0395905_0092499_2048_2332 | 94 |
| 162 | 3300037471 | Ga0395905_0093297 | Ga0395905_0093297_1612_1896 | 94 |
| 163 | 3300037471 | Ga0395905_0202930 | Ga0395905_0202930_101_385 | 94 |
| 164 | 3300037471 | Ga0395905_0289923 | Ga0395905_0289923_857_1141 | 94 |
| 165 | 3300037471 | Ga0395905_0374582 | Ga0395905_0374582_999_1283 | 94 |
| 166 | 3300037471 | Ga0395905_0741535 | Ga0395905_0741535_132_416 | 94 |
| 167 | 3300037471 | Ga0395905_0964762 | Ga0395905_0964762_331_615 | 94 |
| 168 | 3300037853 | Ga0436364_0030565 | Ga0436364_0030565_736_1044 | 94 |
| 169 | 3300038443 | Ga0395901_0046370 | Ga0395901_0046370_1925_2209 | 94 |
| 170 | 3300038443 | Ga0395901_0079691 | Ga0395901_0079691_1180_1464 | 94 |
| 171 | 3300038443 | Ga0395901_0306836 | Ga0395901_0306836_1020_1304 | 94 |
| 172 | 3300038443 | Ga0395901_0870888 | Ga0395901_0870888_469_753 | 94 |
| 173 | 3300038443 | Ga0395901_0960768 | Ga0395901_0960768_408_692 | 94 |
| 174 | 3300038443 | Ga0395901_1216318 | Ga0395901_1216318_403_687 | 94 |
| 175 | 3300044658 | Ga0466972_0102614 | Ga0466972_0102614_430_714 | 94 |
| 176 | 3300044684 | Ga0466966_0233315 | Ga0466966_0233315_597_881 | 94 |
| 177 | 3300044901 | Ga0466960_0096813 | Ga0466960_0096813_566_850 | 94 |
| 178 | 3300045976 | Ga0466967_1488060 | Ga0466967_1488060_332_616 | 94 |
| 179 | 3300046518 | Ga0495631_0298179 | Ga0495631_0298179_253_537 | 94 |
| 180 | 3300046525 | Ga0495663_0002468 | Ga0495663_0002468_1391_1675 | 94 |
| 181 | 3300046537 | Ga0495598_0001445 | Ga0495598_0001445_3041_3325 | 94 |
| 182 | 3300046539 | Ga0495621_0006529 | Ga0495621_0006529_514_798 | 94 |
| 183 | 3300046558 | Ga0495633_0062564 | Ga0495633_0062564_1391_1675 | 94 |
| 184 | 3300046684 | Ga0495669_0012596 | Ga0495669_0012596_222_506 | 94 |
| 185 | 3300046684 | Ga0495669_0013226 | Ga0495669_0013226_1202_1486 | 94 |
| 186 | 3300047445 | Ga0495677_0015055 | Ga0495677_0015055_2296_2580 | 94 |
| 187 | 3300047447 | Ga0495685_074146 | Ga0495685_074146_717_1001 | 94 |
| 188 | 3300048910 | Ga0496107_0030540 | Ga0496107_0030540_309_593 | 94 |
| 189 | 3300048910 | Ga0496107_0418940 | Ga0496107_0418940_516_800 | 94 |
| 190 | 3300048912 | Ga0496109_0072363 | Ga0496109_0072363_1396_1680 | 94 |
| 191 | 3300048913 | Ga0496110_0215501 | Ga0496110_0215501_1217_1501 | 94 |
| 192 | 3300048917 | Ga0496114_0321229 | Ga0496114_0321229_620_904 | 94 |
| 193 | 3300001990 | JGI24737J22298_10004367 | JGI24737J22298_100043678 | 95 |
| 194 | 3300001990 | JGI24737J22298_10023183 | JGI24737J22298_100231832 | 95 |
| 195 | 3300002067 | JGI24735J21928_10044683 | JGI24735J21928_100446833 | 95 |
| 196 | 3300005339 | Ga0070660_100408234 | Ga0070660_1004082342 | 95 |
| 197 | 3300005341 | Ga0070691_10384953 | Ga0070691_103849532 | 95 |
| 198 | 3300005344 | Ga0070661_100991027 | Ga0070661_1009910272 | 95 |
| 199 | 3300005353 | Ga0070669_100538430 | Ga0070669_1005384302 | 95 |
| 200 | 3300005366 | Ga0070659_100004168 | Ga0070659_1000041686 | 95 |
| 201 | 3300005366 | Ga0070659_101097388 | Ga0070659_1010973882 | 95 |
| 202 | 3300005435 | Ga0070714_100063953 | Ga0070714_1000639535 | 95 |
| 203 | 3300005435 | Ga0070714_100362869 | Ga0070714_1003628692 | 95 |
| 204 | 3300005435 | Ga0070714_101311915 | Ga0070714_1013119152 | 95 |
| 205 | 3300005436 | Ga0070713_101307384 | Ga0070713_1013073842 | 95 |
| 206 | 3300005535 | Ga0070684_100066457 | Ga0070684_1000664574 | 95 |
| 207 | 3300005539 | Ga0068853_100335957 | Ga0068853_1003359571 | 95 |
| 208 | 3300005548 | Ga0070665_100082886 | Ga0070665_1000828864 | 95 |
| 209 | 3300005577 | Ga0068857_100064127 | Ga0068857_1000641276 | 95 |
| 210 | 3300005618 | Ga0068864_100885491 | Ga0068864_1008854912 | 95 |
| 211 | 3300005841 | Ga0068863_100023410 | Ga0068863_1000234102 | 95 |
| 212 | 3300006195 | Ga0075366_10304034 | Ga0075366_103040342 | 95 |
| 213 | 3300009093 | Ga0105240_11731925 | Ga0105240_117319252 | 95 |
| 214 | 3300009551 | Ga0105238_11191701 | Ga0105238_111917012 | 95 |
| 215 | 3300011119 | Ga0105246_11712984 | Ga0105246_117129841 | 95 |
| 216 | 3300013297 | Ga0157378_10183627 | Ga0157378_101836272 | 95 |
| 217 | 3300013307 | Ga0157372_10642743 | Ga0157372_106427432 | 95 |
| 218 | 3300014325 | Ga0163163_10061314 | Ga0163163_100613144 | 95 |
| 219 | 3300014745 | Ga0157377_10329516 | Ga0157377_103295162 | 95 |
| 220 | 3300025919 | Ga0207657_10753858 | Ga0207657_107538582 | 95 |
| 221 | 3300025929 | Ga0207664_10040821 | Ga0207664_100408214 | 95 |
| 222 | 3300025929 | Ga0207664_10192661 | Ga0207664_101926613 | 95 |
| 223 | 3300025929 | Ga0207664_10249100 | Ga0207664_102491002 | 95 |
| 224 | 3300025932 | Ga0207690_10020330 | Ga0207690_100203305 | 95 |
| 225 | 3300025933 | Ga0207706_10065213 | Ga0207706_100652135 | 95 |
| 226 | 3300025944 | Ga0207661_10072414 | Ga0207661_100724143 | 95 |
| 227 | 3300025949 | Ga0207667_10040963 | Ga0207667_100409636 | 95 |
| 228 | 3300026041 | Ga0207639_10828586 | Ga0207639_108285862 | 95 |
| 229 | 3300026078 | Ga0207702_10395588 | Ga0207702_103955883 | 95 |
| 230 | 3300026116 | Ga0207674_10001210 | Ga0207674_100012105 | 95 |
| 231 | 3300028379 | Ga0268266_10367597 | Ga0268266_103675973 | 95 |
| 232 | 3300031824 | Ga0307413_10039367 | Ga0307413_100393675 | 95 |
| 233 | 3300031824 | Ga0307413_10068694 | Ga0307413_100686943 | 95 |
| 234 | 3300031824 | Ga0307413_11716724 | Ga0307413_117167241 | 95 |
| 235 | 3300031852 | Ga0307410_10032482 | Ga0307410_100324825 | 95 |
| 236 | 3300031852 | Ga0307410_10526931 | Ga0307410_105269312 | 95 |
| 237 | 3300031901 | Ga0307406_10121564 | Ga0307406_101215643 | 95 |
| 238 | 3300031903 | Ga0307407_10022319 | Ga0307407_100223193 | 95 |
| 239 | 3300031903 | Ga0307407_10232175 | Ga0307407_102321752 | 95 |
| 240 | 3300031911 | Ga0307412_10170308 | Ga0307412_101703082 | 95 |
| 241 | 3300031911 | Ga0307412_10515554 | Ga0307412_105155542 | 95 |
| 242 | 3300031995 | Ga0307409_100035249 | Ga0307409_1000352492 | 95 |
| 243 | 3300031995 | Ga0307409_100123383 | Ga0307409_1001233833 | 95 |
| 244 | 3300032002 | Ga0307416_100192425 | Ga0307416_1001924253 | 95 |
| 245 | 3300032002 | Ga0307416_100887396 | Ga0307416_1008873962 | 95 |
| 246 | 3300032004 | Ga0307414_10024392 | Ga0307414_100243924 | 95 |
| 247 | 3300032004 | Ga0307414_10063804 | Ga0307414_100638043 | 95 |
| 248 | 3300032004 | Ga0307414_10523606 | Ga0307414_105236062 | 95 |
| 249 | 3300032005 | Ga0307411_10011718 | Ga0307411_100117182 | 95 |
| 250 | 3300032005 | Ga0307411_10074609 | Ga0307411_100746092 | 95 |
| 251 | 3300032005 | Ga0307411_10109865 | Ga0307411_101098653 | 95 |
| 252 | 3300032005 | Ga0307411_10138748 | Ga0307411_101387483 | 95 |
| 253 | 3300032126 | Ga0307415_100014111 | Ga0307415_1000141117 | 95 |
| 254 | 3300032126 | Ga0307415_100159083 | Ga0307415_1001590833 | 95 |
| 255 | 3300032126 | Ga0307415_100315783 | Ga0307415_1003157832 | 95 |
| 256 | 3300037471 | Ga0395905_0736003 | Ga0395905_0736003_251_538 | 95 |
| 257 | 3300037471 | Ga0395905_0917688 | Ga0395905_0917688_132_419 | 95 |
| 258 | 3300038443 | Ga0395901_0778562 | Ga0395901_0778562_144_431 | 95 |
| 259 | 3300041463 | Ga0451804_0681598 | Ga0451804_0681598_48_338 | 95 |
| 260 | 3300041486 | Ga0451807_0650239 | Ga0451807_0650239_65_352 | 95 |
| 261 | 3300042012 | Ga0439455_0011708 | Ga0439455_0011708_816_1103 | 95 |
| 262 | 3300042012 | Ga0439455_0077726 | Ga0439455_0077726_564_851 | 95 |
| 263 | 3300042157 | Ga0439458_0000009 | Ga0439458_0000009_13128_13415 | 95 |
| 264 | 3300044658 | Ga0466972_0444140 | Ga0466972_0444140_215_502 | 95 |
| 265 | 3300044684 | Ga0466966_0940807 | Ga0466966_0940807_102_389 | 95 |
| 266 | 3300044694 | Ga0466963_0115871 | Ga0466963_0115871_591_884 | 95 |
| 267 | 3300044842 | Ga0466957_0333555 | Ga0466957_0333555_364_651 | 95 |
| 268 | 3300045976 | Ga0466967_0332142 | Ga0466967_0332142_290_583 | 95 |
| 269 | 3300046522 | Ga0495643_0261294 | Ga0495643_0261294_481_768 | 95 |
| 270 | 3300046525 | Ga0495663_0006033 | Ga0495663_0006033_1585_1872 | 95 |
| 271 | 3300046528 | Ga0495642_0157571 | Ga0495642_0157571_352_639 | 95 |
| 272 | 3300046684 | Ga0495669_0011969 | Ga0495669_0011969_499_786 | 95 |
| 273 | 3300047445 | Ga0495677_0013471 | Ga0495677_0013471_2241_2528 | 95 |
| 274 | 3300050493 | nmdc:mga0k408_290419_c1 | nmdc:mga0k408_290419_c1_232_519 | 95 |
| 275 | 3300050493 | nmdc:mga0k408_373651_c1 | nmdc:mga0k408_373651_c1_140_427 | 95 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4pui-assembly2.cif.gz_B | bola domain of sufe1 from arabidopsis thaliana | 0.9466 | 7 | 92 |
| 4pui-assembly1.cif.gz_A | bola domain of sufe1 from arabidopsis thaliana | 0.9367 | 7 | 92 |
| 4pug-assembly2.cif.gz_B | bola1 from arabidopsis thaliana | 0.9301 | 9 | 95 |
| 3o2e-assembly1.cif.gz_A | crystal structure of a bol-like protein from babesia bovis | 0.9048 | 11 | 93 |
| 4pui-assembly2.cif.gz_B | bola domain of sufe1 from arabidopsis thaliana | 0.8837 | 7 | 92 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q3E793_13_109_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.933 | 11 | 94 | 3.30.300.90 |
| af_P91375_6_86_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.931 | 7 | 89 | 3.30.300.90 |
| 4puiA01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.9306 | 11 | 92 | 3.30.300.90 |
| af_Q682I1_66_160_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.928 | 11 | 95 | 3.30.300.90 |
| af_Q54G84_40_127_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.9266 | 8 | 95 | 3.30.300.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A397NKG3-F1-model_v4 | BolA protein | 0.9925 | 6 | 95 |
GO:0016226
|
| AF-A0A219B325-F1-model_v4 | BolA family transcriptional regulator | 0.992 | 7 | 92 |
GO:0016226
|
| AF-A0A1H9V232-F1-model_v4 | BolA protein | 0.9908 | 9 | 91 |
GO:0016226
|
| AF-A0A0Q5R8Z7-F1-model_v4 | BolA family transcriptional regulator | 0.9888 | 8 | 94 |
GO:0016226
|
| AF-A0A3D5NCL4-F1-model_v4 | BolA family transcriptional regulator | 0.9869 | 9 | 94 |
GO:0016226
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar