F380179

General Info

Members Datasets Scaffolds Average Seq Length
275 167 550 232

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100282287|Ga0070690_1002822872
Length 244
Sequence MRRADRLFRIVQRLRRWGATTARQLAEALEVSERTVYRDIRDLTTSGVPIQGEAGVGYALDRSYELPPLMFDEEEIEALVLGARIVRAWADKKLARSAEDALQKIEAVLPPRLKSRLADSALLAPDLHFSDRFRAGLEDLRRAIREQRKARFHYVDKAQAGSDRTVHPLALACWGQTWTLTAWCEMRDGFRTFRLDRIEDLQITDARFESPPGRTLADFLAMVQAEDRAAGLEQDSPSRPAKRR

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
109 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
110 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
111 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
112 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
113 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
114 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
115 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
116 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
117 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
118 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
119 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
120 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
121 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
122 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
123 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
158 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.27
Nodule 0
Rhizoplane 1.82
Rhizosphere 90.91
Stem 0
Stem Tuber 0
Unclassified 3.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100282287 3300005330 Bacteria 1185
2 Ga0065707_10299043 3300005295 Bacteria 1008
3 Ga0070670_100197254 3300005331 Bacteria 1749
4 Ga0070666_10004740 3300005335 Bacteria 8312
5 Ga0070668_100034238 3300005347 Bacteria 3870
6 Ga0070668_100427152 3300005347 Bacteria 1135
7 Ga0070669_100018296 3300005353 Bacteria 5008
8 Ga0070675_100042041 3300005354 Bacteria 3734
9 Ga0070675_100289997 3300005354 Bacteria 1440
10 Ga0070671_100083603 3300005355 Bacteria 2669
11 Ga0070671_100431770 3300005355 Bacteria 1129
12 Ga0070673_100019424 3300005364 Bacteria 4877
13 Ga0070688_100003525 3300005365 Bacteria 8065
14 Ga0070688_100056598 3300005365 Bacteria 2463
15 Ga0070659_100216927 3300005366 Bacteria 1578
16 Ga0070710_10138278 3300005437 Bacteria 1491
17 Ga0070694_100641177 3300005444 Bacteria 859
18 Ga0070708_100005638 3300005445 Bacteria 9922
19 Ga0070708_100032001 3300005445 Bacteria 4558
20 Ga0070708_100106239 3300005445 Bacteria 2577
21 Ga0070663_100183638 3300005455 Bacteria 1624
22 Ga0070662_100531991 3300005457 Bacteria 983
23 Ga0068867_100218394 3300005459 Bacteria 1535
24 Ga0070706_100237257 3300005467 Bacteria 1703
25 Ga0070707_100111863 3300005468 Bacteria 2648
26 Ga0070707_100146703 3300005468 Bacteria 2297
27 Ga0070698_100077105 3300005471 Bacteria 3334
28 Ga0070698_100207182 3300005471 Unclassified 1896
29 Ga0070699_100009072 3300005518 Bacteria 8621
30 Ga0070699_100014748 3300005518 Bacteria 6720
31 Ga0070699_100309519 3300005518 Unclassified 1418
32 Ga0070679_100403606 3300005530 Bacteria 1312
33 Ga0070697_100010874 3300005536 Bacteria 7107
34 Ga0070697_100077922 3300005536 Bacteria 2727
35 Ga0070697_100087208 3300005536 Bacteria 2576
36 Ga0070697_100611946 3300005536 Bacteria 958
37 Ga0070672_100079708 3300005543 Bacteria 2622
38 Ga0070672_100175279 3300005543 Bacteria 1785
39 Ga0070686_100007525 3300005544 Bacteria 6080
40 Ga0070686_100332953 3300005544 Bacteria 1135
41 Ga0070695_100002602 3300005545 Bacteria 10423
42 Ga0070695_100318461 3300005545 Bacteria 1155
43 Ga0070696_100320109 3300005546 Bacteria 1193
44 Ga0070665_100204211 3300005548 Bacteria 1976
45 Ga0070704_100050909 3300005549 Bacteria 2914
46 Ga0070704_100124422 3300005549 Bacteria 1987
47 Ga0068855_100023456 3300005563 Bacteria 7391
48 Ga0070664_100590135 3300005564 Bacteria 1030
49 Ga0068854_100002370 3300005578 Bacteria 11622
50 Ga0068856_100247380 3300005614 Bacteria 1798
51 Ga0068856_100527470 3300005614 Bacteria 1202
52 Ga0068859_100000056 3300005617 Bacteria 119390
53 Ga0068859_100200900 3300005617 Bacteria 2078
54 Ga0068859_101007053 3300005617 Bacteria 915
55 Ga0068864_100170569 3300005618 Bacteria 1984
56 Ga0068861_100185984 3300005719 Bacteria 1732
57 Ga0068870_10113142 3300005840 Bacteria 1553
58 Ga0068870_10339754 3300005840 Bacteria 960
59 Ga0068863_100002910 3300005841 Bacteria 16973
60 Ga0068860_100604913 3300005843 Bacteria 1102
61 Ga0068862_100006761 3300005844 Bacteria 9507
62 Ga0081455_10065258 3300005937 Bacteria 3046
63 Ga0081539_10018129 3300005985 Bacteria 4901
64 Ga0075365_10029636 3300006038 Bacteria 3500
65 Ga0075365_10172110 3300006038 Bacteria 1512
66 Ga0075363_100093588 3300006048 Bacteria 1656
67 Ga0075364_10073277 3300006051 Bacteria 2257
68 Ga0075432_10058406 3300006058 Bacteria 1370
69 Ga0070716_100070386 3300006173 Bacteria 2054
70 Ga0070716_100356799 3300006173 Bacteria 1037
71 Ga0075367_10011865 3300006178 Bacteria 4627
72 Ga0075367_10049398 3300006178 Bacteria 2479
73 Ga0075367_10268720 3300006178 Unclassified 1071
74 Ga0075366_10001797 3300006195 Bacteria 10838
75 Ga0075366_10101008 3300006195 Bacteria 1731
76 Ga0075370_10080035 3300006353 Bacteria 1877
77 Ga0068871_100789845 3300006358 Unclassified 874
78 Ga0075428_100150988 3300006844 Bacteria 2524
79 Ga0075428_100187650 3300006844 Bacteria 2236
80 Ga0075431_100415354 3300006847 Bacteria 1345
81 Ga0075433_10023290 3300006852 Bacteria 5211
82 Ga0075433_10109366 3300006852 Bacteria 2452
83 Ga0075433_10111325 3300006852 Bacteria 2429
84 Ga0075433_10123638 3300006852 Bacteria 2299
85 Ga0075433_10213728 3300006852 Bacteria 1714
86 Ga0075433_10263677 3300006852 Unclassified 1527
87 Ga0075434_100041530 3300006871 Bacteria 4557
88 Ga0075434_100072877 3300006871 Bacteria 3426
89 Ga0075434_100209173 3300006871 Bacteria 1971
90 Ga0075434_100539712 3300006871 Bacteria 1186
91 Ga0075434_100657777 3300006871 Bacteria 1066
92 Ga0075434_100814549 3300006871 Bacteria 950
93 Ga0075429_100405897 3300006880 Bacteria 1193
94 Ga0075436_100030341 3300006914 Bacteria 3722
95 Ga0075436_100054651 3300006914 Bacteria 2757
96 Ga0075436_100067641 3300006914 Bacteria 2469
97 Ga0075436_100110386 3300006914 Bacteria 1919
98 Ga0097620_100000056 3300006931 Bacteria 119390
99 Ga0097620_100200894 3300006931 Bacteria 2078
100 Ga0097620_101007176 3300006931 Bacteria 915
101 Ga0075435_100016150 3300007076 Bacteria 5624
102 Ga0075435_100025843 3300007076 Bacteria 4575
103 Ga0075435_100059012 3300007076 Bacteria 3109
104 Ga0075435_100267293 3300007076 Bacteria 1458
105 Ga0099794_10002710 3300007265 Bacteria 6597
106 Ga0099794_10041696 3300007265 Bacteria 2186
107 Ga0099794_10151303 3300007265 Bacteria 1178
108 Ga0111539_10018488 3300009094 Bacteria 8633
109 Ga0111539_10044843 3300009094 Bacteria 5295
110 Ga0111539_10084711 3300009094 Bacteria 3726
111 Ga0111539_10106441 3300009094 Bacteria 3290
112 Ga0111539_10366862 3300009094 Bacteria 1676
113 Ga0111539_10411773 3300009094 Bacteria 1574
114 Ga0111539_10809463 3300009094 Bacteria 1090
115 Ga0114129_10001904 3300009147 Bacteria 28438
116 Ga0114129_10005751 3300009147 Bacteria 17567
117 Ga0114129_10006295 3300009147 Bacteria 16826
118 Ga0114129_10007043 3300009147 Bacteria 16009
119 Ga0114129_10021385 3300009147 Bacteria 9183
120 Ga0114129_10030694 3300009147 Bacteria 7602
121 Ga0114129_10043247 3300009147 Bacteria 6337
122 Ga0114129_10057157 3300009147 Bacteria 5462
123 Ga0114129_10059647 3300009147 Bacteria 5334
124 Ga0114129_10302310 3300009147 Bacteria 2132
125 Ga0114129_10455422 3300009147 Bacteria 1677
126 Ga0105248_10210954 3300009177 Bacteria 2188
127 Ga0105248_10277720 3300009177 Bacteria 1886
128 Ga0105248_10466990 3300009177 Bacteria 1422
129 Ga0105249_10320858 3300009553 Bacteria 1560
130 Ga0105249_10847355 3300009553 Bacteria 980
131 Ga0157375_10057778 3300013308 Bacteria 3836
132 Ga0163163_10049670 3300014325 Bacteria 4128
133 Ga0163163_10341674 3300014325 Bacteria 1552
134 Ga0157380_10068504 3300014326 Bacteria 2860
135 Ga0157380_10336977 3300014326 Bacteria 1405
136 Ga0157376_10698812 3300014969 Bacteria 1019
137 Ga0163161_10340657 3300017792 Bacteria 1189
138 Ga0207688_10072363 3300025901 Bacteria 1958
139 Ga0207680_10007811 3300025903 Bacteria 5228
140 Ga0207643_10257392 3300025908 Unclassified 1077
141 Ga0207643_10458204 3300025908 Bacteria 812
142 Ga0207684_10210468 3300025910 Bacteria 1677
143 Ga0207662_10521085 3300025918 Bacteria 820
144 Ga0207652_10013049 3300025921 Bacteria 6724
145 Ga0207646_10025817 3300025922 Bacteria 5371
146 Ga0207646_10061376 3300025922 Bacteria 3356
147 Ga0207646_10143642 3300025922 Bacteria 2150
148 Ga0207681_10333080 3300025923 Bacteria 1210
149 Ga0207650_10121163 3300025925 Bacteria 2037
150 Ga0207644_10068380 3300025931 Bacteria 2591
151 Ga0207706_10564518 3300025933 Bacteria 979
152 Ga0207706_10632716 3300025933 Bacteria 917
153 Ga0207709_10036453 3300025935 Bacteria 2914
154 Ga0207669_10110174 3300025937 Bacteria 1843
155 Ga0207665_10070690 3300025939 Bacteria 2382
156 Ga0207691_10036369 3300025940 Bacteria 4562
157 Ga0207691_10275016 3300025940 Bacteria 1450
158 Ga0207711_10275174 3300025941 Bacteria 1550
159 Ga0207689_10169038 3300025942 Bacteria 1802
160 Ga0207679_10139566 3300025945 Bacteria 1957
161 Ga0207651_10073528 3300025960 Bacteria 2431
162 Ga0207712_10123116 3300025961 Bacteria 1965
163 Ga0207668_10078082 3300025972 Bacteria 2390
164 Ga0207640_10004668 3300025981 Bacteria 7436
165 Ga0207658_10290801 3300025986 Bacteria 1404
166 Ga0207677_10836829 3300026023 Bacteria 826
167 Ga0207678_10037152 3300026067 Bacteria 4238
168 Ga0207708_10232199 3300026075 Bacteria 1481
169 Ga0207702_10914153 3300026078 Bacteria 870
170 Ga0207641_10003075 3300026088 Bacteria 15047
171 Ga0207648_10010238 3300026089 Bacteria 8909
172 Ga0207648_10399094 3300026089 Bacteria 1246
173 Ga0207674_10076366 3300026116 Bacteria 3358
174 Ga0207675_100193455 3300026118 Bacteria 1952
175 Ga0207683_10111722 3300026121 Bacteria 2447
176 Ga0207698_10481302 3300026142 Bacteria 1204
177 Ga0207428_10002887 3300027907 Bacteria 17029
178 Ga0207428_10048433 3300027907 Bacteria 3409
179 Ga0268266_10358862 3300028379 Bacteria 1371
180 Ga0268265_10009061 3300028380 Bacteria 6731
181 Ga0268264_10638612 3300028381 Bacteria 1053
182 Ga0268264_10659194 3300028381 Bacteria 1036
183 Ga0307408_100276890 3300031548 Bacteria 1396
184 Ga0373948_0000920 3300034817 Bacteria 3941
185 Ga0373950_0000218 3300034818 Bacteria 7656
186 Ga0373928_0002506 3300035084 Unclassified 3556
187 Ga0373929_0001499 3300035085 Bacteria 4439
188 Ga0373934_0154706 3300035086 Bacteria 940
189 Ga0373940_0000540 3300035088 Bacteria 5962
190 Ga0373949_0003467 3300035090 Bacteria 3744
191 Ga0373951_0003344 3300035091 Bacteria 3918
192 Ga0373951_0052379 3300035091 Bacteria 1007
193 Ga0373952_0000150 3300035092 Bacteria 10299
194 Ga0373932_0000376 3300035112 Bacteria 13709
195 Ga0373939_0000531 3300035114 Bacteria 9575
196 Ga0373941_0000735 3300035115 Bacteria 6724
197 Ga0373960_0000667 3300035121 Bacteria 7068
198 Ga0373942_0001109 3300035207 Bacteria 7168
199 Ga0373961_0000861 3300035241 Bacteria 10219
200 Ga0373962_0000449 3300035242 Bacteria 9040
201 Ga0373962_0079845 3300035242 Bacteria 991
202 Ga0373931_0014857 3300035691 Bacteria 3813
203 Ga0373937_0046838 3300036401 Bacteria 3955
204 Ga0395900_0656964 3300037418 Bacteria 985
205 Ga0439464_0020867 3300042439 Bacteria 1796
206 Ga0453684_0062470 3300044712 Bacteria 4771
207 Ga0453684_0250030 3300044712 Bacteria 2036
208 Ga0451576_0065095 3300045051 Bacteria 3795
209 Ga0451576_0394510 3300045051 Bacteria 1451
210 Ga0451576_0683652 3300045051 Bacteria 1078
211 Ga0495638_0092997 3300046460 Bacteria 1814
212 Ga0495621_0078076 3300046539 Bacteria 1230
213 Ga0495647_0015097 3300046681 Bacteria 2701
214 Ga0495658_0003141 3300046683 Bacteria 8234
215 Ga0495670_0110874 3300046691 Bacteria 1420
216 Ga0496102_0085200 3300048905 Bacteria 2917
217 Ga0496103_0356251 3300048906 Unclassified 940
218 Ga0496107_0275961 3300048910 Unclassified 1251
219 Ga0496109_0159246 3300048912 Bacteria 2115
220 Ga0496112_0088695 3300048915 Bacteria 3061
221 Ga0501033_0064810 3300049570 Bacteria 2688
222 Ga0501036_0063381 3300049572 Bacteria 3130
223 Ga0501038_0018627 3300049574 Bacteria 6271
224 Ga0501039_0016709 3300049575 Bacteria 5623
225 Ga0501039_0470746 3300049575 Bacteria 987
226 Ga0501041_0006893 3300049577 Bacteria 6661
227 Ga0501048_0023701 3300049582 Bacteria 4483
228 Ga0501067_0190595 3300049583 Bacteria 1142
229 Ga0501072_0000549 3300049588 Bacteria 26969
230 Ga0501075_0000014 3300049591 Bacteria 77078
231 Ga0501076_0000072 3300049592 Bacteria 50636
232 Ga0501077_0179265 3300049593 Bacteria 1346
233 Ga0501080_0011358 3300049742 Bacteria 8155
234 Ga0501045_0065158 3300049824 Bacteria 2675
235 nmdc:mga00v17_128408_c1 3300050491 Bacteria 1619
236 nmdc:mga0yw44_64978_c1 3300050492 Bacteria 2247
237 nmdc:mga0k408_14442_c1 3300050493 Bacteria 4352
238 nmdc:mga0k408_8834_c1 3300050493 Bacteria 5421
239 nmdc:mga06z11_17674_c1 3300050494 Bacteria 3242
240 nmdc:mga06z11_32900_c1 3300050494 Bacteria 2532
241 nmdc:mga06z11_9770_c1 3300050494 Bacteria 4055
242 nmdc:mga04h51_126200_c1 3300050495 Bacteria 958
243 nmdc:mga04h51_33289_c1 3300050495 Bacteria 1640
244 nmdc:mga07m45_14605_c1 3300050496 Bacteria 4187
245 nmdc:mga05p37_197119_c1 3300050507 Bacteria 2441
246 nmdc:mga05p37_23337_c1 3300050507 Bacteria 7506
247 nmdc:mga05p37_23645_c1 3300050507 Bacteria 7460
248 nmdc:mga05p37_70950_c1 3300050507 Bacteria 4285
249 nmdc:mga05p37_79916_c1 3300050507 Bacteria 4027
250 nmdc:mga05p37_98953_c1 3300050507 Bacteria 3593
251 nmdc:mga09592_396392_c1 3300050508 Bacteria 1193
252 nmdc:mga09592_544325_c1 3300050508 Bacteria 997
253 nmdc:mga08y16_21545_c1 3300050511 Bacteria 6805
254 nmdc:mga08y16_328865_c1 3300050511 Bacteria 1573
255 nmdc:mga08y16_334427_c1 3300050511 Bacteria 1557
256 nmdc:mga08y16_367680_c1 3300050511 Bacteria 1476
257 nmdc:mga08y16_67909_c1 3300050511 Bacteria 3718
258 nmdc:mga0n895_1000617_c1 3300050512 Bacteria 817
259 nmdc:mga0n895_127795_c1 3300050512 Bacteria 2566
260 nmdc:mga0n895_178366_c1 3300050512 Bacteria 2155
261 nmdc:mga0n895_438213_c1 3300050512 Bacteria 1320
262 nmdc:mga0n895_7439_c1 3300050512 Bacteria 9397
263 nmdc:mga0rr50_122870_c1 3300050513 Bacteria 2069
264 nmdc:mga0rr50_169591_c1 3300050513 Bacteria 1777
265 nmdc:mga0rr50_206533_c1 3300050513 Bacteria 1617
266 nmdc:mga0rr50_68398_c1 3300050513 Bacteria 2701
267 nmdc:mga08x19_19249_c1 3300050514 Bacteria 4187
268 nmdc:mga08x19_426109_c1 3300050514 Bacteria 932
269 nmdc:mga0a205_131412_c1 3300050515 Bacteria 2404
270 nmdc:mga0a205_140398_c1 3300050515 Bacteria 2316
271 nmdc:mga0a205_275545_c1 3300050515 Bacteria 1559
272 nmdc:mga0a205_347293_c1 3300050515 Bacteria 1351
273 nmdc:mga0a205_37739_c1 3300050515 Bacteria 4646
274 Ga0501084_0000930 3300054114 Bacteria 22664
275 Ga0530510_0000215 3300061734 Bacteria 35909
276 Ga0070690_100282287
277 Ga0065707_10299043
278 Ga0070670_100197254
279 Ga0070666_10004740
280 Ga0070668_100034238
281 Ga0070668_100427152
282 Ga0070669_100018296
283 Ga0070675_100042041
284 Ga0070675_100289997
285 Ga0070671_100083603
286 Ga0070671_100431770
287 Ga0070673_100019424
288 Ga0070688_100003525
289 Ga0070688_100056598
290 Ga0070659_100216927
291 Ga0070710_10138278
292 Ga0070694_100641177
293 Ga0070708_100005638
294 Ga0070708_100032001
295 Ga0070708_100106239
296 Ga0070663_100183638
297 Ga0070662_100531991
298 Ga0068867_100218394
299 Ga0070706_100237257
300 Ga0070707_100111863
301 Ga0070707_100146703
302 Ga0070698_100077105
303 Ga0070698_100207182
304 Ga0070699_100009072
305 Ga0070699_100014748
306 Ga0070699_100309519
307 Ga0070679_100403606
308 Ga0070697_100010874
309 Ga0070697_100077922
310 Ga0070697_100087208
311 Ga0070697_100611946
312 Ga0070672_100079708
313 Ga0070672_100175279
314 Ga0070686_100007525
315 Ga0070686_100332953
316 Ga0070695_100002602
317 Ga0070695_100318461
318 Ga0070696_100320109
319 Ga0070665_100204211
320 Ga0070704_100050909
321 Ga0070704_100124422
322 Ga0068855_100023456
323 Ga0070664_100590135
324 Ga0068854_100002370
325 Ga0068856_100247380
326 Ga0068856_100527470
327 Ga0068859_100000056
328 Ga0068859_100200900
329 Ga0068859_101007053
330 Ga0068864_100170569
331 Ga0068861_100185984
332 Ga0068870_10113142
333 Ga0068870_10339754
334 Ga0068863_100002910
335 Ga0068860_100604913
336 Ga0068862_100006761
337 Ga0081455_10065258
338 Ga0081539_10018129
339 Ga0075365_10029636
340 Ga0075365_10172110
341 Ga0075363_100093588
342 Ga0075364_10073277
343 Ga0075432_10058406
344 Ga0070716_100070386
345 Ga0070716_100356799
346 Ga0075367_10011865
347 Ga0075367_10049398
348 Ga0075367_10268720
349 Ga0075366_10001797
350 Ga0075366_10101008
351 Ga0075370_10080035
352 Ga0068871_100789845
353 Ga0075428_100150988
354 Ga0075428_100187650
355 Ga0075431_100415354
356 Ga0075433_10023290
357 Ga0075433_10109366
358 Ga0075433_10111325
359 Ga0075433_10123638
360 Ga0075433_10213728
361 Ga0075433_10263677
362 Ga0075434_100041530
363 Ga0075434_100072877
364 Ga0075434_100209173
365 Ga0075434_100539712
366 Ga0075434_100657777
367 Ga0075434_100814549
368 Ga0075429_100405897
369 Ga0075436_100030341
370 Ga0075436_100054651
371 Ga0075436_100067641
372 Ga0075436_100110386
373 Ga0097620_100000056
374 Ga0097620_100200894
375 Ga0097620_101007176
376 Ga0075435_100016150
377 Ga0075435_100025843
378 Ga0075435_100059012
379 Ga0075435_100267293
380 Ga0099794_10002710
381 Ga0099794_10041696
382 Ga0099794_10151303
383 Ga0111539_10018488
384 Ga0111539_10044843
385 Ga0111539_10084711
386 Ga0111539_10106441
387 Ga0111539_10366862
388 Ga0111539_10411773
389 Ga0111539_10809463
390 Ga0114129_10001904
391 Ga0114129_10005751
392 Ga0114129_10006295
393 Ga0114129_10007043
394 Ga0114129_10021385
395 Ga0114129_10030694
396 Ga0114129_10043247
397 Ga0114129_10057157
398 Ga0114129_10059647
399 Ga0114129_10302310
400 Ga0114129_10455422
401 Ga0105248_10210954
402 Ga0105248_10277720
403 Ga0105248_10466990
404 Ga0105249_10320858
405 Ga0105249_10847355
406 Ga0157375_10057778
407 Ga0163163_10049670
408 Ga0163163_10341674
409 Ga0157380_10068504
410 Ga0157380_10336977
411 Ga0157376_10698812
412 Ga0163161_10340657
413 Ga0207688_10072363
414 Ga0207680_10007811
415 Ga0207643_10257392
416 Ga0207643_10458204
417 Ga0207684_10210468
418 Ga0207662_10521085
419 Ga0207652_10013049
420 Ga0207646_10025817
421 Ga0207646_10061376
422 Ga0207646_10143642
423 Ga0207681_10333080
424 Ga0207650_10121163
425 Ga0207644_10068380
426 Ga0207706_10564518
427 Ga0207706_10632716
428 Ga0207709_10036453
429 Ga0207669_10110174
430 Ga0207665_10070690
431 Ga0207691_10036369
432 Ga0207691_10275016
433 Ga0207711_10275174
434 Ga0207689_10169038
435 Ga0207679_10139566
436 Ga0207651_10073528
437 Ga0207712_10123116
438 Ga0207668_10078082
439 Ga0207640_10004668
440 Ga0207658_10290801
441 Ga0207677_10836829
442 Ga0207678_10037152
443 Ga0207708_10232199
444 Ga0207702_10914153
445 Ga0207641_10003075
446 Ga0207648_10010238
447 Ga0207648_10399094
448 Ga0207674_10076366
449 Ga0207675_100193455
450 Ga0207683_10111722
451 Ga0207698_10481302
452 Ga0207428_10002887
453 Ga0207428_10048433
454 Ga0268266_10358862
455 Ga0268265_10009061
456 Ga0268264_10638612
457 Ga0268264_10659194
458 Ga0307408_100276890
459 Ga0373948_0000920
460 Ga0373950_0000218
461 Ga0373928_0002506
462 Ga0373929_0001499
463 Ga0373934_0154706
464 Ga0373940_0000540
465 Ga0373949_0003467
466 Ga0373951_0003344
467 Ga0373951_0052379
468 Ga0373952_0000150
469 Ga0373932_0000376
470 Ga0373939_0000531
471 Ga0373941_0000735
472 Ga0373960_0000667
473 Ga0373942_0001109
474 Ga0373961_0000861
475 Ga0373962_0000449
476 Ga0373962_0079845
477 Ga0373931_0014857
478 Ga0373937_0046838
479 Ga0395900_0656964
480 Ga0439464_0020867
481 Ga0453684_0062470
482 Ga0453684_0250030
483 Ga0451576_0065095
484 Ga0451576_0394510
485 Ga0451576_0683652
486 Ga0495638_0092997
487 Ga0495621_0078076
488 Ga0495647_0015097
489 Ga0495658_0003141
490 Ga0495670_0110874
491 Ga0496102_0085200
492 Ga0496103_0356251
493 Ga0496107_0275961
494 Ga0496109_0159246
495 Ga0496112_0088695
496 Ga0501033_0064810
497 Ga0501036_0063381
498 Ga0501038_0018627
499 Ga0501039_0016709
500 Ga0501039_0470746
501 Ga0501041_0006893
502 Ga0501048_0023701
503 Ga0501067_0190595
504 Ga0501072_0000549
505 Ga0501075_0000014
506 Ga0501076_0000072
507 Ga0501077_0179265
508 Ga0501080_0011358
509 Ga0501045_0065158
510 nmdc:mga00v17_128408_c1
511 nmdc:mga0yw44_64978_c1
512 nmdc:mga0k408_14442_c1
513 nmdc:mga0k408_8834_c1
514 nmdc:mga06z11_17674_c1
515 nmdc:mga06z11_32900_c1
516 nmdc:mga06z11_9770_c1
517 nmdc:mga04h51_126200_c1
518 nmdc:mga04h51_33289_c1
519 nmdc:mga07m45_14605_c1
520 nmdc:mga05p37_197119_c1
521 nmdc:mga05p37_23337_c1
522 nmdc:mga05p37_23645_c1
523 nmdc:mga05p37_70950_c1
524 nmdc:mga05p37_79916_c1
525 nmdc:mga05p37_98953_c1
526 nmdc:mga09592_396392_c1
527 nmdc:mga09592_544325_c1
528 nmdc:mga08y16_21545_c1
529 nmdc:mga08y16_328865_c1
530 nmdc:mga08y16_334427_c1
531 nmdc:mga08y16_367680_c1
532 nmdc:mga08y16_67909_c1
533 nmdc:mga0n895_1000617_c1
534 nmdc:mga0n895_127795_c1
535 nmdc:mga0n895_178366_c1
536 nmdc:mga0n895_438213_c1
537 nmdc:mga0n895_7439_c1
538 nmdc:mga0rr50_122870_c1
539 nmdc:mga0rr50_169591_c1
540 nmdc:mga0rr50_206533_c1
541 nmdc:mga0rr50_68398_c1
542 nmdc:mga08x19_19249_c1
543 nmdc:mga08x19_426109_c1
544 nmdc:mga0a205_131412_c1
545 nmdc:mga0a205_140398_c1
546 nmdc:mga0a205_275545_c1
547 nmdc:mga0a205_347293_c1
548 nmdc:mga0a205_37739_c1
549 Ga0501084_0000930
550 Ga0530510_0000215

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08279

HTH_11

HTH domain

6

59

0.96

PF13280

WYL

WYL domain

135

235

0.94

PF08220

HTH_DeoR

DeoR-like helix-turn-helix domain

6

59

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u2w-assembly1.cif.gz_A crystal structure of the staphylococcus aureus pi258 cadc 0.8925 5 61
3irq-assembly1.cif.gz_D crystal structure of a z-z junction 0.8436 6 61
7oyk-assembly1.cif.gz_AAA dna-binding domain of cggr in complex with the dna operator 0.8411 4 63
1u2w-assembly2.cif.gz_C crystal structure of the staphylococcus aureus pi258 cadc 0.8274 5 61
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.8269 4 61
ID Description Score Start End Superfamily
1j5yA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9447 3 61 1.10.10.10
3v7sA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9297 5 62 1.10.10.10
af_P0ACK8_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9244 4 61 1.10.10.10
4a12A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8952 1 46 1.10.10.10
af_P15082_1_58_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8931 1 61 1.10.10.10
ID Description Score Start End GO Terms
AF-G9PV77-F1-model_v4 deleted 0.9741 137 206
AF-A0A7X3MD42-F1-model_v4 WYL domain-containing protein 0.966 139 211
AF-G1WRN0-F1-model_v4 deleted 0.9646 141 210
AF-A0A257GUM5-F1-model_v4 WYL domain-containing protein 0.9444 147 224
AF-A0A2A4XZQ2-F1-model_v4 WYL domain-containing protein 0.9431 141 226

Map