F380354

General Info

Members Datasets Scaffolds Average Seq Length
275 141 275 92

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100735259|Ga0075434_1007352592
Length 89
Sequence MTVAEAIRAKLDQAFAPAALDIVDESHLHAGHAGHRPGISTHFRVAIVSSAFAGKARVERQRMIYAALDELMGKPIHALALSAKAPGER

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
109 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
110 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
111 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
121 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
122 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
123 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
124 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
125 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
130 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
131 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.09
Nodule 0
Rhizoplane 2.91
Rhizosphere 95.27
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10004367 3300001990 Bacteria 4933
2 JGI24737J22298_10023183 3300001990 Bacteria 1970
3 JGI24735J21928_10044683 3300002067 Bacteria 1287
4 Ga0065712_10415715 3300005290 Unclassified 717
5 Ga0070658_10014808 3300005327 Bacteria 6249
6 Ga0070658_10029453 3300005327 Bacteria 4410
7 Ga0070658_10050965 3300005327 Unclassified 3355
8 Ga0070658_10297203 3300005327 Bacteria 1376
9 Ga0070658_10674837 3300005327 Bacteria 897
10 Ga0068869_100883750 3300005334 Bacteria 772
11 Ga0070682_100594387 3300005337 Bacteria 873
12 Ga0068868_100270907 3300005338 Unclassified 1434
13 Ga0070660_100008386 3300005339 Bacteria 7224
14 Ga0070660_100408234 3300005339 Bacteria 1124
15 Ga0070691_10384953 3300005341 Bacteria 787
16 Ga0070661_100068373 3300005344 Bacteria 2610
17 Ga0070661_100122099 3300005344 Bacteria 1952
18 Ga0070661_100156281 3300005344 Bacteria 1725
19 Ga0070661_100991027 3300005344 Bacteria 697
20 Ga0070669_100297665 3300005353 Bacteria 1297
21 Ga0070669_100538430 3300005353 Bacteria 972
22 Ga0070675_100047934 3300005354 Unclassified 3503
23 Ga0070671_100343727 3300005355 Bacteria 1273
24 Ga0070659_100004168 3300005366 Bacteria 10307
25 Ga0070659_100446342 3300005366 Bacteria 1097
26 Ga0070659_101097388 3300005366 Bacteria 701
27 Ga0070714_100063953 3300005435 Bacteria 3165
28 Ga0070714_100362869 3300005435 Bacteria 1362
29 Ga0070714_101311915 3300005435 Bacteria 706
30 Ga0070713_100312456 3300005436 Bacteria 1449
31 Ga0070713_100857183 3300005436 Bacteria 872
32 Ga0070713_101307384 3300005436 Bacteria 703
33 Ga0070663_100088930 3300005455 Bacteria 2285
34 Ga0070663_101027330 3300005455 Bacteria 718
35 Ga0070681_10115276 3300005458 Bacteria 2625
36 Ga0070681_11404162 3300005458 Bacteria 622
37 Ga0070684_100066457 3300005535 Bacteria 3165
38 Ga0068853_100054647 3300005539 Bacteria 3442
39 Ga0068853_100335957 3300005539 Bacteria 1403
40 Ga0070672_100030442 3300005543 Bacteria 4054
41 Ga0070672_100045048 3300005543 Bacteria 3410
42 Ga0070686_100181186 3300005544 Unclassified 1497
43 Ga0070693_101158030 3300005547 Unclassified 592
44 Ga0070665_100082886 3300005548 Bacteria 3212
45 Ga0068855_100202022 3300005563 Bacteria 2237
46 Ga0070664_100464922 3300005564 Bacteria 1163
47 Ga0070664_100628838 3300005564 Bacteria 997
48 Ga0068857_100064127 3300005577 Bacteria 3266
49 Ga0068857_100864132 3300005577 Bacteria 866
50 Ga0068852_100012940 3300005616 Bacteria 6363
51 Ga0068852_102152073 3300005616 Unclassified 579
52 Ga0068864_100885491 3300005618 Bacteria 881
53 Ga0068864_100901576 3300005618 Unclassified 873
54 Ga0068851_10934452 3300005834 Bacteria 545
55 Ga0068863_100004532 3300005841 Bacteria 13698
56 Ga0068863_100023410 3300005841 Bacteria 5899
57 Ga0068863_101542038 3300005841 Unclassified 673
58 Ga0070716_100334925 3300006173 Bacteria 1065
59 Ga0075366_10304034 3300006195 Bacteria 976
60 Ga0075434_100735259 3300006871 Bacteria 1004
61 Ga0068865_100150441 3300006881 Bacteria 1765
62 Ga0105240_10443824 3300009093 Bacteria 1453
63 Ga0105240_11731925 3300009093 Bacteria 652
64 Ga0105248_10175120 3300009177 Bacteria 2418
65 Ga0105237_10124924 3300009545 Bacteria 2567
66 Ga0105238_10052960 3300009551 Bacteria 4079
67 Ga0105238_11191701 3300009551 Bacteria 786
68 Ga0105238_12149903 3300009551 Bacteria 593
69 Ga0105239_11271492 3300010375 Unclassified 849
70 Ga0105239_11868061 3300010375 Unclassified 696
71 Ga0105246_10086339 3300011119 Unclassified 2249
72 Ga0105246_10219001 3300011119 Unclassified 1491
73 Ga0105246_11712984 3300011119 Unclassified 598
74 Ga0157373_10038247 3300013100 Bacteria 3440
75 Ga0157373_10045910 3300013100 Bacteria 3118
76 Ga0157373_10588428 3300013100 Unclassified 809
77 Ga0157371_10062001 3300013102 Bacteria 2651
78 Ga0157371_10327060 3300013102 Unclassified 1113
79 Ga0157371_10714977 3300013102 Bacteria 751
80 Ga0157370_10036715 3300013104 Bacteria 4754
81 Ga0157370_10972533 3300013104 Bacteria 769
82 Ga0157369_11714584 3300013105 Unclassified 638
83 Ga0157378_10183627 3300013297 Unclassified 1969
84 Ga0157372_10251000 3300013307 Bacteria 2054
85 Ga0157372_10642743 3300013307 Bacteria 1236
86 Ga0157375_10270351 3300013308 Unclassified 1862
87 Ga0163163_10061314 3300014325 Bacteria 3726
88 Ga0157377_10329516 3300014745 Bacteria 1017
89 Ga0206354_11140010 3300020081 Bacteria 660
90 Ga0213875_10028084 3300021388 Bacteria 2675
91 Ga0207656_10531033 3300025321 Bacteria 598
92 Ga0207656_10546005 3300025321 Unclassified 590
93 Ga0207682_10132835 3300025893 Bacteria 1112
94 Ga0207680_10102510 3300025903 Unclassified 1841
95 Ga0207645_10021744 3300025907 Bacteria 4179
96 Ga0207705_10080708 3300025909 Bacteria 2370
97 Ga0207705_10198309 3300025909 Bacteria 1520
98 Ga0207705_10284398 3300025909 Bacteria 1266
99 Ga0207705_10477380 3300025909 Unclassified 968
100 Ga0207707_10607767 3300025912 Bacteria 925
101 Ga0207695_10634184 3300025913 Bacteria 950
102 Ga0207693_10025496 3300025915 Bacteria 4687
103 Ga0207657_10001331 3300025919 Bacteria 26231
104 Ga0207657_10753858 3300025919 Unclassified 754
105 Ga0207649_10073556 3300025920 Bacteria 2190
106 Ga0207649_10780096 3300025920 Bacteria 745
107 Ga0207694_10291753 3300025924 Bacteria 1341
108 Ga0207659_10075124 3300025926 Bacteria 2479
109 Ga0207687_10803455 3300025927 Bacteria 802
110 Ga0207700_10182828 3300025928 Bacteria 1757
111 Ga0207700_10259242 3300025928 Bacteria 1488
112 Ga0207664_10040821 3300025929 Bacteria 3611
113 Ga0207664_10192661 3300025929 Bacteria 1755
114 Ga0207664_10249100 3300025929 Bacteria 1550
115 Ga0207644_10303138 3300025931 Bacteria 1288
116 Ga0207690_10020330 3300025932 Bacteria 4101
117 Ga0207690_10206881 3300025932 Bacteria 1494
118 Ga0207706_10065213 3300025933 Bacteria 3206
119 Ga0207670_10533313 3300025936 Bacteria 957
120 Ga0207704_10185023 3300025938 Unclassified 1509
121 Ga0207665_10057146 3300025939 Bacteria 2635
122 Ga0207691_10006922 3300025940 Bacteria 10935
123 Ga0207711_10116099 3300025941 Bacteria 2386
124 Ga0207661_10072414 3300025944 Bacteria 2819
125 Ga0207667_10040963 3300025949 Bacteria 4929
126 Ga0207667_10257361 3300025949 Bacteria 1785
127 Ga0207667_10624771 3300025949 Bacteria 1085
128 Ga0207677_10099400 3300026023 Bacteria 2136
129 Ga0207703_11220906 3300026035 Unclassified 723
130 Ga0207639_10737416 3300026041 Bacteria 915
131 Ga0207639_10828586 3300026041 Bacteria 863
132 Ga0207678_10048543 3300026067 Bacteria 3669
133 Ga0207678_10659838 3300026067 Bacteria 919
134 Ga0207702_10395588 3300026078 Bacteria 1332
135 Ga0207702_11439589 3300026078 Unclassified 683
136 Ga0207641_10015935 3300026088 Bacteria 6154
137 Ga0207641_11041223 3300026088 Bacteria 816
138 Ga0207648_10101502 3300026089 Bacteria 2521
139 Ga0207676_11849675 3300026095 Unclassified 602
140 Ga0207674_10001210 3300026116 Bacteria 33627
141 Ga0207674_10346342 3300026116 Bacteria 1437
142 Ga0207683_11796757 3300026121 Bacteria 562
143 Ga0207698_10006895 3300026142 Bacteria 7107
144 Ga0207698_11298329 3300026142 Bacteria 742
145 Ga0268266_10367597 3300028379 Bacteria 1354
146 Ga0307405_11785644 3300031731 Bacteria 546
147 Ga0307413_10039367 3300031824 Bacteria 2749
148 Ga0307413_10068694 3300031824 Bacteria 2220
149 Ga0307413_11716724 3300031824 Bacteria 560
150 Ga0307410_10032482 3300031852 Bacteria 3359
151 Ga0307410_10526931 3300031852 Bacteria 976
152 Ga0307406_10121564 3300031901 Bacteria 1816
153 Ga0307407_10022319 3300031903 Bacteria 3281
154 Ga0307407_10232175 3300031903 Bacteria 1253
155 Ga0307407_10235222 3300031903 Bacteria 1247
156 Ga0307407_11095995 3300031903 Bacteria 619
157 Ga0307412_10170308 3300031911 Bacteria 1627
158 Ga0307412_10515554 3300031911 Bacteria 998
159 Ga0307409_100035249 3300031995 Bacteria 3664
160 Ga0307409_100123383 3300031995 Bacteria 2198
161 Ga0307409_100451671 3300031995 Bacteria 1241
162 Ga0307409_100647012 3300031995 Bacteria 1050
163 Ga0307409_101244583 3300031995 Bacteria 768
164 Ga0307416_100192425 3300032002 Bacteria 1925
165 Ga0307416_100887396 3300032002 Bacteria 991
166 Ga0307416_102239481 3300032002 Bacteria 647
167 Ga0307414_10020386 3300032004 Bacteria 4132
168 Ga0307414_10024392 3300032004 Bacteria 3856
169 Ga0307414_10063804 3300032004 Bacteria 2620
170 Ga0307414_10523606 3300032004 Bacteria 1052
171 Ga0307411_10011718 3300032005 Bacteria 4748
172 Ga0307411_10074609 3300032005 Bacteria 2312
173 Ga0307411_10109865 3300032005 Bacteria 1970
174 Ga0307411_10138748 3300032005 Bacteria 1789
175 Ga0307411_10588312 3300032005 Bacteria 955
176 Ga0307415_100014111 3300032126 Bacteria 4685
177 Ga0307415_100159083 3300032126 Bacteria 1748
178 Ga0307415_100315783 3300032126 Bacteria 1301
179 Ga0373924_0392610 3300035410 Unclassified 620
180 Ga0395899_0060159 3300037312 Bacteria 2798
181 Ga0395899_0082662 3300037312 Bacteria 2335
182 Ga0395899_0125977 3300037312 Bacteria 1832
183 Ga0395899_0129664 3300037312 Bacteria 1801
184 Ga0395899_0190353 3300037312 Bacteria 1436
185 Ga0395899_0465480 3300037312 Unclassified 825
186 Ga0395899_0572412 3300037312 Bacteria 723
187 Ga0395899_0747302 3300037312 Unclassified 609
188 Ga0395900_0035979 3300037418 Bacteria 5102
189 Ga0395900_0047163 3300037418 Bacteria 4436
190 Ga0395900_0052316 3300037418 Bacteria 4204
191 Ga0395900_0070159 3300037418 Bacteria 3602
192 Ga0395900_0115232 3300037418 Bacteria 2758
193 Ga0395900_0148263 3300037418 Bacteria 2398
194 Ga0395900_0233923 3300037418 Bacteria 1846
195 Ga0395900_0702889 3300037418 Bacteria 944
196 Ga0395900_0835274 3300037418 Unclassified 847
197 Ga0395900_0941565 3300037418 Bacteria 786
198 Ga0395898_0083531 3300037466 Bacteria 3078
199 Ga0395898_0584232 3300037466 Bacteria 1059
200 Ga0395898_0681126 3300037466 Bacteria 970
201 Ga0395898_0735591 3300037466 Bacteria 928
202 Ga0395905_0000187 3300037471 Bacteria 98895
203 Ga0395905_0086921 3300037471 Bacteria 2931
204 Ga0395905_0092499 3300037471 Bacteria 2836
205 Ga0395905_0093297 3300037471 Bacteria 2823
206 Ga0395905_0202930 3300037471 Bacteria 1858
207 Ga0395905_0237772 3300037471 Bacteria 1702
208 Ga0395905_0289923 3300037471 Bacteria 1523
209 Ga0395905_0374582 3300037471 Bacteria 1317
210 Ga0395905_0567991 3300037471 Bacteria 1036
211 Ga0395905_0736003 3300037471 Bacteria 888
212 Ga0395905_0741535 3300037471 Bacteria 884
213 Ga0395905_0749990 3300037471 Unclassified 878
214 Ga0395905_0917688 3300037471 Bacteria 779
215 Ga0395905_0964762 3300037471 Bacteria 755
216 Ga0436364_0030565 3300037853 Bacteria 2675
217 Ga0395901_0046370 3300038443 Bacteria 4514
218 Ga0395901_0079691 3300038443 Bacteria 3419
219 Ga0395901_0306836 3300038443 Bacteria 1644
220 Ga0395901_0778562 3300038443 Bacteria 947
221 Ga0395901_0870888 3300038443 Bacteria 884
222 Ga0395901_0960768 3300038443 Bacteria 832
223 Ga0395901_1216318 3300038443 Unclassified 718
224 Ga0451804_0681598 3300041463 Bacteria 666
225 Ga0451807_0650239 3300041486 Bacteria 612
226 Ga0439455_0011708 3300042012 Bacteria 1955
227 Ga0439455_0077726 3300042012 Bacteria 899
228 Ga0439458_0000009 3300042157 Bacteria 29761
229 Ga0466972_0102614 3300044658 Bacteria 1353
230 Ga0466972_0444140 3300044658 Unclassified 609
231 Ga0466966_0233315 3300044684 Bacteria 1110
232 Ga0466966_0251515 3300044684 Bacteria 1064
233 Ga0466966_0940807 3300044684 Unclassified 521
234 Ga0466963_0014070 3300044694 Bacteria 4929
235 Ga0466963_0115871 3300044694 Bacteria 1841
236 Ga0466963_0709839 3300044694 Unclassified 710
237 Ga0466957_0333555 3300044842 Bacteria 1026
238 Ga0466960_0096813 3300044901 Bacteria 1513
239 Ga0466960_0507003 3300044901 Bacteria 707
240 Ga0466959_0049790 3300045049 Bacteria 3077
241 Ga0466959_0521048 3300045049 Bacteria 803
242 Ga0466967_0332142 3300045976 Bacteria 1468
243 Ga0466967_1488060 3300045976 Bacteria 674
244 Ga0466967_2511431 3300045976 Bacteria 510
245 Ga0495631_0298179 3300046518 Bacteria 686
246 Ga0495643_0261294 3300046522 Bacteria 804
247 Ga0495663_0002468 3300046525 Bacteria 5560
248 Ga0495663_0006033 3300046525 Bacteria 3352
249 Ga0495642_0157571 3300046528 Bacteria 984
250 Ga0495598_0001445 3300046537 Bacteria 4708
251 Ga0495621_0006529 3300046539 Bacteria 3411
252 Ga0495633_0062564 3300046558 Bacteria 1742
253 Ga0495625_0259481 3300046660 Bacteria 1125
254 Ga0495669_0011969 3300046684 Bacteria 3688
255 Ga0495669_0012596 3300046684 Unclassified 3602
256 Ga0495669_0013226 3300046684 Bacteria 3515
257 Ga0495669_0618940 3300046684 Bacteria 527
258 Ga0495670_0627667 3300046691 Bacteria 585
259 Ga0495687_095039 3300047443 Bacteria 1132
260 Ga0495677_0013471 3300047445 Bacteria 2977
261 Ga0495677_0015055 3300047445 Bacteria 2811
262 Ga0495685_074146 3300047447 Bacteria 1138
263 Ga0496107_0030540 3300048910 Bacteria 3841
264 Ga0496107_0418940 3300048910 Bacteria 996
265 Ga0496109_0072363 3300048912 Unclassified 3167
266 Ga0496109_0266225 3300048912 Bacteria 1615
267 Ga0496110_0215501 3300048913 Unclassified 1746
268 Ga0496114_0321229 3300048917 Unclassified 1368
269 Ga0501075_0195241 3300049591 Bacteria 1544
270 Ga0501077_0136442 3300049593 Bacteria 1556
271 nmdc:mga0k408_290419_c1 3300050493 Bacteria 976
272 nmdc:mga0k408_373651_c1 3300050493 Bacteria 849
273 Ga0501084_0700493 3300054114 Bacteria 854
274 Ga0501082_1856869 3300060353 Bacteria 525
275 Ga0466962_0510525 3300061719 Bacteria 609

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10674837 Ga0070658_106748372 82
2 3300005337 Ga0070682_100594387 Ga0070682_1005943872 82
3 3300005436 Ga0070713_100857183 Ga0070713_1008571832 82
4 3300005455 Ga0070663_100088930 Ga0070663_1000889304 82
5 3300005458 Ga0070681_11404162 Ga0070681_114041622 82
6 3300005543 Ga0070672_100045048 Ga0070672_1000450482 82
7 3300005618 Ga0068864_100901576 Ga0068864_1009015762 82
8 3300011119 Ga0105246_10086339 Ga0105246_100863392 82
9 3300013102 Ga0157371_10062001 Ga0157371_100620012 82
10 3300025909 Ga0207705_10198309 Ga0207705_101983092 82
11 3300025926 Ga0207659_10075124 Ga0207659_100751244 82
12 3300025931 Ga0207644_10303138 Ga0207644_103031381 82
13 3300026121 Ga0207683_11796757 Ga0207683_117967571 82
14 3300037471 Ga0395905_0237772 Ga0395905_0237772_1442_1690 82
15 3300046684 Ga0495669_0618940 Ga0495669_0618940_123_371 82
16 3300046691 Ga0495670_0627667 Ga0495670_0627667_28_276 82
17 3300047443 Ga0495687_095039 Ga0495687_095039_20_268 82
18 3300048912 Ga0496109_0266225 Ga0496109_0266225_1346_1594 82
19 3300005327 Ga0070658_10029453 Ga0070658_100294531 83
20 3300005327 Ga0070658_10297203 Ga0070658_102972032 83
21 3300005334 Ga0068869_100883750 Ga0068869_1008837501 83
22 3300005344 Ga0070661_100122099 Ga0070661_1001220994 83
23 3300005436 Ga0070713_100312456 Ga0070713_1003124562 83
24 3300005539 Ga0068853_100054647 Ga0068853_1000546472 83
25 3300005564 Ga0070664_100464922 Ga0070664_1004649223 83
26 3300005616 Ga0068852_102152073 Ga0068852_1021520732 83
27 3300009093 Ga0105240_10443824 Ga0105240_104438242 83
28 3300009545 Ga0105237_10124924 Ga0105237_101249245 83
29 3300010375 Ga0105239_11868061 Ga0105239_118680612 83
30 3300013100 Ga0157373_10038247 Ga0157373_100382474 83
31 3300013100 Ga0157373_10588428 Ga0157373_105884282 83
32 3300013104 Ga0157370_10972533 Ga0157370_109725331 83
33 3300013105 Ga0157369_11714584 Ga0157369_117145842 83
34 3300013307 Ga0157372_10251000 Ga0157372_102510003 83
35 3300025321 Ga0207656_10546005 Ga0207656_105460052 83
36 3300025907 Ga0207645_10021744 Ga0207645_100217442 83
37 3300025909 Ga0207705_10284398 Ga0207705_102843983 83
38 3300025913 Ga0207695_10634184 Ga0207695_106341842 83
39 3300025927 Ga0207687_10803455 Ga0207687_108034552 83
40 3300025928 Ga0207700_10259242 Ga0207700_102592423 83
41 3300025949 Ga0207667_10257361 Ga0207667_102573612 83
42 3300026023 Ga0207677_10099400 Ga0207677_100994003 83
43 3300026067 Ga0207678_10659838 Ga0207678_106598381 83
44 3300031731 Ga0307405_11785644 Ga0307405_117856442 83
45 3300031903 Ga0307407_10235222 Ga0307407_102352222 83
46 3300032002 Ga0307416_102239481 Ga0307416_1022394812 83
47 3300037312 Ga0395899_0129664 Ga0395899_0129664_1517_1768 83
48 3300037312 Ga0395899_0572412 Ga0395899_0572412_456_707 83
49 3300037312 Ga0395899_0747302 Ga0395899_0747302_133_390 83
50 3300037418 Ga0395900_0052316 Ga0395900_0052316_417_668 83
51 3300037418 Ga0395900_0148263 Ga0395900_0148263_997_1248 83
52 3300037418 Ga0395900_0835274 Ga0395900_0835274_68_319 83
53 3300037466 Ga0395898_0584232 Ga0395898_0584232_558_809 83
54 3300037466 Ga0395898_0681126 Ga0395898_0681126_216_467 83
55 3300037471 Ga0395905_0567991 Ga0395905_0567991_754_1005 83
56 3300037471 Ga0395905_0749990 Ga0395905_0749990_560_811 83
57 3300044684 Ga0466966_0251515 Ga0466966_0251515_267_518 83
58 3300044694 Ga0466963_0014070 Ga0466963_0014070_2442_2693 83
59 3300044694 Ga0466963_0709839 Ga0466963_0709839_61_318 83
60 3300044901 Ga0466960_0507003 Ga0466960_0507003_29_307 83
61 3300045049 Ga0466959_0049790 Ga0466959_0049790_1527_1778 83
62 3300045049 Ga0466959_0521048 Ga0466959_0521048_54_305 83
63 3300045976 Ga0466967_2511431 Ga0466967_2511431_92_343 83
64 3300046660 Ga0495625_0259481 Ga0495625_0259481_848_1102 83
65 3300061719 Ga0466962_0510525 Ga0466962_0510525_158_409 83
66 3300049591 Ga0501075_0195241 Ga0501075_0195241_1039_1305 88
67 3300049593 Ga0501077_0136442 Ga0501077_0136442_776_1042 88
68 3300054114 Ga0501084_0700493 Ga0501084_0700493_339_605 88
69 3300060353 Ga0501082_1856869 Ga0501082_1856869_147_413 88
70 3300006871 Ga0075434_100735259 Ga0075434_1007352592 89
71 3300035410 Ga0373924_0392610 Ga0373924_0392610_15_299 89
72 3300025936 Ga0207670_10533313 Ga0207670_105333131 92
73 3300026142 Ga0207698_11298329 Ga0207698_112983292 92
74 3300005339 Ga0070660_100008386 Ga0070660_1000083866 93
75 3300005455 Ga0070663_101027330 Ga0070663_1010273302 93
76 3300005564 Ga0070664_100628838 Ga0070664_1006288382 93
77 3300020081 Ga0206354_11140010 Ga0206354_111400102 93
78 3300025893 Ga0207682_10132835 Ga0207682_101328352 93
79 3300025909 Ga0207705_10080708 Ga0207705_100807082 93
80 3300025919 Ga0207657_10001331 Ga0207657_1000133126 93
81 3300025932 Ga0207690_10206881 Ga0207690_102068812 93
82 3300026041 Ga0207639_10737416 Ga0207639_107374162 93
83 3300026067 Ga0207678_10048543 Ga0207678_100485433 93
84 3300005290 Ga0065712_10415715 Ga0065712_104157151 94
85 3300005327 Ga0070658_10014808 Ga0070658_100148081 94
86 3300005327 Ga0070658_10050965 Ga0070658_100509653 94
87 3300005338 Ga0068868_100270907 Ga0068868_1002709073 94
88 3300005344 Ga0070661_100068373 Ga0070661_1000683733 94
89 3300005344 Ga0070661_100156281 Ga0070661_1001562814 94
90 3300005353 Ga0070669_100297665 Ga0070669_1002976652 94
91 3300005354 Ga0070675_100047934 Ga0070675_1000479342 94
92 3300005355 Ga0070671_100343727 Ga0070671_1003437271 94
93 3300005366 Ga0070659_100446342 Ga0070659_1004463423 94
94 3300005458 Ga0070681_10115276 Ga0070681_101152764 94
95 3300005543 Ga0070672_100030442 Ga0070672_1000304424 94
96 3300005544 Ga0070686_100181186 Ga0070686_1001811862 94
97 3300005547 Ga0070693_101158030 Ga0070693_1011580301 94
98 3300005563 Ga0068855_100202022 Ga0068855_1002020223 94
99 3300005577 Ga0068857_100864132 Ga0068857_1008641322 94
100 3300005616 Ga0068852_100012940 Ga0068852_1000129403 94
101 3300005834 Ga0068851_10934452 Ga0068851_109344522 94
102 3300005841 Ga0068863_100004532 Ga0068863_10000453215 94
103 3300005841 Ga0068863_101542038 Ga0068863_1015420382 94
104 3300006173 Ga0070716_100334925 Ga0070716_1003349252 94
105 3300006881 Ga0068865_100150441 Ga0068865_1001504413 94
106 3300009177 Ga0105248_10175120 Ga0105248_101751202 94
107 3300009551 Ga0105238_10052960 Ga0105238_100529604 94
108 3300009551 Ga0105238_12149903 Ga0105238_121499031 94
109 3300010375 Ga0105239_11271492 Ga0105239_112714922 94
110 3300011119 Ga0105246_10219001 Ga0105246_102190012 94
111 3300013100 Ga0157373_10045910 Ga0157373_100459104 94
112 3300013102 Ga0157371_10327060 Ga0157371_103270602 94
113 3300013102 Ga0157371_10714977 Ga0157371_107149772 94
114 3300013104 Ga0157370_10036715 Ga0157370_100367152 94
115 3300013308 Ga0157375_10270351 Ga0157375_102703512 94
116 3300021388 Ga0213875_10028084 Ga0213875_100280842 94
117 3300025321 Ga0207656_10531033 Ga0207656_105310332 94
118 3300025903 Ga0207680_10102510 Ga0207680_101025102 94
119 3300025909 Ga0207705_10477380 Ga0207705_104773802 94
120 3300025912 Ga0207707_10607767 Ga0207707_106077672 94
121 3300025915 Ga0207693_10025496 Ga0207693_100254967 94
122 3300025920 Ga0207649_10073556 Ga0207649_100735563 94
123 3300025920 Ga0207649_10780096 Ga0207649_107800962 94
124 3300025924 Ga0207694_10291753 Ga0207694_102917532 94
125 3300025928 Ga0207700_10182828 Ga0207700_101828282 94
126 3300025938 Ga0207704_10185023 Ga0207704_101850231 94
127 3300025939 Ga0207665_10057146 Ga0207665_100571462 94
128 3300025940 Ga0207691_10006922 Ga0207691_100069227 94
129 3300025941 Ga0207711_10116099 Ga0207711_101160992 94
130 3300025949 Ga0207667_10624771 Ga0207667_106247712 94
131 3300026035 Ga0207703_11220906 Ga0207703_112209061 94
132 3300026078 Ga0207702_11439589 Ga0207702_114395892 94
133 3300026088 Ga0207641_10015935 Ga0207641_100159354 94
134 3300026088 Ga0207641_11041223 Ga0207641_110412232 94
135 3300026089 Ga0207648_10101502 Ga0207648_101015024 94
136 3300026095 Ga0207676_11849675 Ga0207676_118496752 94
137 3300026116 Ga0207674_10346342 Ga0207674_103463422 94
138 3300026142 Ga0207698_10006895 Ga0207698_100068958 94
139 3300031903 Ga0307407_11095995 Ga0307407_110959952 94
140 3300031995 Ga0307409_100451671 Ga0307409_1004516712 94
141 3300031995 Ga0307409_100647012 Ga0307409_1006470122 94
142 3300031995 Ga0307409_101244583 Ga0307409_1012445832 94
143 3300032004 Ga0307414_10020386 Ga0307414_100203863 94
144 3300032005 Ga0307411_10588312 Ga0307411_105883122 94
145 3300037312 Ga0395899_0060159 Ga0395899_0060159_109_393 94
146 3300037312 Ga0395899_0082662 Ga0395899_0082662_397_681 94
147 3300037312 Ga0395899_0125977 Ga0395899_0125977_1213_1497 94
148 3300037312 Ga0395899_0190353 Ga0395899_0190353_1010_1294 94
149 3300037312 Ga0395899_0465480 Ga0395899_0465480_397_681 94
150 3300037418 Ga0395900_0035979 Ga0395900_0035979_4455_4739 94
151 3300037418 Ga0395900_0047163 Ga0395900_0047163_276_560 94
152 3300037418 Ga0395900_0070159 Ga0395900_0070159_982_1266 94
153 3300037418 Ga0395900_0115232 Ga0395900_0115232_2378_2662 94
154 3300037418 Ga0395900_0233923 Ga0395900_0233923_839_1123 94
155 3300037418 Ga0395900_0702889 Ga0395900_0702889_530_814 94
156 3300037418 Ga0395900_0941565 Ga0395900_0941565_34_318 94
157 3300037466 Ga0395898_0083531 Ga0395898_0083531_493_777 94
158 3300037466 Ga0395898_0735591 Ga0395898_0735591_581_865 94
159 3300037471 Ga0395905_0000187 Ga0395905_0000187_37829_38113 94
160 3300037471 Ga0395905_0086921 Ga0395905_0086921_2484_2768 94
161 3300037471 Ga0395905_0092499 Ga0395905_0092499_2048_2332 94
162 3300037471 Ga0395905_0093297 Ga0395905_0093297_1612_1896 94
163 3300037471 Ga0395905_0202930 Ga0395905_0202930_101_385 94
164 3300037471 Ga0395905_0289923 Ga0395905_0289923_857_1141 94
165 3300037471 Ga0395905_0374582 Ga0395905_0374582_999_1283 94
166 3300037471 Ga0395905_0741535 Ga0395905_0741535_132_416 94
167 3300037471 Ga0395905_0964762 Ga0395905_0964762_331_615 94
168 3300037853 Ga0436364_0030565 Ga0436364_0030565_736_1044 94
169 3300038443 Ga0395901_0046370 Ga0395901_0046370_1925_2209 94
170 3300038443 Ga0395901_0079691 Ga0395901_0079691_1180_1464 94
171 3300038443 Ga0395901_0306836 Ga0395901_0306836_1020_1304 94
172 3300038443 Ga0395901_0870888 Ga0395901_0870888_469_753 94
173 3300038443 Ga0395901_0960768 Ga0395901_0960768_408_692 94
174 3300038443 Ga0395901_1216318 Ga0395901_1216318_403_687 94
175 3300044658 Ga0466972_0102614 Ga0466972_0102614_430_714 94
176 3300044684 Ga0466966_0233315 Ga0466966_0233315_597_881 94
177 3300044901 Ga0466960_0096813 Ga0466960_0096813_566_850 94
178 3300045976 Ga0466967_1488060 Ga0466967_1488060_332_616 94
179 3300046518 Ga0495631_0298179 Ga0495631_0298179_253_537 94
180 3300046525 Ga0495663_0002468 Ga0495663_0002468_1391_1675 94
181 3300046537 Ga0495598_0001445 Ga0495598_0001445_3041_3325 94
182 3300046539 Ga0495621_0006529 Ga0495621_0006529_514_798 94
183 3300046558 Ga0495633_0062564 Ga0495633_0062564_1391_1675 94
184 3300046684 Ga0495669_0012596 Ga0495669_0012596_222_506 94
185 3300046684 Ga0495669_0013226 Ga0495669_0013226_1202_1486 94
186 3300047445 Ga0495677_0015055 Ga0495677_0015055_2296_2580 94
187 3300047447 Ga0495685_074146 Ga0495685_074146_717_1001 94
188 3300048910 Ga0496107_0030540 Ga0496107_0030540_309_593 94
189 3300048910 Ga0496107_0418940 Ga0496107_0418940_516_800 94
190 3300048912 Ga0496109_0072363 Ga0496109_0072363_1396_1680 94
191 3300048913 Ga0496110_0215501 Ga0496110_0215501_1217_1501 94
192 3300048917 Ga0496114_0321229 Ga0496114_0321229_620_904 94
193 3300001990 JGI24737J22298_10004367 JGI24737J22298_100043678 95
194 3300001990 JGI24737J22298_10023183 JGI24737J22298_100231832 95
195 3300002067 JGI24735J21928_10044683 JGI24735J21928_100446833 95
196 3300005339 Ga0070660_100408234 Ga0070660_1004082342 95
197 3300005341 Ga0070691_10384953 Ga0070691_103849532 95
198 3300005344 Ga0070661_100991027 Ga0070661_1009910272 95
199 3300005353 Ga0070669_100538430 Ga0070669_1005384302 95
200 3300005366 Ga0070659_100004168 Ga0070659_1000041686 95
201 3300005366 Ga0070659_101097388 Ga0070659_1010973882 95
202 3300005435 Ga0070714_100063953 Ga0070714_1000639535 95
203 3300005435 Ga0070714_100362869 Ga0070714_1003628692 95
204 3300005435 Ga0070714_101311915 Ga0070714_1013119152 95
205 3300005436 Ga0070713_101307384 Ga0070713_1013073842 95
206 3300005535 Ga0070684_100066457 Ga0070684_1000664574 95
207 3300005539 Ga0068853_100335957 Ga0068853_1003359571 95
208 3300005548 Ga0070665_100082886 Ga0070665_1000828864 95
209 3300005577 Ga0068857_100064127 Ga0068857_1000641276 95
210 3300005618 Ga0068864_100885491 Ga0068864_1008854912 95
211 3300005841 Ga0068863_100023410 Ga0068863_1000234102 95
212 3300006195 Ga0075366_10304034 Ga0075366_103040342 95
213 3300009093 Ga0105240_11731925 Ga0105240_117319252 95
214 3300009551 Ga0105238_11191701 Ga0105238_111917012 95
215 3300011119 Ga0105246_11712984 Ga0105246_117129841 95
216 3300013297 Ga0157378_10183627 Ga0157378_101836272 95
217 3300013307 Ga0157372_10642743 Ga0157372_106427432 95
218 3300014325 Ga0163163_10061314 Ga0163163_100613144 95
219 3300014745 Ga0157377_10329516 Ga0157377_103295162 95
220 3300025919 Ga0207657_10753858 Ga0207657_107538582 95
221 3300025929 Ga0207664_10040821 Ga0207664_100408214 95
222 3300025929 Ga0207664_10192661 Ga0207664_101926613 95
223 3300025929 Ga0207664_10249100 Ga0207664_102491002 95
224 3300025932 Ga0207690_10020330 Ga0207690_100203305 95
225 3300025933 Ga0207706_10065213 Ga0207706_100652135 95
226 3300025944 Ga0207661_10072414 Ga0207661_100724143 95
227 3300025949 Ga0207667_10040963 Ga0207667_100409636 95
228 3300026041 Ga0207639_10828586 Ga0207639_108285862 95
229 3300026078 Ga0207702_10395588 Ga0207702_103955883 95
230 3300026116 Ga0207674_10001210 Ga0207674_100012105 95
231 3300028379 Ga0268266_10367597 Ga0268266_103675973 95
232 3300031824 Ga0307413_10039367 Ga0307413_100393675 95
233 3300031824 Ga0307413_10068694 Ga0307413_100686943 95
234 3300031824 Ga0307413_11716724 Ga0307413_117167241 95
235 3300031852 Ga0307410_10032482 Ga0307410_100324825 95
236 3300031852 Ga0307410_10526931 Ga0307410_105269312 95
237 3300031901 Ga0307406_10121564 Ga0307406_101215643 95
238 3300031903 Ga0307407_10022319 Ga0307407_100223193 95
239 3300031903 Ga0307407_10232175 Ga0307407_102321752 95
240 3300031911 Ga0307412_10170308 Ga0307412_101703082 95
241 3300031911 Ga0307412_10515554 Ga0307412_105155542 95
242 3300031995 Ga0307409_100035249 Ga0307409_1000352492 95
243 3300031995 Ga0307409_100123383 Ga0307409_1001233833 95
244 3300032002 Ga0307416_100192425 Ga0307416_1001924253 95
245 3300032002 Ga0307416_100887396 Ga0307416_1008873962 95
246 3300032004 Ga0307414_10024392 Ga0307414_100243924 95
247 3300032004 Ga0307414_10063804 Ga0307414_100638043 95
248 3300032004 Ga0307414_10523606 Ga0307414_105236062 95
249 3300032005 Ga0307411_10011718 Ga0307411_100117182 95
250 3300032005 Ga0307411_10074609 Ga0307411_100746092 95
251 3300032005 Ga0307411_10109865 Ga0307411_101098653 95
252 3300032005 Ga0307411_10138748 Ga0307411_101387483 95
253 3300032126 Ga0307415_100014111 Ga0307415_1000141117 95
254 3300032126 Ga0307415_100159083 Ga0307415_1001590833 95
255 3300032126 Ga0307415_100315783 Ga0307415_1003157832 95
256 3300037471 Ga0395905_0736003 Ga0395905_0736003_251_538 95
257 3300037471 Ga0395905_0917688 Ga0395905_0917688_132_419 95
258 3300038443 Ga0395901_0778562 Ga0395901_0778562_144_431 95
259 3300041463 Ga0451804_0681598 Ga0451804_0681598_48_338 95
260 3300041486 Ga0451807_0650239 Ga0451807_0650239_65_352 95
261 3300042012 Ga0439455_0011708 Ga0439455_0011708_816_1103 95
262 3300042012 Ga0439455_0077726 Ga0439455_0077726_564_851 95
263 3300042157 Ga0439458_0000009 Ga0439458_0000009_13128_13415 95
264 3300044658 Ga0466972_0444140 Ga0466972_0444140_215_502 95
265 3300044684 Ga0466966_0940807 Ga0466966_0940807_102_389 95
266 3300044694 Ga0466963_0115871 Ga0466963_0115871_591_884 95
267 3300044842 Ga0466957_0333555 Ga0466957_0333555_364_651 95
268 3300045976 Ga0466967_0332142 Ga0466967_0332142_290_583 95
269 3300046522 Ga0495643_0261294 Ga0495643_0261294_481_768 95
270 3300046525 Ga0495663_0006033 Ga0495663_0006033_1585_1872 95
271 3300046528 Ga0495642_0157571 Ga0495642_0157571_352_639 95
272 3300046684 Ga0495669_0011969 Ga0495669_0011969_499_786 95
273 3300047445 Ga0495677_0013471 Ga0495677_0013471_2241_2528 95
274 3300050493 nmdc:mga0k408_290419_c1 nmdc:mga0k408_290419_c1_232_519 95
275 3300050493 nmdc:mga0k408_373651_c1 nmdc:mga0k408_373651_c1_140_427 95

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

11

88

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pui-assembly2.cif.gz_B bola domain of sufe1 from arabidopsis thaliana 0.9466 7 92
4pui-assembly1.cif.gz_A bola domain of sufe1 from arabidopsis thaliana 0.9367 7 92
4pug-assembly2.cif.gz_B bola1 from arabidopsis thaliana 0.9301 9 95
3o2e-assembly1.cif.gz_A crystal structure of a bol-like protein from babesia bovis 0.9048 11 93
4pui-assembly2.cif.gz_B bola domain of sufe1 from arabidopsis thaliana 0.8837 7 92
ID Description Score Start End Superfamily
af_Q3E793_13_109_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.933 11 94 3.30.300.90
af_P91375_6_86_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.931 7 89 3.30.300.90
4puiA01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9306 11 92 3.30.300.90
af_Q682I1_66_160_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.928 11 95 3.30.300.90
af_Q54G84_40_127_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9266 8 95 3.30.300.90
ID Description Score Start End GO Terms
AF-A0A397NKG3-F1-model_v4 BolA protein 0.9925 6 95 GO:0016226
AF-A0A219B325-F1-model_v4 BolA family transcriptional regulator 0.992 7 92 GO:0016226
AF-A0A1H9V232-F1-model_v4 BolA protein 0.9908 9 91 GO:0016226
AF-A0A0Q5R8Z7-F1-model_v4 BolA family transcriptional regulator 0.9888 8 94 GO:0016226
AF-A0A3D5NCL4-F1-model_v4 BolA family transcriptional regulator 0.9869 9 94 GO:0016226

Feature Viewer

pLDDT pTM Quality
84.72 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map