F380079

General Info

Members Datasets Scaffolds Average Seq Length
274 196 271 283

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2837678835|2837683683
Length 326
Sequence VARRQGNRKGPAISASPAIAEPSAGIGYAGPVGRFLRRRAEGRTIPVIAVCLAILGLWYCAAIGVNWATETDKLARAGDYSTLNAVAATWSAERPVLPVPHQIVAEVWKTVFEVRPTSPRSLLFHAWVTLSSTLLGFLFGSALGVLLAVGILFSRTLDKSLMPWVVISQTIPILAIAPMIIVVLNSMGVQGLLPKAFISTYLSFFPVTVGMVKGLRSPDRMLIDLMHSYSANSLQTLVKLRFPASLPFLFTSMKVAVAASLVGAIVGELPTGAVAGLGARLLAGSYYGQTIQIWSALVMASLMAAVLVWLVGLCERAALRRQGMLR

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
3 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
55 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
56 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
81 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
82 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
85 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
86 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
87 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
88 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
96 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
97 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
103 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
104 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
105 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
107 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
132 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
135 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
142 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
143 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
144 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
185 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
186 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
187 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
188 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
189 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
190 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
191 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
192 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
195 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
196 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 0
Isolates 1.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.61
Nodule 0
Rhizoplane 1.09
Rhizosphere 68.98
Stem 0
Stem Tuber 0
Unclassified 11.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1006769 3300002773 Bacteria 3049
2 JGI25151J46595_10012578 3300003187 Bacteria 3844
3 JGI25153J46596_10001017 3300003215 Bacteria 17052
4 JGI25153J46596_10015842 3300003215 Bacteria 3049
5 rootL2_10012925 3300003322 Bacteria 4266
6 Ga0055536_1003852 3300003781 Bacteria 7892
7 Ga0055531_10020317 3300003794 Bacteria 2633
8 Ga0068869_100045254 3300005334 Bacteria 3168
9 Ga0070674_100079319 3300005356 Bacteria 2342
10 Ga0070659_100476065 3300005366 Bacteria 1062
11 Ga0070667_100086762 3300005367 Bacteria 2686
12 Ga0070667_100281319 3300005367 Bacteria 1494
13 Ga0070713_100618980 3300005436 Bacteria 1030
14 Ga0068867_100021641 3300005459 Bacteria 4589
15 Ga0068867_100142232 3300005459 Bacteria 1876
16 Ga0070706_100007365 3300005467 Bacteria 10323
17 Ga0070707_100150946 3300005468 Bacteria 2262
18 Ga0070698_100000629 3300005471 Bacteria 37984
19 Ga0070698_100058728 3300005471 Bacteria 3888
20 Ga0070699_100038600 3300005518 Bacteria 4135
21 Ga0070695_100005993 3300005545 Bacteria 7178
22 Ga0070696_100185404 3300005546 Bacteria 1546
23 Ga0068855_100585449 3300005563 Bacteria 1205
24 Ga0068857_100042264 3300005577 Bacteria 4043
25 Ga0068852_100017171 3300005616 Bacteria 5671
26 Ga0068859_100721162 3300005617 Bacteria 1087
27 Ga0068864_100502346 3300005618 Bacteria 1167
28 Ga0068866_10007922 3300005718 Bacteria 4461
29 Ga0068861_100000302 3300005719 Bacteria 27656
30 Ga0068861_100554228 3300005719 Bacteria 1048
31 Ga0068858_100059128 3300005842 Bacteria 3543
32 Ga0068858_100341025 3300005842 Bacteria 1434
33 Ga0068860_100002702 3300005843 Bacteria 18453
34 Ga0068862_100001956 3300005844 Bacteria 18681
35 Ga0068862_100258305 3300005844 Bacteria 1589
36 Ga0081455_10003599 3300005937 Bacteria 17790
37 Ga0081455_10026302 3300005937 Bacteria 5357
38 Ga0081455_10029103 3300005937 Bacteria 5039
39 Ga0081455_10276890 3300005937 Bacteria 1214
40 Ga0081539_10028749 3300005985 Bacteria 3490
41 Ga0075363_100058382 3300006048 Bacteria 2072
42 Ga0075363_100129999 3300006048 Bacteria 1412
43 Ga0075367_10009987 3300006178 Bacteria 4975
44 Ga0075367_10010597 3300006178 Bacteria 4848
45 Ga0075369_10020811 3300006186 Bacteria 2689
46 Ga0075369_10033476 3300006186 Bacteria 2178
47 Ga0075366_10027797 3300006195 Bacteria 3319
48 Ga0075366_10031039 3300006195 Bacteria 3143
49 Ga0075366_10037486 3300006195 Bacteria 2863
50 Ga0075366_10077097 3300006195 Bacteria 1989
51 Ga0075370_10127417 3300006353 Bacteria 1484
52 Ga0097620_100721272 3300006931 Bacteria 1087
53 Ga0111539_10000042 3300009094 Bacteria 129513
54 Ga0105245_10455954 3300009098 Bacteria 1288
55 Ga0114129_10462696 3300009147 Bacteria 1662
56 Ga0105243_10218477 3300009148 Bacteria 1683
57 Ga0105237_10025464 3300009545 Bacteria 6050
58 Ga0105238_10029835 3300009551 Bacteria 5555
59 Ga0105249_10016619 3300009553 Bacteria 6532
60 Ga0105239_10044089 3300010375 Bacteria 4889
61 Ga0157378_10005771 3300013297 Bacteria 10843
62 Ga0163162_10000408 3300013306 Bacteria 39422
63 Ga0157372_10168315 3300013307 Bacteria 2535
64 Ga0157379_10042204 3300014968 Bacteria 4072
65 Ga0157379_10242979 3300014968 Bacteria 1633
66 Ga0163161_10024825 3300017792 Bacteria 4237
67 Ga0213872_10001290 3300021361 Bacteria 16734
68 Ga0207425_1006764 3300025245 Bacteria 3101
69 Ga0209129_1001196 3300025258 Bacteria 14949
70 Ga0209455_1001167 3300025272 Bacteria 12638
71 Ga0209676_1000300 3300025292 Bacteria 100399
72 Ga0209025_1003817 3300025294 Bacteria 13758
73 Ga0209758_1000060 3300025297 Bacteria 324326
74 Ga0209758_1000592 3300025297 Bacteria 56476
75 Ga0209050_1005549 3300025298 Bacteria 7865
76 Ga0209050_1005850 3300025298 Bacteria 7535
77 Ga0209257_1000297 3300025304 Bacteria 109481
78 Ga0209257_1044479 3300025304 Bacteria 1295
79 Ga0207645_10045924 3300025907 Bacteria 2791
80 Ga0207695_10073198 3300025913 Bacteria 3493
81 Ga0207694_10035098 3300025924 Bacteria 3846
82 Ga0207690_10184604 3300025932 Bacteria 1573
83 Ga0207706_10182617 3300025933 Bacteria 1842
84 Ga0207669_10043129 3300025937 Bacteria 2640
85 Ga0207665_10043071 3300025939 Bacteria 3018
86 Ga0207689_10198534 3300025942 Bacteria 1656
87 Ga0207667_10569075 3300025949 Bacteria 1145
88 Ga0207658_10376615 3300025986 Bacteria 1242
89 Ga0207677_10353542 3300026023 Bacteria 1232
90 Ga0207703_10379458 3300026035 Bacteria 1307
91 Ga0207678_10004586 3300026067 Bacteria 12423
92 Ga0207648_10002057 3300026089 Bacteria 21925
93 Ga0207648_10054062 3300026089 Bacteria 3508
94 Ga0207648_10162366 3300026089 Bacteria 1973
95 Ga0207674_10019597 3300026116 Bacteria 7324
96 Ga0207674_10057165 3300026116 Bacteria 3955
97 Ga0207674_10172208 3300026116 Bacteria 2118
98 Ga0207675_100001959 3300026118 Bacteria 20579
99 Ga0207428_10000110 3300027907 Bacteria 111885
100 Ga0268265_10240090 3300028380 Bacteria 1598
101 Ga0265334_10103813 3300028573 Bacteria 1026
102 Ga0265318_10004410 3300028577 Bacteria 6830
103 Ga0307515_10000020 3300028794 Bacteria 411735
104 Ga0307515_10000051 3300028794 Bacteria 272100
105 Ga0307515_10000053 3300028794 Bacteria 266512
106 Ga0307515_10000305 3300028794 Bacteria 121634
107 Ga0307515_10292952 3300028794 Bacteria 1321
108 Ga0265338_10081068 3300028800 Bacteria 2723
109 Ga0307512_10080857 3300030522 Bacteria 2336
110 Ga0265330_10006199 3300031235 Bacteria 5919
111 Ga0265332_10000015 3300031238 Bacteria 243944
112 Ga0265325_10004328 3300031241 Bacteria 8993
113 Ga0265325_10017584 3300031241 Bacteria 3973
114 Ga0265325_10164791 3300031241 Bacteria 1041
115 Ga0265329_10018251 3300031242 Bacteria 2402
116 Ga0265340_10056529 3300031247 Bacteria 1887
117 Ga0265340_10062660 3300031247 Bacteria 1776
118 Ga0265339_10000227 3300031249 Bacteria 45452
119 Ga0265331_10029097 3300031250 Bacteria 2759
120 Ga0265316_10007778 3300031344 Bacteria 10038
121 Ga0265316_10029386 3300031344 Bacteria 4521
122 Ga0265316_10281602 3300031344 Bacteria 1215
123 Ga0307513_10035100 3300031456 Bacteria 5617
124 Ga0307513_10036230 3300031456 Bacteria 5509
125 Ga0307513_10044969 3300031456 Bacteria 4831
126 Ga0307513_10224790 3300031456 Bacteria 1695
127 Ga0307513_10379310 3300031456 Bacteria 1154
128 Ga0307408_100062181 3300031548 Bacteria 2728
129 Ga0265313_10000048 3300031595 Bacteria 112723
130 Ga0265313_10017810 3300031595 Bacteria 4015
131 Ga0307508_10000072 3300031616 Bacteria 118449
132 Ga0307508_10034725 3300031616 Bacteria 4544
133 Ga0307514_10032782 3300031649 Bacteria 4152
134 Ga0265314_10116375 3300031711 Bacteria 1690
135 Ga0265342_10009957 3300031712 Bacteria 6643
136 Ga0265342_10042044 3300031712 Bacteria 2763
137 Ga0307516_10010499 3300031730 Bacteria 10170
138 Ga0307516_10060299 3300031730 Bacteria 3687
139 Ga0307516_10095248 3300031730 Bacteria 2800
140 Ga0307416_100109697 3300032002 Bacteria 2428
141 Ga0307416_100186170 3300032002 Bacteria 1952
142 Ga0307507_10046118 3300033179 Bacteria 4277
143 Ga0373949_0037061 3300035090 Bacteria 1185
144 Ga0373932_0021542 3300035112 Bacteria 1703
145 Ga0373936_0012146 3300035113 Bacteria 3271
146 Ga0373954_0217811 3300035118 Bacteria 939
147 Ga0373957_0068140 3300035120 Bacteria 1388
148 Ga0373931_0161171 3300035691 Bacteria 1315
149 Ga0373931_0182990 3300035691 Bacteria 1242
150 Ga0373935_0106818 3300035692 Bacteria 1853
151 Ga0373937_0201200 3300036401 Bacteria 1872
152 Ga0373937_0207422 3300036401 Bacteria 1843
153 Ga0373925_0083410 3300037068 Bacteria 2434
154 Ga0395900_0398420 3300037418 Bacteria 1341
155 Ga0436364_1419281 3300037853 Bacteria 1307
156 Ga0436361_0090832 3300039447 Bacteria 34932
157 Ga0451802_1107540 3300041460 Bacteria 1444
158 Ga0451577_0008458 3300042876 Bacteria 10014
159 Ga0451577_0012781 3300042876 Bacteria 7877
160 Ga0451577_0050989 3300042876 Bacteria 3694
161 Ga0451577_0200990 3300042876 Bacteria 1799
162 Ga0453683_0006217 3300044673 Bacteria 8215
163 Ga0453684_0000365 3300044712 Bacteria 186233
164 Ga0453684_0165225 3300044712 Bacteria 2613
165 Ga0451576_0023440 3300045051 Bacteria 6682
166 Ga0451576_0073543 3300045051 Bacteria 3557
167 Ga0451576_0283372 3300045051 Bacteria 1732
168 Ga0451576_0483672 3300045051 Bacteria 1300
169 Ga0495617_029983 3300046452 Bacteria 1829
170 Ga0495603_0233457 3300046455 Bacteria 1060
171 Ga0495580_0219091 3300046472 Bacteria 1308
172 Ga0495582_0080726 3300046473 Bacteria 1806
173 Ga0495585_0009206 3300046492 Bacteria 5941
174 Ga0495583_0023579 3300046506 Bacteria 3110
175 Ga0495583_0058522 3300046506 Bacteria 1730
176 Ga0495606_0118205 3300046507 Bacteria 1590
177 Ga0495608_0148794 3300046511 Bacteria 1493
178 Ga0495610_0010872 3300046512 Bacteria 5618
179 Ga0495610_0035499 3300046512 Bacteria 2559
180 Ga0495610_0067154 3300046512 Bacteria 1686
181 Ga0495616_0030848 3300046513 Bacteria 2812
182 Ga0495620_0110106 3300046515 Bacteria 1092
183 Ga0495631_0010888 3300046518 Bacteria 4490
184 Ga0495632_0011716 3300046519 Bacteria 5104
185 Ga0495632_0071725 3300046519 Bacteria 1663
186 Ga0495643_0063231 3300046522 Bacteria 1958
187 Ga0495643_0071996 3300046522 Bacteria 1813
188 Ga0495643_0094943 3300046522 Bacteria 1534
189 Ga0495642_0162772 3300046528 Bacteria 968
190 Ga0495597_0024004 3300046542 Bacteria 2817
191 Ga0495645_0217667 3300046543 Bacteria 1286
192 Ga0495625_0008980 3300046660 Bacteria 8442
193 Ga0495625_0020081 3300046660 Bacteria 5164
194 Ga0495647_0044390 3300046681 Bacteria 1705
195 Ga0495658_0021252 3300046683 Bacteria 3420
196 Ga0495670_0025162 3300046691 Bacteria 2944
197 Ga0495649_0109661 3300046694 Bacteria 1464
198 Ga0495660_0045828 3300046810 Bacteria 2399
199 Ga0495687_000147 3300047443 Bacteria 107007
200 Ga0495687_035273 3300047443 Bacteria 2250
201 Ga0495677_0080055 3300047445 Bacteria 1224
202 Ga0495684_0114711 3300047471 Bacteria 2031
203 Ga0495686_0104888 3300047472 Bacteria 1701
204 Ga0495626_0108815 3300048091 Bacteria 1202
205 Ga0496106_0004656 3300048909 Bacteria 10169
206 Ga0496106_0248103 3300048909 Bacteria 1423
207 Ga0496121_0022932 3300048924 Bacteria 6032
208 Ga0496121_0201648 3300048924 Bacteria 1417
209 Ga0496122_0048028 3300048925 Bacteria 3288
210 Ga0496123_0132314 3300048926 Bacteria 1379
211 Ga0496123_0159685 3300048926 Bacteria 1203
212 Ga0496124_0118953 3300048927 Bacteria 2114
213 Ga0496125_0056691 3300048928 Bacteria 3179
214 Ga0496125_0077273 3300048928 Bacteria 2567
215 Ga0496126_0089966 3300048929 Bacteria 2701
216 Ga0496126_0232637 3300048929 Bacteria 1543
217 Ga0495678_012849 3300049459 Bacteria 3952
218 Ga0501032_0000075 3300049569 Bacteria 84153
219 Ga0501033_0000216 3300049570 Bacteria 55449
220 Ga0501034_0000476 3300049571 Bacteria 65960
221 Ga0501034_0167009 3300049571 Bacteria 2169
222 Ga0501036_0000540 3300049572 Bacteria 27084
223 Ga0501036_0255581 3300049572 Bacteria 1468
224 Ga0501037_0000021 3300049573 Bacteria 150037
225 Ga0501038_0000032 3300049574 Bacteria 131432
226 Ga0501039_0000025 3300049575 Bacteria 152236
227 Ga0501040_0280480 3300049576 Bacteria 1190
228 Ga0501043_0000570 3300049579 Bacteria 32944
229 Ga0501043_0282195 3300049579 Bacteria 1273
230 Ga0501047_0478363 3300049581 Bacteria 1073
231 Ga0501067_0081691 3300049583 Bacteria 1792
232 Ga0501070_0310176 3300049586 Bacteria 1284
233 Ga0501072_0194197 3300049588 Bacteria 1619
234 Ga0501073_0002930 3300049589 Bacteria 12804
235 Ga0501073_0218617 3300049589 Bacteria 1316
236 Ga0501073_0275253 3300049589 Bacteria 1161
237 Ga0501074_0113492 3300049590 Bacteria 1939
238 Ga0501076_0278516 3300049592 Bacteria 1370
239 Ga0501080_0178639 3300049742 Bacteria 1954
240 Ga0501080_0266025 3300049742 Bacteria 1561
241 Ga0501083_0213949 3300049744 Bacteria 1256
242 Ga0501035_0000085 3300049822 Bacteria 116189
243 Ga0501044_0071942 3300049823 Bacteria 3516
244 nmdc:mga03683_38230_c1 3300050489 Bacteria 1959
245 nmdc:mga00v17_183608_c1 3300050491 Bacteria 1350
246 nmdc:mga0k408_136826_c1 3300050493 Bacteria 1456
247 nmdc:mga0k408_55569_c1 3300050493 Bacteria 2296
248 nmdc:mga07m45_10548_c1 3300050496 Bacteria 4830
249 nmdc:mga07m45_16309_c1 3300050496 Bacteria 3977
250 nmdc:mga07m45_19733_c1 3300050496 Bacteria 3654
251 nmdc:mga05p37_389185_c1 3300050507 Bacteria 1631
252 nmdc:mga0qj67_434130_c1 3300050509 Bacteria 1058
253 nmdc:mga08y16_47_c1 3300050511 Bacteria 111829
254 nmdc:mga0a205_8894_c1 3300050515 Bacteria 9151
255 nmdc:mga0sz30_11975_c1 3300050516 Bacteria 3365
256 Ga0500578_0078484 3300053086 Bacteria 2101
257 Ga0500651_0270928 3300053093 Bacteria 982
258 Ga0500594_0011404 3300053118 Bacteria 2074
259 Ga0500642_0013999 3300053130 Bacteria 2970
260 Ga0500658_0048673 3300053134 Bacteria 1724
261 Ga0500658_0050628 3300053134 Bacteria 1696
262 Ga0500658_0093136 3300053134 Bacteria 1306
263 Ga0500658_0155768 3300053134 Bacteria 1032
264 Ga0500568_0011358 3300053139 Bacteria 4137
265 Ga0500577_0035643 3300053142 Bacteria 1776
266 Ga0500604_0010400 3300053151 Bacteria 2489
267 Ga0500616_0000932 3300053153 Bacteria 31998
268 Ga0500616_0002773 3300053153 Bacteria 14146
269 Ga0500622_0010341 3300053156 Bacteria 5127
270 Ga0500587_004935 3300053739 Bacteria 1815
271 Ga0590075_003539 3300059424 Bacteria 3710

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014968 Ga0157379_10242979 Ga0157379_102429792 232
2 3300005618 Ga0068864_100502346 Ga0068864_1005023462 234
3 3300042876 Ga0451577_0008458 Ga0451577_0008458_1060_1926 243
4 3300044673 Ga0453683_0006217 Ga0453683_0006217_4683_5549 243
5 3300044712 Ga0453684_0165225 Ga0453684_0165225_1066_1932 243
6 3300045051 Ga0451576_0283372 Ga0451576_0283372_679_1545 243
7 3300031730 Ga0307516_10095248 Ga0307516_100952483 244
8 3300028800 Ga0265338_10081068 Ga0265338_100810681 248
9 3300031235 Ga0265330_10006199 Ga0265330_100061995 248
10 3300031241 Ga0265325_10004328 Ga0265325_100043283 248
11 3300031242 Ga0265329_10018251 Ga0265329_100182512 248
12 3300031249 Ga0265339_10000227 Ga0265339_1000022737 248
13 3300031250 Ga0265331_10029097 Ga0265331_100290972 248
14 3300031344 Ga0265316_10007778 Ga0265316_100077789 248
15 3300031595 Ga0265313_10000048 Ga0265313_1000004843 248
16 3300031712 Ga0265342_10009957 Ga0265342_100099577 248
17 3300049572 Ga0501036_0255581 Ga0501036_0255581_581_1426 248
18 3300049576 Ga0501040_0280480 Ga0501040_0280480_290_1135 248
19 3300049590 Ga0501074_0113492 Ga0501074_0113492_514_1359 248
20 3300049592 Ga0501076_0278516 Ga0501076_0278516_13_858 248
21 3300046452 Ga0495617_029983 Ga0495617_029983_1011_1811 249
22 3300046512 Ga0495610_0067154 Ga0495610_0067154_745_1578 249
23 3300005937 Ga0081455_10029103 Ga0081455_100291032 250
24 3300009147 Ga0114129_10462696 Ga0114129_104626962 250
25 3300050507 nmdc:mga05p37_389185_c1 nmdc:mga05p37_389185_c1_200_1132 250
26 3300050515 nmdc:mga0a205_8894_c1 nmdc:mga0a205_8894_c1_83_1015 250
27 3300003781 Ga0055536_1003852 Ga0055536_10038526 251
28 3300025292 Ga0209676_1000300 Ga0209676_100030068 251
29 3300025298 Ga0209050_1005850 Ga0209050_10058507 251
30 3300005356 Ga0070674_100079319 Ga0070674_1000793193 252
31 3300005367 Ga0070667_100281319 Ga0070667_1002813192 252
32 3300005459 Ga0068867_100021641 Ga0068867_1000216412 252
33 3300005718 Ga0068866_10007922 Ga0068866_100079225 252
34 3300005719 Ga0068861_100000302 Ga0068861_10000030210 252
35 3300005842 Ga0068858_100059128 Ga0068858_1000591284 252
36 3300005843 Ga0068860_100002702 Ga0068860_10000270214 252
37 3300005844 Ga0068862_100001956 Ga0068862_10000195610 252
38 3300009098 Ga0105245_10455954 Ga0105245_104559542 252
39 3300009553 Ga0105249_10016619 Ga0105249_100166193 252
40 3300013297 Ga0157378_10005771 Ga0157378_100057714 252
41 3300013306 Ga0163162_10000408 Ga0163162_1000040816 252
42 3300014968 Ga0157379_10042204 Ga0157379_100422044 252
43 3300017792 Ga0163161_10024825 Ga0163161_100248254 252
44 3300025937 Ga0207669_10043129 Ga0207669_100431293 252
45 3300025986 Ga0207658_10376615 Ga0207658_103766151 252
46 3300026035 Ga0207703_10379458 Ga0207703_103794582 252
47 3300026089 Ga0207648_10002057 Ga0207648_1000205715 252
48 3300026118 Ga0207675_100001959 Ga0207675_1000019594 252
49 3300028380 Ga0268265_10240090 Ga0268265_102400902 252
50 3300046455 Ga0495603_0233457 Ga0495603_0233457_38_913 252
51 3300046681 Ga0495647_0044390 Ga0495647_0044390_120_995 252
52 3300049588 Ga0501072_0194197 Ga0501072_0194197_103_948 252
53 3300025942 Ga0207689_10198534 Ga0207689_101985342 254
54 3300005937 Ga0081455_10276890 Ga0081455_102768902 257
55 3300031344 Ga0265316_10281602 Ga0265316_102816022 257
56 3300031456 Ga0307513_10036230 Ga0307513_100362303 257
57 3300037418 Ga0395900_0398420 Ga0395900_0398420_58_981 257
58 3300049569 Ga0501032_0000075 Ga0501032_0000075_40018_40896 257
59 3300049570 Ga0501033_0000216 Ga0501033_0000216_41581_42459 257
60 3300049571 Ga0501034_0000476 Ga0501034_0000476_25065_25943 257
61 3300049572 Ga0501036_0000540 Ga0501036_0000540_24624_25502 257
62 3300049573 Ga0501037_0000021 Ga0501037_0000021_108816_109694 257
63 3300049574 Ga0501038_0000032 Ga0501038_0000032_90537_91415 257
64 3300049575 Ga0501039_0000025 Ga0501039_0000025_104806_105684 257
65 3300049579 Ga0501043_0000570 Ga0501043_0000570_25065_25943 257
66 3300049822 Ga0501035_0000085 Ga0501035_0000085_70848_71726 257
67 3300028794 Ga0307515_10000305 Ga0307515_1000030543 258
68 3300031616 Ga0307508_10000072 Ga0307508_10000072101 258
69 3300031649 Ga0307514_10032782 Ga0307514_100327822 258
70 3300033179 Ga0307507_10046118 Ga0307507_100461184 258
71 3300006195 Ga0075366_10077097 Ga0075366_100770972 259
72 3300028794 Ga0307515_10000051 Ga0307515_10000051167 260
73 3300031456 Ga0307513_10035100 Ga0307513_100351002 260
74 3300032002 Ga0307416_100109697 Ga0307416_1001096973 260
75 3300037853 Ga0436364_1419281 Ga0436364_1419281_10_855 260
76 3300042876 Ga0451577_0200990 Ga0451577_0200990_471_1409 262
77 3300045051 Ga0451576_0483672 Ga0451576_0483672_292_1230 262
78 3300030522 Ga0307512_10080857 Ga0307512_100808573 263
79 3300031730 Ga0307516_10010499 Ga0307516_100104994 263
80 3300041460 Ga0451802_1107540 Ga0451802_1107540_159_1016 263
81 3300046512 Ga0495610_0035499 Ga0495610_0035499_219_1076 263
82 3300046515 Ga0495620_0110106 Ga0495620_0110106_201_1058 263
83 3300046519 Ga0495632_0071725 Ga0495632_0071725_731_1588 263
84 3300046522 Ga0495643_0094943 Ga0495643_0094943_612_1469 263
85 3300046543 Ga0495645_0217667 Ga0495645_0217667_25_900 263
86 3300046660 Ga0495625_0020081 Ga0495625_0020081_3046_3903 263
87 3300047472 Ga0495686_0104888 Ga0495686_0104888_248_1105 263
88 3300050493 nmdc:mga0k408_136826_c1 nmdc:mga0k408_136826_c1_417_1274 263
89 3300053093 Ga0500651_0270928 Ga0500651_0270928_86_952 263
90 3300053739 Ga0500587_004935 Ga0500587_004935_451_1308 263
91 3300005617 Ga0068859_100721162 Ga0068859_1007211622 264
92 3300006931 Ga0097620_100721272 Ga0097620_1007212722 264
93 3300028794 Ga0307515_10292952 Ga0307515_102929522 264
94 3300031456 Ga0307513_10044969 Ga0307513_100449693 264
95 3300035113 Ga0373936_0012146 Ga0373936_0012146_2081_2986 264
96 iso_pu_bacteria 2585428062 2587759580 264
97 3300005367 Ga0070667_100086762 Ga0070667_1000867623 265
98 3300025907 Ga0207645_10045924 Ga0207645_100459241 265
99 3300003215 JGI25153J46596_10001017 JGI25153J46596_100010172 266
100 3300005719 Ga0068861_100554228 Ga0068861_1005542282 266
101 3300005844 Ga0068862_100258305 Ga0068862_1002583052 266
102 3300009148 Ga0105243_10218477 Ga0105243_102184772 266
103 3300025297 Ga0209758_1000060 Ga0209758_1000060345 266
104 3300028794 Ga0307515_10000020 Ga0307515_10000020180 266
105 3300028794 Ga0307515_10000053 Ga0307515_10000053207 266
106 3300021361 Ga0213872_10001290 Ga0213872_100012907 267
107 3300039447 Ga0436361_0090832 Ga0436361_0090832_6584_7480 267
108 3300049571 Ga0501034_0167009 Ga0501034_0167009_27_911 267
109 3300059424 Ga0590075_003539 Ga0590075_003539_2479_3372 268
110 3300005334 Ga0068869_100045254 Ga0068869_1000452543 269
111 3300005366 Ga0070659_100476065 Ga0070659_1004760651 269
112 3300005459 Ga0068867_100142232 Ga0068867_1001422322 269
113 3300005467 Ga0070706_100007365 Ga0070706_1000073656 269
114 3300005563 Ga0068855_100585449 Ga0068855_1005854492 269
115 3300005577 Ga0068857_100042264 Ga0068857_1000422643 269
116 3300005616 Ga0068852_100017171 Ga0068852_1000171714 269
117 3300005842 Ga0068858_100341025 Ga0068858_1003410251 269
118 3300006048 Ga0075363_100129999 Ga0075363_1001299992 269
119 3300006178 Ga0075367_10009987 Ga0075367_100099873 269
120 3300006195 Ga0075366_10027797 Ga0075366_100277973 269
121 3300006195 Ga0075366_10031039 Ga0075366_100310393 269
122 3300006195 Ga0075366_10037486 Ga0075366_100374863 269
123 3300009545 Ga0105237_10025464 Ga0105237_100254645 269
124 3300009551 Ga0105238_10029835 Ga0105238_100298354 269
125 3300010375 Ga0105239_10044089 Ga0105239_100440895 269
126 3300025913 Ga0207695_10073198 Ga0207695_100731982 269
127 3300025924 Ga0207694_10035098 Ga0207694_100350982 269
128 3300025932 Ga0207690_10184604 Ga0207690_101846042 269
129 3300025933 Ga0207706_10182617 Ga0207706_101826172 269
130 3300025939 Ga0207665_10043071 Ga0207665_100430713 269
131 3300026023 Ga0207677_10353542 Ga0207677_103535422 269
132 3300026067 Ga0207678_10004586 Ga0207678_100045862 269
133 3300026089 Ga0207648_10054062 Ga0207648_100540622 269
134 3300026089 Ga0207648_10162366 Ga0207648_101623662 269
135 3300026116 Ga0207674_10057165 Ga0207674_100571653 269
136 3300031241 Ga0265325_10017584 Ga0265325_100175844 269
137 3300031247 Ga0265340_10056529 Ga0265340_100565291 269
138 3300031456 Ga0307513_10224790 Ga0307513_102247902 269
139 3300031595 Ga0265313_10017810 Ga0265313_100178104 269
140 3300031711 Ga0265314_10116375 Ga0265314_101163752 269
141 3300031712 Ga0265342_10042044 Ga0265342_100420442 269
142 3300035691 Ga0373931_0161171 Ga0373931_0161171_250_1164 269
143 3300036401 Ga0373937_0207422 Ga0373937_0207422_802_1722 269
144 3300046522 Ga0495643_0063231 Ga0495643_0063231_129_1022 269
145 3300046542 Ga0495597_0024004 Ga0495597_0024004_692_1585 269
146 3300047443 Ga0495687_000147 Ga0495687_000147_88732_89625 269
147 3300048091 Ga0495626_0108815 Ga0495626_0108815_214_1107 269
148 3300050489 nmdc:mga03683_38230_c1 nmdc:mga03683_38230_c1_100_987 269
149 3300050491 nmdc:mga00v17_183608_c1 nmdc:mga00v17_183608_c1_342_1229 269
150 3300050496 nmdc:mga07m45_16309_c1 nmdc:mga07m45_16309_c1_1956_2843 269
151 3300053134 Ga0500658_0093136 Ga0500658_0093136_258_1142 269
152 3300053139 Ga0500568_0011358 Ga0500568_0011358_1028_1912 269
153 3300053153 Ga0500616_0002773 Ga0500616_0002773_11027_11911 269
154 3300005468 Ga0070707_100150946 Ga0070707_1001509463 270
155 3300005518 Ga0070699_100038600 Ga0070699_1000386005 270
156 3300006048 Ga0075363_100058382 Ga0075363_1000583823 270
157 3300006178 Ga0075367_10010597 Ga0075367_100105974 270
158 3300006186 Ga0075369_10033476 Ga0075369_100334762 270
159 3300025949 Ga0207667_10569075 Ga0207667_105690752 270
160 3300026116 Ga0207674_10172208 Ga0207674_101722082 270
161 3300031548 Ga0307408_100062181 Ga0307408_1000621813 270
162 3300031730 Ga0307516_10060299 Ga0307516_100602992 270
163 3300035118 Ga0373954_0217811 Ga0373954_0217811_20_892 270
164 3300035120 Ga0373957_0068140 Ga0373957_0068140_442_1314 270
165 3300035692 Ga0373935_0106818 Ga0373935_0106818_955_1827 270
166 3300036401 Ga0373937_0201200 Ga0373937_0201200_329_1201 270
167 3300045051 Ga0451576_0073543 Ga0451576_0073543_99_1007 270
168 3300046472 Ga0495580_0219091 Ga0495580_0219091_407_1279 270
169 3300046473 Ga0495582_0080726 Ga0495582_0080726_603_1475 270
170 3300046492 Ga0495585_0009206 Ga0495585_0009206_4725_5609 270
171 3300046506 Ga0495583_0023579 Ga0495583_0023579_863_1747 270
172 3300046511 Ga0495608_0148794 Ga0495608_0148794_425_1297 270
173 3300046513 Ga0495616_0030848 Ga0495616_0030848_530_1414 270
174 3300046518 Ga0495631_0010888 Ga0495631_0010888_974_1858 270
175 3300046660 Ga0495625_0008980 Ga0495625_0008980_2674_3558 270
176 3300046683 Ga0495658_0021252 Ga0495658_0021252_2226_3098 270
177 3300046691 Ga0495670_0025162 Ga0495670_0025162_664_1548 270
178 3300047445 Ga0495677_0080055 Ga0495677_0080055_15_899 270
179 3300047471 Ga0495684_0114711 Ga0495684_0114711_112_984 270
180 3300049459 Ga0495678_012849 Ga0495678_012849_2539_3423 270
181 3300050493 nmdc:mga0k408_55569_c1 nmdc:mga0k408_55569_c1_332_1216 270
182 3300050496 nmdc:mga07m45_19733_c1 nmdc:mga07m45_19733_c1_1878_2762 270
183 3300050516 nmdc:mga0sz30_11975_c1 nmdc:mga0sz30_11975_c1_1781_2665 270
184 3300053086 Ga0500578_0078484 Ga0500578_0078484_720_1604 270
185 3300053118 Ga0500594_0011404 Ga0500594_0011404_137_1021 270
186 3300003322 rootL2_10012925 rootL2_100129252 271
187 3300006353 Ga0075370_10127417 Ga0075370_101274172 271
188 3300042876 Ga0451577_0012781 Ga0451577_0012781_1768_2658 271
189 3300044712 Ga0453684_0000365 Ga0453684_0000365_4619_5509 271
190 3300045051 Ga0451576_0023440 Ga0451576_0023440_1582_2472 271
191 3300046506 Ga0495583_0058522 Ga0495583_0058522_382_1281 271
192 3300046519 Ga0495632_0011716 Ga0495632_0011716_1469_2368 271
193 3300046528 Ga0495642_0162772 Ga0495642_0162772_25_924 271
194 3300046810 Ga0495660_0045828 Ga0495660_0045828_1380_2279 271
195 3300047443 Ga0495687_035273 Ga0495687_035273_413_1306 271
196 3300050496 nmdc:mga07m45_10548_c1 nmdc:mga07m45_10548_c1_3001_3900 271
197 3300053134 Ga0500658_0048673 Ga0500658_0048673_390_1283 271
198 3300005436 Ga0070713_100618980 Ga0070713_1006189801 272
199 3300005937 Ga0081455_10026302 Ga0081455_100263026 272
200 3300013307 Ga0157372_10168315 Ga0157372_101683152 272
201 3300028573 Ga0265334_10103813 Ga0265334_101038132 272
202 3300035112 Ga0373932_0021542 Ga0373932_0021542_387_1295 272
203 3300003794 Ga0055531_10020317 Ga0055531_100203173 273
204 3300025298 Ga0209050_1005549 Ga0209050_10055495 273
205 3300025304 Ga0209257_1000297 Ga0209257_100029790 273
206 3300028577 Ga0265318_10004410 Ga0265318_100044103 273
207 3300031344 Ga0265316_10029386 Ga0265316_100293862 273
208 3300031616 Ga0307508_10034725 Ga0307508_100347253 273
209 3300005471 Ga0070698_100058728 Ga0070698_1000587282 274
210 3300005545 Ga0070695_100005993 Ga0070695_1000059934 274
211 3300005546 Ga0070696_100185404 Ga0070696_1001854042 274
212 3300005985 Ga0081539_10028749 Ga0081539_100287493 274
213 3300009094 Ga0111539_10000042 Ga0111539_10000042124 274
214 3300025304 Ga0209257_1044479 Ga0209257_10444792 274
215 3300027907 Ga0207428_10000110 Ga0207428_1000011080 274
216 3300031238 Ga0265332_10000015 Ga0265332_10000015108 274
217 3300031241 Ga0265325_10164791 Ga0265325_101647911 274
218 3300031456 Ga0307513_10379310 Ga0307513_103793102 274
219 3300032002 Ga0307416_100186170 Ga0307416_1001861702 274
220 3300035090 Ga0373949_0037061 Ga0373949_0037061_173_1087 274
221 3300035691 Ga0373931_0182990 Ga0373931_0182990_87_998 274
222 3300042876 Ga0451577_0050989 Ga0451577_0050989_2098_3012 274
223 3300046507 Ga0495606_0118205 Ga0495606_0118205_314_1198 274
224 3300049579 Ga0501043_0282195 Ga0501043_0282195_213_1124 274
225 3300049583 Ga0501067_0081691 Ga0501067_0081691_267_1178 274
226 3300049586 Ga0501070_0310176 Ga0501070_0310176_49_957 274
227 3300049589 Ga0501073_0218617 Ga0501073_0218617_91_990 274
228 3300049589 Ga0501073_0275253 Ga0501073_0275253_235_1146 274
229 3300049742 Ga0501080_0178639 Ga0501080_0178639_61_972 274
230 3300049742 Ga0501080_0266025 Ga0501080_0266025_144_1055 274
231 3300049744 Ga0501083_0213949 Ga0501083_0213949_15_908 274
232 3300049823 Ga0501044_0071942 Ga0501044_0071942_2294_3202 274
233 3300050509 nmdc:mga0qj67_434130_c1 nmdc:mga0qj67_434130_c1_17_910 274
234 3300050511 nmdc:mga08y16_47_c1 nmdc:mga08y16_47_c1_41122_42015 274
235 3300053130 Ga0500642_0013999 Ga0500642_0013999_1088_1984 274
236 3300053134 Ga0500658_0050628 Ga0500658_0050628_514_1425 274
237 3300053134 Ga0500658_0155768 Ga0500658_0155768_99_995 274
238 3300053142 Ga0500577_0035643 Ga0500577_0035643_38_934 274
239 3300053151 Ga0500604_0010400 Ga0500604_0010400_549_1460 274
240 3300053153 Ga0500616_0000932 Ga0500616_0000932_15312_16250 274
241 3300025272 Ga0209455_1001167 Ga0209455_100116711 275
242 3300048928 Ga0496125_0077273 Ga0496125_0077273_650_1561 275
243 3300048929 Ga0496126_0089966 Ga0496126_0089966_685_1596 275
244 3300049581 Ga0501047_0478363 Ga0501047_0478363_77_1000 275
245 3300049589 Ga0501073_0002930 Ga0501073_0002930_10740_11675 275
246 iso_pu_bacteria 2837678835 2837683683 275
247 3300005937 Ga0081455_10003599 Ga0081455_1000359912 276
248 3300026116 Ga0207674_10019597 Ga0207674_100195973 276
249 3300031247 Ga0265340_10062660 Ga0265340_100626602 276
250 3300037068 Ga0373925_0083410 Ga0373925_0083410_273_1190 276
251 3300048909 Ga0496106_0248103 Ga0496106_0248103_36_920 276
252 3300048924 Ga0496121_0022932 Ga0496121_0022932_3667_4551 276
253 3300048924 Ga0496121_0201648 Ga0496121_0201648_25_909 276
254 3300048926 Ga0496123_0132314 Ga0496123_0132314_408_1292 276
255 3300048929 Ga0496126_0232637 Ga0496126_0232637_229_1113 276
256 iso_pu_bacteria 2917554339 2917557837 276
257 3300002773 JGI25152J39213_1006769 JGI25152J39213_10067693 277
258 3300003187 JGI25151J46595_10012578 JGI25151J46595_100125783 277
259 3300003215 JGI25153J46596_10015842 JGI25153J46596_100158423 277
260 3300005471 Ga0070698_100000629 Ga0070698_1000006294 277
261 3300006186 Ga0075369_10020811 Ga0075369_100208111 277
262 3300025245 Ga0207425_1006764 Ga0207425_10067643 277
263 3300025258 Ga0209129_1001196 Ga0209129_100119611 277
264 3300025294 Ga0209025_1003817 Ga0209025_100381714 277
265 3300025297 Ga0209758_1000592 Ga0209758_100059268 277
266 3300046512 Ga0495610_0010872 Ga0495610_0010872_107_991 277
267 3300046522 Ga0495643_0071996 Ga0495643_0071996_640_1524 277
268 3300046694 Ga0495649_0109661 Ga0495649_0109661_46_930 277
269 3300048909 Ga0496106_0004656 Ga0496106_0004656_2686_3570 277
270 3300048925 Ga0496122_0048028 Ga0496122_0048028_1805_2689 277
271 3300048926 Ga0496123_0159685 Ga0496123_0159685_114_998 277
272 3300048927 Ga0496124_0118953 Ga0496124_0118953_494_1378 277
273 3300048928 Ga0496125_0056691 Ga0496125_0056691_625_1509 277
274 3300053156 Ga0500622_0010341 Ga0500622_0010341_1449_2333 277

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

140

322

0.89

Feature Viewer

pLDDT pTM Quality
64.45 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map