F380009

General Info

Members Datasets Scaffolds Average Seq Length
274 177 548 299

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0149565|Ga0501039_0149565_647_1699
Length 350
Sequence MAKGSDRDDAKPDQPRSEKKRRQEVARLIEPFRVADGRGFRLRDFDPADTRGVGSKEEAQEYLKRGVVQLAAMQDRLYAQDQWGMLLIFQAMDAAGKDGAIKHVMSGINPQGCQVYSFKAPTNEELDHDYLWRTSRSLPERGRIGVFNRSYYEEVLVVRVHPEILEHQKLPRPLITKKVWAERYEDIRSFERYLSRQGYVVLKFFLNVSKQAQRDRFLERLERPEKNWKFSLADAKERRYWKDYMRAYEDAIRETAAEHAPWFVVPADKKWFARVIVAAAIYDALAHLGLRYPEVGPEKRKELAAARSELLHRDGVKGGAGKRRTRTKPRRKGGAAEADAARQPEPAAAG

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
126 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
127 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
174 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.01
Rhizosphere 95.62
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0149565 3300049575 Bacteria 1835
2 Ga0065715_10014392 3300005293 Bacteria 2744
3 Ga0065707_10002205 3300005295 Bacteria 4864
4 Ga0065707_10150007 3300005295 Bacteria 1658
5 Ga0065707_10153797 3300005295 Bacteria 1630
6 Ga0070690_100034912 3300005330 Bacteria 3153
7 Ga0068869_100190830 3300005334 Bacteria 1611
8 Ga0070666_10009961 3300005335 Bacteria 5932
9 Ga0070680_100200975 3300005336 Bacteria 1681
10 Ga0070689_100087867 3300005340 Bacteria 2446
11 Ga0070675_100316572 3300005354 Bacteria 1378
12 Ga0070671_100045839 3300005355 Bacteria 3635
13 Ga0070674_100018623 3300005356 Bacteria 4395
14 Ga0070673_100005004 3300005364 Bacteria 8451
15 Ga0070673_100006100 3300005364 Bacteria 7809
16 Ga0070659_100102968 3300005366 Bacteria 2299
17 Ga0070709_10013046 3300005434 Bacteria 4665
18 Ga0070714_100313790 3300005435 Bacteria 1464
19 Ga0070713_100118414 3300005436 Bacteria 2319
20 Ga0070710_10011613 3300005437 Bacteria 4355
21 Ga0070711_100001862 3300005439 Bacteria 11790
22 Ga0070705_100085970 3300005440 Bacteria 1946
23 Ga0070705_100105732 3300005440 Bacteria 1788
24 Ga0070708_100013956 3300005445 Bacteria 6602
25 Ga0070678_100089917 3300005456 Bacteria 2351
26 Ga0068867_100043804 3300005459 Bacteria 3277
27 Ga0068867_100065839 3300005459 Bacteria 2698
28 Ga0070707_100265034 3300005468 Bacteria 1671
29 Ga0070698_100000158 3300005471 Bacteria 61818
30 Ga0070699_100026931 3300005518 Bacteria 4959
31 Ga0070699_100316625 3300005518 Bacteria 1401
32 Ga0070697_100255222 3300005536 Bacteria 1500
33 Ga0070672_100391578 3300005543 Bacteria 1190
34 Ga0070686_100079899 3300005544 Bacteria 2163
35 Ga0070693_100008382 3300005547 Bacteria 5093
36 Ga0070665_100011020 3300005548 Bacteria 9138
37 Ga0070664_100454066 3300005564 Bacteria 1177
38 Ga0068854_100036774 3300005578 Bacteria 3434
39 Ga0068854_100058649 3300005578 Bacteria 2779
40 Ga0070702_100044768 3300005615 Bacteria 2500
41 Ga0068859_100075476 3300005617 Bacteria 3412
42 Ga0068864_100092424 3300005618 Bacteria 2671
43 Ga0068864_100191097 3300005618 Bacteria 1877
44 Ga0068863_100000636 3300005841 Bacteria 35534
45 Ga0068858_100001339 3300005842 Bacteria 25415
46 Ga0068860_100055543 3300005843 Bacteria 3765
47 Ga0068860_100162019 3300005843 Bacteria 2157
48 Ga0068862_100218927 3300005844 Bacteria 1723
49 Ga0068862_100267631 3300005844 Bacteria 1562
50 Ga0081455_10093694 3300005937 Bacteria 2427
51 Ga0081539_10006624 3300005985 Bacteria 10996
52 Ga0070717_10071848 3300006028 Bacteria 2888
53 Ga0070716_100098294 3300006173 Bacteria 1788
54 Ga0070712_100005832 3300006175 Bacteria 7622
55 Ga0075428_100003168 3300006844 Bacteria 17978
56 Ga0075428_100053671 3300006844 Bacteria 4416
57 Ga0075428_100115318 3300006844 Bacteria 2926
58 Ga0075430_100042860 3300006846 Bacteria 3826
59 Ga0075430_100137522 3300006846 Bacteria 2035
60 Ga0075431_100093436 3300006847 Bacteria 3104
61 Ga0075431_100112003 3300006847 Bacteria 2816
62 Ga0075433_10001491 3300006852 Bacteria 17298
63 Ga0075433_10145129 3300006852 Bacteria 2110
64 Ga0075433_10145267 3300006852 Bacteria 2109
65 Ga0075434_100000403 3300006871 Bacteria 31843
66 Ga0075434_100006512 3300006871 Bacteria 10709
67 Ga0075434_100128393 3300006871 Bacteria 2553
68 Ga0075434_100376552 3300006871 Bacteria 1440
69 Ga0075434_100448138 3300006871 Bacteria 1312
70 Ga0075436_100032946 3300006914 Unclassified 3570
71 Ga0075436_100325285 3300006914 Bacteria 1105
72 Ga0097620_100075475 3300006931 Bacteria 3412
73 Ga0075435_100000188 3300007076 Bacteria 36923
74 Ga0075435_100002472 3300007076 Bacteria 12288
75 Ga0075435_100005626 3300007076 Bacteria 8778
76 Ga0075435_100066740 3300007076 Bacteria 2928
77 Ga0099794_10000556 3300007265 Bacteria 12507
78 Ga0099794_10063361 3300007265 Bacteria 1799
79 Ga0111539_10046228 3300009094 Bacteria 5207
80 Ga0111539_10142533 3300009094 Bacteria 2805
81 Ga0105247_10057672 3300009101 Bacteria 2401
82 Ga0114129_10001780 3300009147 Bacteria 29349
83 Ga0114129_10013621 3300009147 Bacteria 11586
84 Ga0114129_10023220 3300009147 Bacteria 8797
85 Ga0114129_10033580 3300009147 Bacteria 7250
86 Ga0114129_10040770 3300009147 Bacteria 6545
87 Ga0114129_10057450 3300009147 Bacteria 5445
88 Ga0114129_10143869 3300009147 Bacteria 3267
89 Ga0114129_10490323 3300009147 Bacteria 1606
90 Ga0114129_11014355 3300009147 Bacteria 1044
91 Ga0105243_10252359 3300009148 Bacteria 1576
92 Ga0105248_10008866 3300009177 Bacteria 11053
93 Ga0105248_10009870 3300009177 Bacteria 10512
94 Ga0105248_10046802 3300009177 Bacteria 4850
95 Ga0105249_10373072 3300009553 Bacteria 1451
96 Ga0105239_10102512 3300010375 Bacteria 3167
97 Ga0157378_10187180 3300013297 Bacteria 1950
98 Ga0163162_10540751 3300013306 Bacteria 1294
99 Ga0157375_10178312 3300013308 Bacteria 2276
100 Ga0163163_10056196 3300014325 Bacteria 3890
101 Ga0157380_10055129 3300014326 Bacteria 3156
102 Ga0157379_10023577 3300014968 Bacteria 5461
103 Ga0157379_10081847 3300014968 Bacteria 2892
104 Ga0157376_10031956 3300014969 Unclassified 4222
105 Ga0207697_10008668 3300025315 Bacteria 4434
106 Ga0207682_10052431 3300025893 Bacteria 1691
107 Ga0207692_10012161 3300025898 Bacteria 3689
108 Ga0207688_10190882 3300025901 Bacteria 1225
109 Ga0207680_10025934 3300025903 Bacteria 3240
110 Ga0207680_10088141 3300025903 Bacteria 1967
111 Ga0207699_10132560 3300025906 Bacteria 1627
112 Ga0207645_10014101 3300025907 Bacteria 5356
113 Ga0207684_10296691 3300025910 Bacteria 1393
114 Ga0207693_10007014 3300025915 Bacteria 9307
115 Ga0207693_10244368 3300025915 Bacteria 1409
116 Ga0207663_10002185 3300025916 Bacteria 9348
117 Ga0207660_10155649 3300025917 Bacteria 1759
118 Ga0207662_10002451 3300025918 Bacteria 9301
119 Ga0207646_10408876 3300025922 Bacteria 1225
120 Ga0207681_10095582 3300025923 Bacteria 2131
121 Ga0207659_10273943 3300025926 Bacteria 1377
122 Ga0207700_10025115 3300025928 Bacteria 4133
123 Ga0207664_10261009 3300025929 Bacteria 1515
124 Ga0207644_10079057 3300025931 Bacteria 2425
125 Ga0207644_10318300 3300025931 Bacteria 1257
126 Ga0207706_10364243 3300025933 Bacteria 1256
127 Ga0207670_10074957 3300025936 Bacteria 2350
128 Ga0207670_10174699 3300025936 Bacteria 1613
129 Ga0207665_10291373 3300025939 Bacteria 1217
130 Ga0207691_10025367 3300025940 Bacteria 5567
131 Ga0207691_10069086 3300025940 Bacteria 3191
132 Ga0207711_10002530 3300025941 Bacteria 16283
133 Ga0207711_10113374 3300025941 Bacteria 2413
134 Ga0207711_10148104 3300025941 Bacteria 2116
135 Ga0207689_10052829 3300025942 Bacteria 3348
136 Ga0207689_10356856 3300025942 Bacteria 1215
137 Ga0207679_10387179 3300025945 Bacteria 1227
138 Ga0207651_10001960 3300025960 Bacteria 9678
139 Ga0207651_10051154 3300025960 Bacteria 2809
140 Ga0207651_10065199 3300025960 Bacteria 2553
141 Ga0207640_10088710 3300025981 Bacteria 2136
142 Ga0207658_10042563 3300025986 Bacteria 3296
143 Ga0207658_10042605 3300025986 Bacteria 3294
144 Ga0207703_10258320 3300026035 Bacteria 1573
145 Ga0207708_10017803 3300026075 Bacteria 5347
146 Ga0207641_10000433 3300026088 Bacteria 47984
147 Ga0207641_10237738 3300026088 Bacteria 1696
148 Ga0207648_10009049 3300026089 Bacteria 9579
149 Ga0207648_10086169 3300026089 Bacteria 2740
150 Ga0207648_10599229 3300026089 Bacteria 1015
151 Ga0207676_10045061 3300026095 Bacteria 3406
152 Ga0207676_10186717 3300026095 Bacteria 1820
153 Ga0207675_100079380 3300026118 Bacteria 3075
154 Ga0207675_100166484 3300026118 Bacteria 2105
155 Ga0207683_10157692 3300026121 Bacteria 2050
156 Ga0207683_10446231 3300026121 Bacteria 1192
157 Ga0209588_1000635 3300027671 Bacteria 8859
158 Ga0209588_1003454 3300027671 Bacteria 4386
159 Ga0209588_1030158 3300027671 Bacteria 1732
160 Ga0268265_10020363 3300028380 Bacteria 4629
161 Ga0268265_10390807 3300028380 Bacteria 1283
162 Ga0268264_10022192 3300028381 Bacteria 5182
163 Ga0268264_10109021 3300028381 Bacteria 2421
164 Ga0268264_10122746 3300028381 Bacteria 2292
165 Ga0265334_10085358 3300028573 Bacteria 1159
166 Ga0265338_10014027 3300028800 Bacteria 8974
167 Ga0265339_10000927 3300031249 Bacteria 22533
168 Ga0265331_10025828 3300031250 Bacteria 2961
169 Ga0265313_10013049 3300031595 Bacteria 5022
170 Ga0265314_10000196 3300031711 Bacteria 90241
171 Ga0265314_10078102 3300031711 Bacteria 2193
172 Ga0307405_10111868 3300031731 Bacteria 1852
173 Ga0307407_10018110 3300031903 Bacteria 3554
174 Ga0307409_100104202 3300031995 Bacteria 2362
175 Ga0307409_100614168 3300031995 Bacteria 1076
176 Ga0307416_100029178 3300032002 Bacteria 4117
177 Ga0307416_100079036 3300032002 Bacteria 2770
178 Ga0307416_100156123 3300032002 Bacteria 2101
179 Ga0307411_10204648 3300032005 Bacteria 1519
180 Ga0307415_100268484 3300032126 Bacteria 1396
181 Ga0373952_0015638 3300035092 Bacteria 1534
182 Ga0373931_0153748 3300035691 Bacteria 1343
183 Ga0373933_0155969 3300035724 Bacteria 1448
184 Ga0316584_0062036 3300036712 Bacteria 2800
185 Ga0395899_0223501 3300037312 Bacteria 1303
186 Ga0395900_0186193 3300037418 Bacteria 2107
187 Ga0395900_0307361 3300037418 Bacteria 1570
188 Ga0395898_0010730 3300037466 Bacteria 9570
189 Ga0439446_0024437 3300042156 Bacteria 1724
190 Ga0439435_0004860 3300042436 Bacteria 2921
191 Ga0439460_0096499 3300042461 Bacteria 945
192 Ga0453684_0424310 3300044712 Bacteria 1485
193 Ga0495651_0018339 3300046462 Bacteria 5419
194 Ga0495580_0010494 3300046472 Bacteria 7215
195 Ga0495639_0080130 3300046475 Bacteria 1519
196 Ga0495662_0002447 3300046476 Bacteria 9347
197 Ga0495664_0113459 3300046477 Bacteria 1637
198 Ga0495618_0006646 3300046514 Bacteria 7008
199 Ga0495628_0017931 3300046516 Bacteria 5875
200 Ga0495630_0000006 3300046517 Bacteria 400463
201 Ga0495652_0000679 3300046529 Bacteria 39396
202 Ga0495640_0136399 3300046533 Bacteria 1584
203 Ga0495645_0010301 3300046543 Bacteria 6554
204 Ga0495656_0070064 3300046615 Bacteria 1555
205 Ga0495634_0020998 3300046642 Bacteria 4624
206 Ga0495634_0207695 3300046642 Bacteria 1214
207 Ga0495624_0133112 3300046690 Bacteria 1524
208 Ga0495670_0170574 3300046691 Bacteria 1146
209 Ga0495600_0040269 3300046809 Bacteria 3042
210 Ga0495604_0012241 3300047317 Bacteria 6819
211 Ga0495674_0015457 3300047319 Bacteria 7132
212 Ga0495684_0045803 3300047471 Bacteria 3346
213 Ga0496104_0081030 3300048907 Bacteria 3095
214 Ga0496106_0059644 3300048909 Bacteria 2891
215 Ga0496106_0121168 3300048909 Bacteria 2045
216 Ga0496106_0276587 3300048909 Bacteria 1345
217 Ga0496108_0023947 3300048911 Bacteria 5026
218 Ga0496109_0100627 3300048912 Bacteria 2682
219 Ga0496112_0039855 3300048915 Bacteria 4591
220 Ga0496112_0075217 3300048915 Bacteria 3340
221 Ga0496112_0354364 3300048915 Bacteria 1410
222 Ga0496112_0533427 3300048915 Bacteria 1108
223 Ga0496114_0294341 3300048917 Bacteria 1433
224 Ga0496126_0051105 3300048929 Bacteria 3764
225 Ga0501034_0041858 3300049571 Bacteria 4635
226 Ga0501039_0207145 3300049575 Bacteria 1542
227 Ga0501040_0030630 3300049576 Bacteria 3635
228 Ga0501069_0089447 3300049585 Bacteria 1741
229 Ga0501070_0100903 3300049586 Bacteria 2387
230 Ga0501071_0152761 3300049587 Bacteria 1723
231 Ga0501071_0224016 3300049587 Bacteria 1416
232 Ga0501075_0140759 3300049591 Bacteria 1838
233 Ga0501076_0014107 3300049592 Bacteria 6009
234 Ga0501076_0027875 3300049592 Bacteria 4381
235 Ga0501077_0041107 3300049593 Bacteria 2944
236 Ga0501035_0280533 3300049822 Bacteria 1408
237 Ga0501044_0400619 3300049823 Bacteria 1285
238 nmdc:mga05p37_132860_c1 3300050507 Bacteria 3053
239 nmdc:mga05p37_19308_c1 3300050507 Bacteria 8244
240 nmdc:mga05p37_231595_c1 3300050507 Bacteria 2225
241 nmdc:mga05p37_25273_c1 3300050507 Bacteria 7223
242 nmdc:mga05p37_45261_c1 3300050507 Bacteria 5414
243 nmdc:mga05p37_46508_c1 3300050507 Bacteria 5336
244 nmdc:mga05p37_6403_c1 3300050507 Bacteria 13874
245 nmdc:mga05p37_709893_c1 3300050507 Bacteria 1115
246 nmdc:mga0qj67_143434_c1 3300050509 Bacteria 1936
247 nmdc:mga0qj67_48104_c1 3300050509 Bacteria 3369
248 nmdc:mga0qj67_85897_c1 3300050509 Bacteria 2524
249 nmdc:mga06r32_16859_c1 3300050510 Bacteria 6662
250 nmdc:mga06r32_439397_c1 3300050510 Bacteria 1285
251 nmdc:mga08y16_31460_c1 3300050511 Bacteria 5581
252 nmdc:mga08y16_48716_c1 3300050511 Bacteria 4434
253 nmdc:mga0n895_1187_c1 3300050512 Bacteria 19150
254 nmdc:mga0n895_17035_c1 3300050512 Bacteria 6688
255 nmdc:mga0n895_207745_c1 3300050512 Bacteria 1989
256 nmdc:mga0n895_416164_c1 3300050512 Bacteria 1359
257 nmdc:mga0n895_42611_c1 3300050512 Bacteria 4417
258 nmdc:mga0rr50_19481_c1 3300050513 Bacteria 4582
259 nmdc:mga0rr50_2147_c1 3300050513 Bacteria 11026
260 nmdc:mga0rr50_63253_c1 3300050513 Bacteria 2794
261 nmdc:mga08x19_1954_c1 3300050514 Bacteria 9446
262 nmdc:mga08x19_42688_c1 3300050514 Bacteria 2891
263 nmdc:mga0a205_210381_c1 3300050515 Bacteria 1833
264 nmdc:mga0a205_22_c1 3300050515 Bacteria 88689
265 nmdc:mga0a205_27177_c1 3300050515 Bacteria 5464
266 nmdc:mga0a205_6837_c1 3300050515 Bacteria 10317
267 nmdc:mga0a205_7956_c1 3300050515 Bacteria 9629
268 Ga0495601_0011886 3300053077 Bacteria 5218
269 Ga0495612_0004827 3300053078 Bacteria 5582
270 Ga0495619_0032554 3300053085 Bacteria 3384
271 Ga0501084_0154799 3300054114 Bacteria 1933
272 Ga0501084_0390020 3300054114 Bacteria 1177
273 Ga0501084_0416908 3300054114 Bacteria 1135
274 Ga0501082_0087375 3300060353 Bacteria 2690
275 Ga0501039_0149565
276 Ga0065715_10014392
277 Ga0065707_10002205
278 Ga0065707_10150007
279 Ga0065707_10153797
280 Ga0070690_100034912
281 Ga0068869_100190830
282 Ga0070666_10009961
283 Ga0070680_100200975
284 Ga0070689_100087867
285 Ga0070675_100316572
286 Ga0070671_100045839
287 Ga0070674_100018623
288 Ga0070673_100005004
289 Ga0070673_100006100
290 Ga0070659_100102968
291 Ga0070709_10013046
292 Ga0070714_100313790
293 Ga0070713_100118414
294 Ga0070710_10011613
295 Ga0070711_100001862
296 Ga0070705_100085970
297 Ga0070705_100105732
298 Ga0070708_100013956
299 Ga0070678_100089917
300 Ga0068867_100043804
301 Ga0068867_100065839
302 Ga0070707_100265034
303 Ga0070698_100000158
304 Ga0070699_100026931
305 Ga0070699_100316625
306 Ga0070697_100255222
307 Ga0070672_100391578
308 Ga0070686_100079899
309 Ga0070693_100008382
310 Ga0070665_100011020
311 Ga0070664_100454066
312 Ga0068854_100036774
313 Ga0068854_100058649
314 Ga0070702_100044768
315 Ga0068859_100075476
316 Ga0068864_100092424
317 Ga0068864_100191097
318 Ga0068863_100000636
319 Ga0068858_100001339
320 Ga0068860_100055543
321 Ga0068860_100162019
322 Ga0068862_100218927
323 Ga0068862_100267631
324 Ga0081455_10093694
325 Ga0081539_10006624
326 Ga0070717_10071848
327 Ga0070716_100098294
328 Ga0070712_100005832
329 Ga0075428_100003168
330 Ga0075428_100053671
331 Ga0075428_100115318
332 Ga0075430_100042860
333 Ga0075430_100137522
334 Ga0075431_100093436
335 Ga0075431_100112003
336 Ga0075433_10001491
337 Ga0075433_10145129
338 Ga0075433_10145267
339 Ga0075434_100000403
340 Ga0075434_100006512
341 Ga0075434_100128393
342 Ga0075434_100376552
343 Ga0075434_100448138
344 Ga0075436_100032946
345 Ga0075436_100325285
346 Ga0097620_100075475
347 Ga0075435_100000188
348 Ga0075435_100002472
349 Ga0075435_100005626
350 Ga0075435_100066740
351 Ga0099794_10000556
352 Ga0099794_10063361
353 Ga0111539_10046228
354 Ga0111539_10142533
355 Ga0105247_10057672
356 Ga0114129_10001780
357 Ga0114129_10013621
358 Ga0114129_10023220
359 Ga0114129_10033580
360 Ga0114129_10040770
361 Ga0114129_10057450
362 Ga0114129_10143869
363 Ga0114129_10490323
364 Ga0114129_11014355
365 Ga0105243_10252359
366 Ga0105248_10008866
367 Ga0105248_10009870
368 Ga0105248_10046802
369 Ga0105249_10373072
370 Ga0105239_10102512
371 Ga0157378_10187180
372 Ga0163162_10540751
373 Ga0157375_10178312
374 Ga0163163_10056196
375 Ga0157380_10055129
376 Ga0157379_10023577
377 Ga0157379_10081847
378 Ga0157376_10031956
379 Ga0207697_10008668
380 Ga0207682_10052431
381 Ga0207692_10012161
382 Ga0207688_10190882
383 Ga0207680_10025934
384 Ga0207680_10088141
385 Ga0207699_10132560
386 Ga0207645_10014101
387 Ga0207684_10296691
388 Ga0207693_10007014
389 Ga0207693_10244368
390 Ga0207663_10002185
391 Ga0207660_10155649
392 Ga0207662_10002451
393 Ga0207646_10408876
394 Ga0207681_10095582
395 Ga0207659_10273943
396 Ga0207700_10025115
397 Ga0207664_10261009
398 Ga0207644_10079057
399 Ga0207644_10318300
400 Ga0207706_10364243
401 Ga0207670_10074957
402 Ga0207670_10174699
403 Ga0207665_10291373
404 Ga0207691_10025367
405 Ga0207691_10069086
406 Ga0207711_10002530
407 Ga0207711_10113374
408 Ga0207711_10148104
409 Ga0207689_10052829
410 Ga0207689_10356856
411 Ga0207679_10387179
412 Ga0207651_10001960
413 Ga0207651_10051154
414 Ga0207651_10065199
415 Ga0207640_10088710
416 Ga0207658_10042563
417 Ga0207658_10042605
418 Ga0207703_10258320
419 Ga0207708_10017803
420 Ga0207641_10000433
421 Ga0207641_10237738
422 Ga0207648_10009049
423 Ga0207648_10086169
424 Ga0207648_10599229
425 Ga0207676_10045061
426 Ga0207676_10186717
427 Ga0207675_100079380
428 Ga0207675_100166484
429 Ga0207683_10157692
430 Ga0207683_10446231
431 Ga0209588_1000635
432 Ga0209588_1003454
433 Ga0209588_1030158
434 Ga0268265_10020363
435 Ga0268265_10390807
436 Ga0268264_10022192
437 Ga0268264_10109021
438 Ga0268264_10122746
439 Ga0265334_10085358
440 Ga0265338_10014027
441 Ga0265339_10000927
442 Ga0265331_10025828
443 Ga0265313_10013049
444 Ga0265314_10000196
445 Ga0265314_10078102
446 Ga0307405_10111868
447 Ga0307407_10018110
448 Ga0307409_100104202
449 Ga0307409_100614168
450 Ga0307416_100029178
451 Ga0307416_100079036
452 Ga0307416_100156123
453 Ga0307411_10204648
454 Ga0307415_100268484
455 Ga0373952_0015638
456 Ga0373931_0153748
457 Ga0373933_0155969
458 Ga0316584_0062036
459 Ga0395899_0223501
460 Ga0395900_0186193
461 Ga0395900_0307361
462 Ga0395898_0010730
463 Ga0439446_0024437
464 Ga0439435_0004860
465 Ga0439460_0096499
466 Ga0453684_0424310
467 Ga0495651_0018339
468 Ga0495580_0010494
469 Ga0495639_0080130
470 Ga0495662_0002447
471 Ga0495664_0113459
472 Ga0495618_0006646
473 Ga0495628_0017931
474 Ga0495630_0000006
475 Ga0495652_0000679
476 Ga0495640_0136399
477 Ga0495645_0010301
478 Ga0495656_0070064
479 Ga0495634_0020998
480 Ga0495634_0207695
481 Ga0495624_0133112
482 Ga0495670_0170574
483 Ga0495600_0040269
484 Ga0495604_0012241
485 Ga0495674_0015457
486 Ga0495684_0045803
487 Ga0496104_0081030
488 Ga0496106_0059644
489 Ga0496106_0121168
490 Ga0496106_0276587
491 Ga0496108_0023947
492 Ga0496109_0100627
493 Ga0496112_0039855
494 Ga0496112_0075217
495 Ga0496112_0354364
496 Ga0496112_0533427
497 Ga0496114_0294341
498 Ga0496126_0051105
499 Ga0501034_0041858
500 Ga0501039_0207145
501 Ga0501040_0030630
502 Ga0501069_0089447
503 Ga0501070_0100903
504 Ga0501071_0152761
505 Ga0501071_0224016
506 Ga0501075_0140759
507 Ga0501076_0014107
508 Ga0501076_0027875
509 Ga0501077_0041107
510 Ga0501035_0280533
511 Ga0501044_0400619
512 nmdc:mga05p37_132860_c1
513 nmdc:mga05p37_19308_c1
514 nmdc:mga05p37_231595_c1
515 nmdc:mga05p37_25273_c1
516 nmdc:mga05p37_45261_c1
517 nmdc:mga05p37_46508_c1
518 nmdc:mga05p37_6403_c1
519 nmdc:mga05p37_709893_c1
520 nmdc:mga0qj67_143434_c1
521 nmdc:mga0qj67_48104_c1
522 nmdc:mga0qj67_85897_c1
523 nmdc:mga06r32_16859_c1
524 nmdc:mga06r32_439397_c1
525 nmdc:mga08y16_31460_c1
526 nmdc:mga08y16_48716_c1
527 nmdc:mga0n895_1187_c1
528 nmdc:mga0n895_17035_c1
529 nmdc:mga0n895_207745_c1
530 nmdc:mga0n895_416164_c1
531 nmdc:mga0n895_42611_c1
532 nmdc:mga0rr50_19481_c1
533 nmdc:mga0rr50_2147_c1
534 nmdc:mga0rr50_63253_c1
535 nmdc:mga08x19_1954_c1
536 nmdc:mga08x19_42688_c1
537 nmdc:mga0a205_210381_c1
538 nmdc:mga0a205_22_c1
539 nmdc:mga0a205_27177_c1
540 nmdc:mga0a205_6837_c1
541 nmdc:mga0a205_7956_c1
542 Ga0495601_0011886
543 Ga0495612_0004827
544 Ga0495619_0032554
545 Ga0501084_0154799
546 Ga0501084_0390020
547 Ga0501084_0416908
548 Ga0501082_0087375

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03976

PPK2

Polyphosphate kinase 2 (PPK2)

53

291

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bmm-assembly2.cif.gz_C crystal structure of polyphosphate kinase 2 from deinococcus radiodurans in apo form 0.9547 10 277
5o6m-assembly1.cif.gz_C structure of polyphosphate kinase from meiothermus ruber n121d bound to atp 0.9332 13 277
5o6m-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber n121d bound to atp 0.9317 11 275
5o6k-assembly1.cif.gz_D structure of polyphosphate kinase from meiothermus ruber n121d 0.9312 13 277
3czp-assembly1.cif.gz_A crystal structure of putative polyphosphate kinase 2 from pseudomonas aeruginosa pa01 0.9304 23 268
ID Description Score Start End Superfamily
6aqeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9332 10 277 3.40.50.300
6angA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9317 4 292 3.40.50.300
5ldbC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9261 11 277 3.40.50.300
3czpB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9238 37 268 3.40.50.300
3rhfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9144 9 285 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7W1CCM5-F1-model_v4 Polyphosphate kinase 2 family protein 0.9866 38 292 GO:0006797
GO:0008976
AF-A0A7X6U1E1-F1-model_v4 Polyphosphate kinase 2 family protein 0.9827 10 267 GO:0006797
GO:0008976
AF-A0A848A9E3-F1-model_v4 deleted 0.9825 3 293
AF-A0A3N5EAX7-F1-model_v4 Polyphosphate kinase 2 family protein 0.9817 41 293 GO:0006797
GO:0008976
AF-A0A401U1Q0-F1-model_v4 Polyphosphate kinase-2-related domain-containing protein 0.9812 73 236 GO:0006797
GO:0016776

Map