F380005

General Info

Members Datasets Scaffolds Average Seq Length
274 192 270 161

Family's Representative Sequence

Representative Sequence 3300049128|Ga0501308_021226|Ga0501308_021226_119_655
Length 178
Sequence MRASAALPPEGALHRSETEVLPVTLLLQLEIDQFNARYAAALDERRFDEWPEFFLAEGHYKVQARENFERKLPLALIALESQGMMKDRVYGVTQTIFHGPYYTRHVVSPAMVLEQEDGRIRAQAHYAVFRTRPGDASEVYNVGRYIDQFERTPTGLKLASRLCVYDSEMILNSLIYPI

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
62 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
69 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
74 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
75 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
102 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
103 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
104 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
118 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
119 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
120 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
121 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
122 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
123 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
124 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
125 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
126 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
127 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
128 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
129 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
130 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
131 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
132 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
133 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
134 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
135 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
149 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
180 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
181 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
182 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
183 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
184 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
185 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
187 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
188 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
192 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.05
Metatranscriptomes 9.49
Isolates 1.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.02
Nodule 0.73
Rhizoplane 3.65
Rhizosphere 57.66
Stem 0
Stem Tuber 0
Unclassified 6.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1007413 3300001904 Bacteria 1844
2 JGI24735J21928_10008546 3300002067 Bacteria 3306
3 JGI25155J39150_1000051 3300002704 Bacteria 76772
4 JGI25156J39149_1000155 3300002705 Bacteria 50271
5 JGI25156J39149_1001589 3300002705 Bacteria 9328
6 JGI25156J39149_1003151 3300002705 Bacteria 5552
7 JGI25154J39366_1000170 3300002738 Bacteria 50275
8 JGI25154J39366_1001680 3300002738 Bacteria 7314
9 JGI25157J39369_1000091 3300002741 Bacteria 76837
10 JGI25150J39212_1005617 3300002774 Bacteria 2660
11 JGI25159J45721_1000098 3300002987 Bacteria 41673
12 Ga0006777J48905_1030773 3300003308 Bacteria 1224
13 JGI25160J50197_1000067 3300003354 Bacteria 113436
14 JGI25161J50226_1000035 3300003374 Bacteria 133666
15 Ga0007429J51699_1040284 3300003579 Bacteria 789
16 Ga0055538_1003793 3300003751 Bacteria 1834
17 Ga0055538_1003794 3300003751 Bacteria 1834
18 Ga0055539_1000168 3300003752 Bacteria 58108
19 Ga0055533_1000337 3300003756 Bacteria 20560
20 Ga0055533_1001234 3300003756 Bacteria 7092
21 Ga0055525_1000264 3300003759 Bacteria 49985
22 Ga0055527_1011245 3300003760 Bacteria 1025
23 Ga0055542_1002031 3300003762 Bacteria 7723
24 Ga0055537_1017074 3300003773 Bacteria 1206
25 Ga0055530_10015894 3300003791 Bacteria 2431
26 Ga0055540_1001667 3300003792 Bacteria 12862
27 Ga0055531_10002623 3300003794 Bacteria 11910
28 Ga0055541_1000468 3300003841 Bacteria 11575
29 Ga0055541_1007262 3300003841 Bacteria 1834
30 Ga0055541_1007267 3300003841 Bacteria 1834
31 Ga0055543_1000684 3300004625 Bacteria 17669
32 Ga0058863_11573515 3300004799 Bacteria 880
33 Ga0065165_1006804 3300005262 Bacteria 5838
34 Ga0070658_10244385 3300005327 Bacteria 1522
35 Ga0070658_11199753 3300005327 Bacteria 660
36 Ga0070660_100001657 3300005339 Bacteria 15306
37 Ga0070660_100070008 3300005339 Bacteria 2737
38 Ga0070673_101606022 3300005364 Bacteria 614
39 Ga0070659_100002097 3300005366 Bacteria 14210
40 Ga0070681_11690264 3300005458 Bacteria 559
41 Ga0070679_100010660 3300005530 Bacteria 8722
42 Ga0068853_100079212 3300005539 Bacteria 2873
43 Ga0068853_100755980 3300005539 Bacteria 929
44 Ga0068855_100003061 3300005563 Bacteria 20464
45 Ga0068855_100007212 3300005563 Bacteria 13487
46 Ga0068857_100295627 3300005577 Bacteria 1492
47 Ga0068854_100000269 3300005578 Bacteria 35431
48 Ga0068854_100105906 3300005578 Bacteria 2115
49 Ga0075365_10455088 3300006038 Bacteria 904
50 Ga0075365_10537871 3300006038 Bacteria 826
51 Ga0075362_10012546 3300006177 Bacteria 3368
52 Ga0075367_10373418 3300006178 Bacteria 901
53 Ga0075369_10155431 3300006186 Bacteria 1047
54 Ga0075366_10191516 3300006195 Bacteria 1243
55 Ga0075366_10752347 3300006195 Bacteria 606
56 Ga0075370_10055021 3300006353 Bacteria 2260
57 Ga0079104_1016651 3300006946 Bacteria 2141
58 Ga0105240_10002430 3300009093 Bacteria 29950
59 Ga0105240_10003241 3300009093 Bacteria 25466
60 Ga0105240_10008208 3300009093 Bacteria 14965
61 Ga0105241_10377391 3300009174 Bacteria 1238
62 Ga0105237_10008906 3300009545 Bacteria 10814
63 Ga0105238_10432805 3300009551 Bacteria 1311
64 Ga0105238_10597322 3300009551 Bacteria 1111
65 Ga0105238_12292912 3300009551 Bacteria 575
66 Ga0105239_10001929 3300010375 Bacteria 27059
67 Ga0157373_10001106 3300013100 Bacteria 20692
68 Ga0157370_10000610 3300013104 Bacteria 44530
69 Ga0157370_10387904 3300013104 Bacteria 1286
70 Ga0157369_10002454 3300013105 Bacteria 22253
71 Ga0157369_10071330 3300013105 Bacteria 3729
72 Ga0157374_10000083 3300013296 Bacteria 94408
73 Ga0157372_10001962 3300013307 Bacteria 22368
74 Ga0157372_11626895 3300013307 Bacteria 743
75 Ga0182008_10045737 3300014497 Bacteria 2176
76 Ga0182006_1022388 3300015261 Bacteria 2627
77 Ga0182006_1067241 3300015261 Bacteria 1338
78 Ga0182006_1288091 3300015261 Bacteria 539
79 Ga0182007_10008713 3300015262 Bacteria 4144
80 Ga0206351_10980347 3300020077 Bacteria 1301
81 Ga0154015_1217465 3300020610 Bacteria 7662
82 Ga0209435_100062 3300025206 Bacteria 77288
83 Ga0209436_101924 3300025208 Bacteria 6690
84 Ga0209784_100024 3300025224 Bacteria 394613
85 Ga0209784_100319 3300025224 Bacteria 24844
86 Ga0209784_100813 3300025224 Bacteria 7147
87 Ga0209566_100018 3300025225 Bacteria 448638
88 Ga0209566_100556 3300025225 Bacteria 25033
89 Ga0209566_101103 3300025225 Bacteria 10430
90 Ga0209674_100046 3300025226 Bacteria 357920
91 Ga0209674_100166 3300025226 Bacteria 85496
92 Ga0209674_105470 3300025226 Bacteria 1871
93 Ga0209672_100348 3300025228 Bacteria 29543
94 Ga0209563_100039 3300025230 Bacteria 409717
95 Ga0209563_100090 3300025230 Bacteria 169322
96 Ga0207425_1000682 3300025245 Bacteria 18545
97 Ga0209646_1000001 3300025246 Bacteria 3092932
98 Ga0209646_1000063 3300025246 Bacteria 248065
99 Ga0209026_1000224 3300025250 Bacteria 77298
100 Ga0209677_100024 3300025253 Bacteria 406035
101 Ga0209677_109669 3300025253 Bacteria 1699
102 Ga0209148_1000019 3300025254 Bacteria 748518
103 Ga0209759_1000013 3300025256 Bacteria 399300
104 Ga0209759_1001080 3300025256 Bacteria 17821
105 Ga0209759_1004769 3300025256 Bacteria 4956
106 Ga0209759_1008180 3300025256 Bacteria 3285
107 Ga0209129_1002507 3300025258 Bacteria 8957
108 Ga0209565_1000345 3300025263 Bacteria 40893
109 Ga0209565_1030688 3300025263 Bacteria 1048
110 Ga0209673_1022861 3300025273 Bacteria 2144
111 Ga0209673_1038245 3300025273 Bacteria 1399
112 Ga0209130_1000241 3300025284 Bacteria 70093
113 Ga0209675_1004032 3300025291 Bacteria 6692
114 Ga0209675_1011245 3300025291 Bacteria 2982
115 Ga0209676_1008507 3300025292 Bacteria 4566
116 Ga0209025_1001588 3300025294 Bacteria 28622
117 Ga0209025_1001745 3300025294 Bacteria 26100
118 Ga0209564_1014716 3300025295 Bacteria 3233
119 Ga0209050_1001714 3300025298 Bacteria 21890
120 Ga0209256_1018741 3300025299 Bacteria 2233
121 Ga0209256_1032963 3300025299 Bacteria 1400
122 Ga0207426_1000247 3300025302 Bacteria 119659
123 Ga0209051_1000320 3300025303 Bacteria 72764
124 Ga0209257_1000161 3300025304 Bacteria 176089
125 Ga0209257_1007192 3300025304 Bacteria 6829
126 Ga0207647_10000147 3300025904 Bacteria 55976
127 Ga0207705_10149686 3300025909 Bacteria 1748
128 Ga0207705_10385589 3300025909 Bacteria 1083
129 Ga0207707_10355693 3300025912 Bacteria 1261
130 Ga0207695_10002163 3300025913 Bacteria 29706
131 Ga0207695_10004276 3300025913 Bacteria 19598
132 Ga0207695_10137149 3300025913 Bacteria 2399
133 Ga0207671_10257832 3300025914 Bacteria 1372
134 Ga0207660_10155778 3300025917 Bacteria 1758
135 Ga0207657_10003454 3300025919 Bacteria 16865
136 Ga0207657_10079905 3300025919 Bacteria 2750
137 Ga0207652_10053362 3300025921 Bacteria 3472
138 Ga0207664_10068074 3300025929 Bacteria 2859
139 Ga0207690_10018957 3300025932 Bacteria 4224
140 Ga0207667_10005159 3300025949 Bacteria 15954
141 Ga0207667_10021054 3300025949 Bacteria 7232
142 Ga0207640_10000211 3300025981 Bacteria 40994
143 Ga0207640_10150160 3300025981 Bacteria 1711
144 Ga0207639_10168959 3300026041 Bacteria 1850
145 Ga0207675_101213773 3300026118 Bacteria 774
146 Ga0265330_10021136 3300031235 Bacteria 2973
147 Ga0265332_10070050 3300031238 Bacteria 1494
148 Ga0265328_10064343 3300031239 Bacteria 1347
149 Ga0265329_10221148 3300031242 Bacteria 627
150 Ga0265340_10187288 3300031247 Bacteria 934
151 Ga0265331_10033874 3300031250 Bacteria 2523
152 Ga0307513_10000054 3300031456 Bacteria 148887
153 Ga0307513_10187071 3300031456 Bacteria 1927
154 Ga0307408_100086098 3300031548 Bacteria 2361
155 Ga0307408_101094213 3300031548 Bacteria 739
156 Ga0307408_101560723 3300031548 Bacteria 626
157 Ga0265314_10014325 3300031711 Bacteria 6355
158 Ga0307412_10558844 3300031911 Bacteria 962
159 Ga0307416_102657916 3300032002 Bacteria 598
160 Ga0395899_0000036 3300037312 Bacteria 289502
161 Ga0395899_0070325 3300037312 Bacteria 2561
162 Ga0395899_0400918 3300037312 Bacteria 908
163 Ga0395900_0000071 3300037418 Bacteria 187816
164 Ga0395900_0054901 3300037418 Bacteria 4101
165 Ga0395900_0193640 3300037418 Bacteria 2061
166 Ga0395900_0218120 3300037418 Bacteria 1924
167 Ga0395898_0000115 3300037466 Bacteria 211806
168 Ga0395898_0008118 3300037466 Bacteria 11113
169 Ga0395898_0018192 3300037466 Bacteria 7170
170 Ga0395898_0104751 3300037466 Bacteria 2713
171 Ga0395905_0089484 3300037471 Bacteria 2885
172 Ga0395905_0103250 3300037471 Bacteria 2676
173 Ga0395905_0153518 3300037471 Bacteria 2166
174 Ga0395901_0041887 3300038443 Bacteria 4746
175 Ga0395901_0133888 3300038443 Bacteria 2604
176 Ga0395901_0199020 3300038443 Bacteria 2100
177 Ga0395901_0338331 3300038443 Bacteria 1555
178 Ga0395901_1064180 3300038443 Bacteria 781
179 Ga0451787_242098 3300041441 Bacteria 589
180 Ga0451789_0355223 3300041443 Bacteria 730
181 Ga0451791_1726780 3300041451 Bacteria 1027
182 Ga0451797_1110120 3300041453 Bacteria 573
183 Ga0451798_0496539 3300041458 Bacteria 861
184 Ga0451800_1527535 3300041459 Bacteria 915
185 Ga0451807_1461339 3300041486 Bacteria 1057
186 Ga0451849_0170818 3300041505 Bacteria 594
187 Ga0439433_0066669 3300041999 Bacteria 864
188 Ga0439437_008450 3300042000 Bacteria 1158
189 Ga0439448_0002087 3300042005 Bacteria 5365
190 Ga0439432_062946 3300042006 Bacteria 1141
191 Ga0450890_004257 3300042127 Bacteria 1875
192 Ga0450898_007310 3300042134 Bacteria 1718
193 Ga0450898_015085 3300042134 Bacteria 1306
194 Ga0450899_005478 3300042135 Bacteria 1365
195 Ga0450903_012391 3300042138 Bacteria 1363
196 Ga0439446_0011952 3300042156 Bacteria 2366
197 Ga0439464_0015168 3300042439 Bacteria 2078
198 Ga0439460_0055478 3300042461 Bacteria 1198
199 Ga0466969_0012519 3300044656 Bacteria 4472
200 Ga0466965_0004957 3300044683 Bacteria 5960
201 Ga0466966_0113672 3300044684 Bacteria 1667
202 Ga0466966_0275847 3300044684 Bacteria 1012
203 Ga0466961_0000421 3300044693 Bacteria 27063
204 Ga0466961_0092563 3300044693 Bacteria 1908
205 Ga0466970_0076922 3300044765 Bacteria 1799
206 Ga0466957_0228284 3300044842 Bacteria 1232
207 Ga0466967_0468016 3300045976 Bacteria 1234
208 Ga0466967_0800801 3300045976 Bacteria 936
209 Ga0495621_0178114 3300046539 Bacteria 847
210 Ga0495672_0006547 3300047320 Bacteria 8980
211 Ga0496107_0410452 3300048910 Bacteria 1007
212 Ga0496109_1085171 3300048912 Bacteria 738
213 Ga0496110_0833230 3300048913 Bacteria 827
214 Ga0496116_0310299 3300048919 Bacteria 745
215 Ga0501306_029786 3300049127 Bacteria 806
216 Ga0501306_036132 3300049127 Bacteria 752
217 Ga0501308_021226 3300049128 Bacteria 814
218 Ga0501308_035509 3300049128 Bacteria 685
219 Ga0501310_018654 3300049130 Bacteria 848
220 Ga0501305_026172 3300049161 Bacteria 888
221 Ga0501305_032052 3300049161 Bacteria 823
222 Ga0501307_013967 3300049162 Bacteria 975
223 Ga0501314_009545 3300049530 Bacteria 892
224 Ga0501315_023852 3300049531 Bacteria 843
225 Ga0501315_025833 3300049531 Bacteria 820
226 Ga0501315_027625 3300049531 Bacteria 802
227 Ga0501315_079507 3300049531 Bacteria 555
228 Ga0501320_012826 3300049536 Bacteria 887
229 Ga0501323_039680 3300049539 Bacteria 687
230 Ga0501325_011523 3300049541 Bacteria 819
231 Ga0501325_023848 3300049541 Bacteria 663
232 Ga0501329_14249 3300049545 Bacteria 529
233 Ga0501336_012477 3300049552 Bacteria 702
234 Ga0501032_0588208 3300049569 Bacteria 708
235 Ga0501033_0013119 3300049570 Bacteria 6314
236 Ga0501034_0047010 3300049571 Bacteria 4359
237 Ga0501036_0241103 3300049572 Bacteria 1516
238 Ga0501038_0283854 3300049574 Bacteria 1303
239 Ga0501046_0055501 3300049580 Bacteria 3112
240 Ga0501047_0114769 3300049581 Bacteria 2575
241 Ga0501047_0507800 3300049581 Bacteria 1032
242 Ga0501048_0364181 3300049582 Bacteria 1032
243 Ga0501074_0383063 3300049590 Bacteria 998
244 Ga0501080_0061097 3300049742 Bacteria 3508
245 Ga0501035_0698512 3300049822 Bacteria 818
246 Ga0501044_0100462 3300049823 Bacteria 2911
247 nmdc:mga03n38_99071_c1 3300050490 Bacteria 1403
248 nmdc:mga00v17_266766_c1 3300050491 Bacteria 1111
249 nmdc:mga0yw44_560581_c1 3300050492 Bacteria 776
250 nmdc:mga0yw44_72462_c1 3300050492 Bacteria 2141
251 nmdc:mga0k408_177723_c1 3300050493 Bacteria 1269
252 nmdc:mga0k408_187084_c1 3300050493 Bacteria 1235
253 nmdc:mga0k408_712267_c1 3300050493 Bacteria 588
254 nmdc:mga07m45_59183_c1 3300050496 Bacteria 2167
255 nmdc:mga07m45_749892_c1 3300050496 Bacteria 560
256 nmdc:mga09592_319894_c1 3300050508 Bacteria 1344
257 Ga0500644_0008890 3300053088 Bacteria 2666
258 Ga0500566_0088057 3300053094 Bacteria 1719
259 Ga0500566_0144045 3300053094 Bacteria 1261
260 Ga0500660_061601 3300053100 Bacteria 1805
261 Ga0500562_025549 3300053108 Bacteria 1546
262 Ga0500594_0170017 3300053118 Bacteria 708
263 Ga0500577_0161953 3300053142 Bacteria 953
264 Ga0500586_095206 3300053145 Bacteria 1044
265 Ga0500616_0083310 3300053153 Bacteria 1602
266 Ga0500645_000336 3300053730 Bacteria 33456
267 Ga0500645_012228 3300053730 Bacteria 2777
268 Ga0587128_074270 3300059630 Bacteria 668
269 Ga0587072_089152 3300059643 Bacteria 677
270 Ga0501082_0552941 3300060353 Bacteria 1007

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049531 Ga0501315_023852 Ga0501315_023852_277_756 145
2 3300048910 Ga0496107_0410452 Ga0496107_0410452_416_889 147
3 iso_pu_bacteria 8002745576 8002748326 152
4 3300049531 Ga0501315_079507 Ga0501315_079507_11_472 153
5 iso_pu_bacteria 8055266321 8055270511 153
6 3300013307 Ga0157372_11626895 Ga0157372_116268952 155
7 iso_pu_bacteria 2881101125 2881101180 155
8 3300044656 Ga0466969_0012519 Ga0466969_0012519_2557_3027 156
9 3300044683 Ga0466965_0004957 Ga0466965_0004957_4912_5382 156
10 3300044684 Ga0466966_0113672 Ga0466966_0113672_215_685 156
11 3300044693 Ga0466961_0000421 Ga0466961_0000421_14629_15099 156
12 iso_pu_bacteria 2511231002 2511245667 156
13 3300001904 JGI24736J21556_1007413 JGI24736J21556_10074133 157
14 3300002067 JGI24735J21928_10008546 JGI24735J21928_100085462 157
15 3300002704 JGI25155J39150_1000051 JGI25155J39150_10000517 157
16 3300002705 JGI25156J39149_1000155 JGI25156J39149_100015550 157
17 3300002705 JGI25156J39149_1001589 JGI25156J39149_10015892 157
18 3300002705 JGI25156J39149_1003151 JGI25156J39149_10031516 157
19 3300002738 JGI25154J39366_1000170 JGI25154J39366_100017049 157
20 3300002738 JGI25154J39366_1001680 JGI25154J39366_10016802 157
21 3300002741 JGI25157J39369_1000091 JGI25157J39369_10000917 157
22 3300002774 JGI25150J39212_1005617 JGI25150J39212_10056172 157
23 3300002987 JGI25159J45721_1000098 JGI25159J45721_100009822 157
24 3300003308 Ga0006777J48905_1030773 Ga0006777J48905_10307732 157
25 3300003354 JGI25160J50197_1000067 JGI25160J50197_100006752 157
26 3300003374 JGI25161J50226_1000035 JGI25161J50226_100003573 157
27 3300003579 Ga0007429J51699_1040284 Ga0007429J51699_10402842 157
28 3300003751 Ga0055538_1003793 Ga0055538_10037932 157
29 3300003751 Ga0055538_1003794 Ga0055538_10037942 157
30 3300003752 Ga0055539_1000168 Ga0055539_10001689 157
31 3300003756 Ga0055533_1000337 Ga0055533_10003379 157
32 3300003756 Ga0055533_1001234 Ga0055533_10012342 157
33 3300003759 Ga0055525_1000264 Ga0055525_100026432 157
34 3300003760 Ga0055527_1011245 Ga0055527_10112452 157
35 3300003762 Ga0055542_1002031 Ga0055542_10020319 157
36 3300003773 Ga0055537_1017074 Ga0055537_10170742 157
37 3300003791 Ga0055530_10015894 Ga0055530_100158943 157
38 3300003792 Ga0055540_1001667 Ga0055540_100166715 157
39 3300003794 Ga0055531_10002623 Ga0055531_100026235 157
40 3300003841 Ga0055541_1000468 Ga0055541_10004689 157
41 3300003841 Ga0055541_1007262 Ga0055541_10072622 157
42 3300003841 Ga0055541_1007267 Ga0055541_10072672 157
43 3300004625 Ga0055543_1000684 Ga0055543_100068412 157
44 3300004799 Ga0058863_11573515 Ga0058863_115735152 157
45 3300005262 Ga0065165_1006804 Ga0065165_10068043 157
46 3300005327 Ga0070658_10244385 Ga0070658_102443853 157
47 3300005327 Ga0070658_11199753 Ga0070658_111997531 157
48 3300005339 Ga0070660_100001657 Ga0070660_1000016576 157
49 3300005339 Ga0070660_100070008 Ga0070660_1000700083 157
50 3300005364 Ga0070673_101606022 Ga0070673_1016060221 157
51 3300005366 Ga0070659_100002097 Ga0070659_1000020973 157
52 3300005458 Ga0070681_11690264 Ga0070681_116902641 157
53 3300005530 Ga0070679_100010660 Ga0070679_1000106603 157
54 3300005539 Ga0068853_100079212 Ga0068853_1000792122 157
55 3300005539 Ga0068853_100755980 Ga0068853_1007559802 157
56 3300005563 Ga0068855_100003061 Ga0068855_10000306113 157
57 3300005563 Ga0068855_100007212 Ga0068855_1000072129 157
58 3300005577 Ga0068857_100295627 Ga0068857_1002956272 157
59 3300005578 Ga0068854_100000269 Ga0068854_10000026930 157
60 3300005578 Ga0068854_100105906 Ga0068854_1001059062 157
61 3300006038 Ga0075365_10455088 Ga0075365_104550882 157
62 3300006038 Ga0075365_10537871 Ga0075365_105378712 157
63 3300006177 Ga0075362_10012546 Ga0075362_100125463 157
64 3300006178 Ga0075367_10373418 Ga0075367_103734182 157
65 3300006186 Ga0075369_10155431 Ga0075369_101554312 157
66 3300006195 Ga0075366_10191516 Ga0075366_101915162 157
67 3300006195 Ga0075366_10752347 Ga0075366_107523471 157
68 3300006353 Ga0075370_10055021 Ga0075370_100550211 157
69 3300006946 Ga0079104_1016651 Ga0079104_10166512 157
70 3300009093 Ga0105240_10002430 Ga0105240_1000243022 157
71 3300009093 Ga0105240_10003241 Ga0105240_100032416 157
72 3300009093 Ga0105240_10008208 Ga0105240_100082089 157
73 3300009174 Ga0105241_10377391 Ga0105241_103773912 157
74 3300009545 Ga0105237_10008906 Ga0105237_100089067 157
75 3300009551 Ga0105238_10432805 Ga0105238_104328053 157
76 3300009551 Ga0105238_10597322 Ga0105238_105973222 157
77 3300009551 Ga0105238_12292912 Ga0105238_122929121 157
78 3300010375 Ga0105239_10001929 Ga0105239_1000192918 157
79 3300013100 Ga0157373_10001106 Ga0157373_1000110610 157
80 3300013104 Ga0157370_10000610 Ga0157370_1000061033 157
81 3300013104 Ga0157370_10387904 Ga0157370_103879042 157
82 3300013105 Ga0157369_10002454 Ga0157369_1000245410 157
83 3300013105 Ga0157369_10071330 Ga0157369_100713302 157
84 3300013296 Ga0157374_10000083 Ga0157374_1000008318 157
85 3300013307 Ga0157372_10001962 Ga0157372_1000196216 157
86 3300014497 Ga0182008_10045737 Ga0182008_100457374 157
87 3300015261 Ga0182006_1022388 Ga0182006_10223883 157
88 3300015261 Ga0182006_1067241 Ga0182006_10672412 157
89 3300015261 Ga0182006_1288091 Ga0182006_12880911 157
90 3300015262 Ga0182007_10008713 Ga0182007_100087136 157
91 3300020077 Ga0206351_10980347 Ga0206351_109803472 157
92 3300020610 Ga0154015_1217465 Ga0154015_12174653 157
93 3300025206 Ga0209435_100062 Ga0209435_10006274 157
94 3300025208 Ga0209436_101924 Ga0209436_1019246 157
95 3300025224 Ga0209784_100024 Ga0209784_100024151 157
96 3300025224 Ga0209784_100319 Ga0209784_10031923 157
97 3300025224 Ga0209784_100813 Ga0209784_1008132 157
98 3300025225 Ga0209566_100018 Ga0209566_100018151 157
99 3300025225 Ga0209566_100556 Ga0209566_10055622 157
100 3300025225 Ga0209566_101103 Ga0209566_1011037 157
101 3300025226 Ga0209674_100046 Ga0209674_100046212 157
102 3300025226 Ga0209674_100166 Ga0209674_10016610 157
103 3300025226 Ga0209674_105470 Ga0209674_1054701 157
104 3300025228 Ga0209672_100348 Ga0209672_10034810 157
105 3300025230 Ga0209563_100039 Ga0209563_100039212 157
106 3300025230 Ga0209563_100090 Ga0209563_10009027 157
107 3300025245 Ga0207425_1000682 Ga0207425_10006827 157
108 3300025246 Ga0209646_1000001 Ga0209646_1000001363 157
109 3300025246 Ga0209646_1000063 Ga0209646_1000063168 157
110 3300025250 Ga0209026_1000224 Ga0209026_100022474 157
111 3300025253 Ga0209677_100024 Ga0209677_100024210 157
112 3300025253 Ga0209677_109669 Ga0209677_1096692 157
113 3300025254 Ga0209148_1000019 Ga0209148_1000019485 157
114 3300025256 Ga0209759_1000013 Ga0209759_1000013363 157
115 3300025256 Ga0209759_1001080 Ga0209759_100108010 157
116 3300025256 Ga0209759_1004769 Ga0209759_10047698 157
117 3300025256 Ga0209759_1008180 Ga0209759_10081802 157
118 3300025258 Ga0209129_1002507 Ga0209129_10025076 157
119 3300025263 Ga0209565_1000345 Ga0209565_100034528 157
120 3300025263 Ga0209565_1030688 Ga0209565_10306881 157
121 3300025273 Ga0209673_1022861 Ga0209673_10228612 157
122 3300025273 Ga0209673_1038245 Ga0209673_10382452 157
123 3300025284 Ga0209130_1000241 Ga0209130_100024152 157
124 3300025291 Ga0209675_1004032 Ga0209675_10040328 157
125 3300025291 Ga0209675_1011245 Ga0209675_10112452 157
126 3300025292 Ga0209676_1008507 Ga0209676_10085073 157
127 3300025294 Ga0209025_1001588 Ga0209025_100158821 157
128 3300025294 Ga0209025_1001745 Ga0209025_100174523 157
129 3300025295 Ga0209564_1014716 Ga0209564_10147164 157
130 3300025298 Ga0209050_1001714 Ga0209050_100171410 157
131 3300025299 Ga0209256_1018741 Ga0209256_10187412 157
132 3300025299 Ga0209256_1032963 Ga0209256_10329632 157
133 3300025302 Ga0207426_1000247 Ga0207426_100024766 157
134 3300025303 Ga0209051_1000320 Ga0209051_100032017 157
135 3300025304 Ga0209257_1000161 Ga0209257_1000161118 157
136 3300025304 Ga0209257_1007192 Ga0209257_10071923 157
137 3300025904 Ga0207647_10000147 Ga0207647_1000014740 157
138 3300025909 Ga0207705_10149686 Ga0207705_101496862 157
139 3300025909 Ga0207705_10385589 Ga0207705_103855892 157
140 3300025912 Ga0207707_10355693 Ga0207707_103556932 157
141 3300025913 Ga0207695_10002163 Ga0207695_1000216320 157
142 3300025913 Ga0207695_10004276 Ga0207695_100042768 157
143 3300025913 Ga0207695_10137149 Ga0207695_101371493 157
144 3300025914 Ga0207671_10257832 Ga0207671_102578322 157
145 3300025917 Ga0207660_10155778 Ga0207660_101557783 157
146 3300025919 Ga0207657_10003454 Ga0207657_100034547 157
147 3300025919 Ga0207657_10079905 Ga0207657_100799053 157
148 3300025921 Ga0207652_10053362 Ga0207652_100533623 157
149 3300025929 Ga0207664_10068074 Ga0207664_100680743 157
150 3300025932 Ga0207690_10018957 Ga0207690_100189573 157
151 3300025949 Ga0207667_10005159 Ga0207667_1000515910 157
152 3300025949 Ga0207667_10021054 Ga0207667_100210542 157
153 3300025981 Ga0207640_10000211 Ga0207640_100002118 157
154 3300025981 Ga0207640_10150160 Ga0207640_101501602 157
155 3300026041 Ga0207639_10168959 Ga0207639_101689592 157
156 3300026118 Ga0207675_101213773 Ga0207675_1012137732 157
157 3300031235 Ga0265330_10021136 Ga0265330_100211363 157
158 3300031238 Ga0265332_10070050 Ga0265332_100700503 157
159 3300031239 Ga0265328_10064343 Ga0265328_100643432 157
160 3300031242 Ga0265329_10221148 Ga0265329_102211482 157
161 3300031247 Ga0265340_10187288 Ga0265340_101872881 157
162 3300031250 Ga0265331_10033874 Ga0265331_100338742 157
163 3300031456 Ga0307513_10000054 Ga0307513_1000005483 157
164 3300031456 Ga0307513_10187071 Ga0307513_101870712 157
165 3300031548 Ga0307408_100086098 Ga0307408_1000860983 157
166 3300031548 Ga0307408_101094213 Ga0307408_1010942132 157
167 3300031548 Ga0307408_101560723 Ga0307408_1015607232 157
168 3300031711 Ga0265314_10014325 Ga0265314_100143253 157
169 3300031911 Ga0307412_10558844 Ga0307412_105588442 157
170 3300032002 Ga0307416_102657916 Ga0307416_1026579162 157
171 3300037312 Ga0395899_0000036 Ga0395899_0000036_48696_49169 157
172 3300037312 Ga0395899_0070325 Ga0395899_0070325_375_851 157
173 3300037312 Ga0395899_0400918 Ga0395899_0400918_285_758 157
174 3300037418 Ga0395900_0000071 Ga0395900_0000071_48696_49169 157
175 3300037418 Ga0395900_0054901 Ga0395900_0054901_3534_4010 157
176 3300037418 Ga0395900_0193640 Ga0395900_0193640_83_556 157
177 3300037418 Ga0395900_0218120 Ga0395900_0218120_649_1134 157
178 3300037466 Ga0395898_0000115 Ga0395898_0000115_35035_35508 157
179 3300037466 Ga0395898_0008118 Ga0395898_0008118_8851_9324 157
180 3300037466 Ga0395898_0018192 Ga0395898_0018192_1072_1548 157
181 3300037466 Ga0395898_0104751 Ga0395898_0104751_1064_1549 157
182 3300037471 Ga0395905_0089484 Ga0395905_0089484_1388_1873 157
183 3300037471 Ga0395905_0103250 Ga0395905_0103250_1761_2237 157
184 3300037471 Ga0395905_0153518 Ga0395905_0153518_1121_1597 157
185 3300038443 Ga0395901_0041887 Ga0395901_0041887_427_903 157
186 3300038443 Ga0395901_0133888 Ga0395901_0133888_1244_1729 157
187 3300038443 Ga0395901_0199020 Ga0395901_0199020_1381_1866 157
188 3300038443 Ga0395901_0338331 Ga0395901_0338331_686_1159 157
189 3300038443 Ga0395901_1064180 Ga0395901_1064180_245_721 157
190 3300041441 Ga0451787_242098 Ga0451787_242098_36_512 157
191 3300041443 Ga0451789_0355223 Ga0451789_0355223_171_650 157
192 3300041451 Ga0451791_1726780 Ga0451791_1726780_29_523 157
193 3300041453 Ga0451797_1110120 Ga0451797_1110120_53_535 157
194 3300041458 Ga0451798_0496539 Ga0451798_0496539_15_509 157
195 3300041459 Ga0451800_1527535 Ga0451800_1527535_140_634 157
196 3300041486 Ga0451807_1461339 Ga0451807_1461339_408_902 157
197 3300041505 Ga0451849_0170818 Ga0451849_0170818_88_567 157
198 3300041999 Ga0439433_0066669 Ga0439433_0066669_346_852 157
199 3300042000 Ga0439437_008450 Ga0439437_008450_354_860 157
200 3300042005 Ga0439448_0002087 Ga0439448_0002087_1956_2429 157
201 3300042006 Ga0439432_062946 Ga0439432_062946_263_748 157
202 3300042127 Ga0450890_004257 Ga0450890_004257_860_1366 157
203 3300042134 Ga0450898_007310 Ga0450898_007310_132_638 157
204 3300042134 Ga0450898_015085 Ga0450898_015085_318_806 157
205 3300042135 Ga0450899_005478 Ga0450899_005478_830_1315 157
206 3300042138 Ga0450903_012391 Ga0450903_012391_595_1101 157
207 3300042156 Ga0439446_0011952 Ga0439446_0011952_1558_2064 157
208 3300042439 Ga0439464_0015168 Ga0439464_0015168_1059_1565 157
209 3300042461 Ga0439460_0055478 Ga0439460_0055478_52_558 157
210 3300044684 Ga0466966_0275847 Ga0466966_0275847_35_514 157
211 3300044693 Ga0466961_0092563 Ga0466961_0092563_1356_1832 157
212 3300044765 Ga0466970_0076922 Ga0466970_0076922_20_496 157
213 3300044842 Ga0466957_0228284 Ga0466957_0228284_78_554 157
214 3300045976 Ga0466967_0468016 Ga0466967_0468016_563_1039 157
215 3300045976 Ga0466967_0800801 Ga0466967_0800801_445_921 157
216 3300046539 Ga0495621_0178114 Ga0495621_0178114_238_738 157
217 3300047320 Ga0495672_0006547 Ga0495672_0006547_2568_3041 157
218 3300048912 Ga0496109_1085171 Ga0496109_1085171_64_552 157
219 3300048913 Ga0496110_0833230 Ga0496110_0833230_280_768 157
220 3300048919 Ga0496116_0310299 Ga0496116_0310299_235_726 157
221 3300049127 Ga0501306_029786 Ga0501306_029786_57_554 157
222 3300049127 Ga0501306_036132 Ga0501306_036132_238_714 157
223 3300049128 Ga0501308_021226 Ga0501308_021226_119_655 157
224 3300049128 Ga0501308_035509 Ga0501308_035509_121_597 157
225 3300049130 Ga0501310_018654 Ga0501310_018654_197_700 157
226 3300049161 Ga0501305_026172 Ga0501305_026172_276_761 157
227 3300049161 Ga0501305_032052 Ga0501305_032052_264_767 157
228 3300049162 Ga0501307_013967 Ga0501307_013967_215_700 157
229 3300049530 Ga0501314_009545 Ga0501314_009545_276_779 157
230 3300049531 Ga0501315_025833 Ga0501315_025833_120_605 157
231 3300049531 Ga0501315_027625 Ga0501315_027625_68_556 157
232 3300049536 Ga0501320_012826 Ga0501320_012826_279_782 157
233 3300049539 Ga0501323_039680 Ga0501323_039680_103_606 157
234 3300049541 Ga0501325_011523 Ga0501325_011523_117_605 157
235 3300049541 Ga0501325_023848 Ga0501325_023848_110_595 157
236 3300049545 Ga0501329_14249 Ga0501329_14249_16_492 157
237 3300049552 Ga0501336_012477 Ga0501336_012477_119_604 157
238 3300049569 Ga0501032_0588208 Ga0501032_0588208_179_655 157
239 3300049570 Ga0501033_0013119 Ga0501033_0013119_5758_6234 157
240 3300049571 Ga0501034_0047010 Ga0501034_0047010_2486_2962 157
241 3300049572 Ga0501036_0241103 Ga0501036_0241103_602_1078 157
242 3300049574 Ga0501038_0283854 Ga0501038_0283854_502_978 157
243 3300049580 Ga0501046_0055501 Ga0501046_0055501_658_1134 157
244 3300049581 Ga0501047_0114769 Ga0501047_0114769_1942_2421 157
245 3300049581 Ga0501047_0507800 Ga0501047_0507800_173_649 157
246 3300049582 Ga0501048_0364181 Ga0501048_0364181_535_1011 157
247 3300049590 Ga0501074_0383063 Ga0501074_0383063_94_570 157
248 3300049742 Ga0501080_0061097 Ga0501080_0061097_2327_2803 157
249 3300049822 Ga0501035_0698512 Ga0501035_0698512_228_704 157
250 3300049823 Ga0501044_0100462 Ga0501044_0100462_2255_2731 157
251 3300050490 nmdc:mga03n38_99071_c1 nmdc:mga03n38_99071_c1_12_491 157
252 3300050491 nmdc:mga00v17_266766_c1 nmdc:mga00v17_266766_c1_552_1043 157
253 3300050492 nmdc:mga0yw44_560581_c1 nmdc:mga0yw44_560581_c1_13_489 157
254 3300050492 nmdc:mga0yw44_72462_c1 nmdc:mga0yw44_72462_c1_847_1323 157
255 3300050493 nmdc:mga0k408_177723_c1 nmdc:mga0k408_177723_c1_174_650 157
256 3300050493 nmdc:mga0k408_187084_c1 nmdc:mga0k408_187084_c1_649_1143 157
257 3300050493 nmdc:mga0k408_712267_c1 nmdc:mga0k408_712267_c1_47_532 157
258 3300050496 nmdc:mga07m45_59183_c1 nmdc:mga07m45_59183_c1_582_1073 157
259 3300050496 nmdc:mga07m45_749892_c1 nmdc:mga07m45_749892_c1_59_544 157
260 3300050508 nmdc:mga09592_319894_c1 nmdc:mga09592_319894_c1_806_1282 157
261 3300053088 Ga0500644_0008890 Ga0500644_0008890_1959_2447 157
262 3300053094 Ga0500566_0088057 Ga0500566_0088057_673_1176 157
263 3300053094 Ga0500566_0144045 Ga0500566_0144045_397_900 157
264 3300053100 Ga0500660_061601 Ga0500660_061601_287_781 157
265 3300053108 Ga0500562_025549 Ga0500562_025549_50_538 157
266 3300053118 Ga0500594_0170017 Ga0500594_0170017_64_558 157
267 3300053142 Ga0500577_0161953 Ga0500577_0161953_250_753 157
268 3300053145 Ga0500586_095206 Ga0500586_095206_455_931 157
269 3300053153 Ga0500616_0083310 Ga0500616_0083310_1048_1539 157
270 3300053730 Ga0500645_000336 Ga0500645_000336_27383_27877 157
271 3300053730 Ga0500645_012228 Ga0500645_012228_1490_1984 157
272 3300059630 Ga0587128_074270 Ga0587128_074270_118_594 157
273 3300059643 Ga0587072_089152 Ga0587072_089152_90_578 157
274 3300060353 Ga0501082_0552941 Ga0501082_0552941_163_639 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00866

Ring_hydroxyl_B

Ring hydroxylating beta subunit

37

172

0.89

PF13577

SnoaL_4

SnoaL-like domain

23

162

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2chc-assembly1.cif.gz_A structure of rv3472(d26n), a function unknown protein from mycobacterium tuberculosis 0.8884 8 145
3eby-assembly1.cif.gz_A crystal structure of the beta subunit of a putative aromatic-ring-hydroxylating dioxygenase (yp_001165631.1) from novosphingobium aromaticivorans dsm 12444 at 1.75 a resolution 0.8821 8 146
6p77-assembly1.cif.gz_A 2.5 angstrom structure of caci_6494 from catenulispora acidiphila 0.8775 7 147
6p7l-assembly2.cif.gz_C 1.8 angstrom structure of aln2 from streptomyces sp. cm020 0.8756 1 142
2chc-assembly1.cif.gz_C structure of rv3472(d26n), a function unknown protein from mycobacterium tuberculosis 0.8744 3 145
ID Description Score Start End Superfamily
3ebyA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8858 8 146 3.10.450.50
2chcB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8759 8 145 3.10.450.50
af_O07237_11_153_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.833 3 144 3.10.450.50
2rgqA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8217 11 146 3.10.450.50
2b1xB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8085 1 149 3.10.450.50
ID Description Score Start End GO Terms
AF-H1S7F7-F1-model_v4 SnoaL-like domain-containing protein 0.9359 56 149
AF-Q9ZAT9-F1-model_v4 Daunorubicin biosynthesis enzyme 0.9015 1 146
AF-A0A1C4P9Z2-F1-model_v4 SnoaL-like domain-containing protein 0.9011 3 146
AF-A0A418PYG0-F1-model_v4 DUF4440 domain-containing protein 0.8973 1 145
AF-A0A164HQZ4-F1-model_v4 SnoaL-like domain-containing protein 0.8933 17 151 GO:0016491

Feature Viewer

pLDDT pTM Quality
85.71 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map