F380002

General Info

Members Datasets Scaffolds Average Seq Length
274 183 215 162

Family's Representative Sequence

Representative Sequence 3300048921|Ga0496118_0303135|Ga0496118_0303135_280_768
Length 162
Sequence MAVRPIRIFGDPVLRGTCAPIDDIDDGVRSLVTDLVDSVAEPGRAGVAAPQIGVALRAFSYNVDGVIGYVLNPVLEVSGDPEPTGEGCLSVPGLWHDALRHPWARVTGLGLDGAEIVIEGEGLLAQALQHECDHLDGILYLDRLPKDVRRQAMREVRESDWF

Samples

Sample ID Description Type Environment
1 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
2 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
3 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
4 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
5 2643221546 Microbacterium sp. Root53 Isolate Unclassified
6 2643221553 Microbacterium sp. Root553 Isolate Unclassified
7 2643221566 Microbacterium sp. Root166 Isolate Unclassified
8 2643221575 Microbacterium sp. Root61 Isolate Unclassified
9 2643221630 Microbacterium sp. Root322 Isolate Unclassified
10 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
11 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
12 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
13 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
14 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
15 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
16 2773857759 Microbacterium sp. 1294 Isolate Unclassified
17 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
18 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
19 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
20 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
21 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
22 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
23 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
24 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
25 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
26 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
27 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
28 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
29 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
30 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
31 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
32 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
33 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
34 2919069694 Microbacterium sp. 1154 Isolate Unclassified
35 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
36 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
37 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
38 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
39 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
40 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
41 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
42 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
43 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
44 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
45 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
46 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
47 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
48 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
49 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
50 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
51 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
52 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
53 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
54 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
92 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
93 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
121 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
122 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
123 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
124 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
125 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
135 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
172 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
175 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
176 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
177 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
178 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
179 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
180 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
181 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
182 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
183 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.47
Metatranscriptomes 0
Isolates 21.53

Biome Distribution

Category Percentage (%)
Aerial Root 0.73
Bulb 0
Endosphere 10.95
Nodule 0
Rhizoplane 9.49
Rhizosphere 48.54
Stem 0
Stem Tuber 0
Unclassified 30.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10034079 3300001979 Bacteria 1608
2 Ga0068869_100362382 3300005334 Bacteria 1184
3 Ga0068868_100358043 3300005338 Bacteria 1251
4 Ga0070660_100784209 3300005339 Bacteria 801
5 Ga0070668_100069216 3300005347 Bacteria 2745
6 Ga0070675_100398716 3300005354 Bacteria 1227
7 Ga0070663_100594314 3300005455 Bacteria 930
8 Ga0070678_100210380 3300005456 Bacteria 1611
9 Ga0070678_100319672 3300005456 Bacteria 1325
10 Ga0070678_100752016 3300005456 Bacteria 882
11 Ga0070679_100755787 3300005530 Bacteria 915
12 Ga0068853_100281873 3300005539 Bacteria 1532
13 Ga0070672_101038973 3300005543 Bacteria 727
14 Ga0070696_100686631 3300005546 Bacteria 833
15 Ga0070665_100072188 3300005548 Bacteria 3460
16 Ga0068855_101472172 3300005563 Bacteria 700
17 Ga0068856_100873702 3300005614 Bacteria 918
18 Ga0068856_100954821 3300005614 Bacteria 876
19 Ga0068861_100037062 3300005719 Bacteria 3624
20 Ga0068870_10005248 3300005840 Bacteria 5640
21 Ga0068862_100374698 3300005844 Bacteria 1326
22 Ga0075365_10092204 3300006038 Bacteria 2065
23 Ga0075365_10121732 3300006038 Bacteria 1800
24 Ga0075363_100130795 3300006048 Bacteria 1407
25 Ga0075364_10027048 3300006051 Bacteria 3661
26 Ga0075364_10076653 3300006051 Bacteria 2206
27 Ga0075364_10128972 3300006051 Bacteria 1697
28 Ga0075364_10143671 3300006051 Bacteria 1606
29 Ga0075364_10168267 3300006051 Bacteria 1481
30 Ga0075364_10223205 3300006051 Bacteria 1279
31 Ga0075364_10328250 3300006051 Bacteria 1042
32 Ga0075367_10021822 3300006178 Bacteria 3584
33 Ga0075367_10121733 3300006178 Bacteria 1608
34 Ga0075369_10014400 3300006186 Bacteria 3158
35 Ga0075370_10059678 3300006353 Bacteria 2171
36 Ga0075428_100946748 3300006844 Bacteria 913
37 Ga0105244_10016628 3300009036 Bacteria 4184
38 Ga0105244_10016629 3300009036 Bacteria 4184
39 Ga0105244_10167782 3300009036 Bacteria 1046
40 Ga0111539_10376384 3300009094 Bacteria 1653
41 Ga0105243_10039989 3300009148 Bacteria 3659
42 Ga0105243_10352680 3300009148 Bacteria 1352
43 Ga0105243_10387639 3300009148 Bacteria 1294
44 Ga0105243_11285085 3300009148 Bacteria 748
45 Ga0105239_11855669 3300010375 Bacteria 699
46 Ga0157371_10024678 3300013102 Bacteria 4387
47 Ga0157370_10123261 3300013104 Bacteria 2420
48 Ga0157369_10341558 3300013105 Bacteria 1555
49 Ga0171462_1003 3300013250 Bacteria 853796
50 Ga0163162_10105762 3300013306 Bacteria 2908
51 Ga0157372_10480056 3300013307 Bacteria 1449
52 Ga0157375_10468855 3300013308 Bacteria 1424
53 Ga0163163_10933004 3300014325 Bacteria 931
54 Ga0157380_10014779 3300014326 Bacteria 5717
55 Ga0209646_1000248 3300025246 Bacteria 54666
56 Ga0209759_1030182 3300025256 Bacteria 1075
57 Ga0207655_1005377 3300025728 Bacteria 8721
58 Ga0207655_1179026 3300025728 Bacteria 649
59 Ga0207692_10013042 3300025898 Bacteria 3593
60 Ga0207692_10281555 3300025898 Bacteria 1006
61 Ga0207688_10128205 3300025901 Bacteria 1486
62 Ga0207647_10022807 3300025904 Bacteria 4152
63 Ga0207662_10118322 3300025918 Bacteria 1659
64 Ga0207652_10353899 3300025921 Bacteria 1325
65 Ga0207709_10247003 3300025935 Bacteria 1301
66 Ga0207691_10909550 3300025940 Bacteria 736
67 Ga0207689_10158367 3300025942 Bacteria 1866
68 Ga0207667_10610866 3300025949 Bacteria 1099
69 Ga0207639_10336738 3300026041 Bacteria 1344
70 Ga0207678_10242782 3300026067 Bacteria 1543
71 Ga0207678_10532863 3300026067 Bacteria 1026
72 Ga0207702_10766270 3300026078 Bacteria 953
73 Ga0207675_100411690 3300026118 Bacteria 1334
74 Ga0207683_10279938 3300026121 Bacteria 1524
75 Ga0207683_10351856 3300026121 Bacteria 1352
76 Ga0265327_10182760 3300031251 Bacteria 958
77 Ga0307514_10001412 3300031649 Bacteria 29641
78 Ga0307405_10298533 3300031731 Bacteria 1221
79 Ga0307406_10000034 3300031901 Bacteria 83739
80 Ga0307406_10000392 3300031901 Bacteria 25311
81 Ga0307406_10009054 3300031901 Bacteria 5568
82 Ga0307406_10019285 3300031901 Bacteria 4001
83 Ga0307406_10199709 3300031901 Bacteria 1471
84 Ga0307406_10340321 3300031901 Bacteria 1168
85 Ga0307412_10310247 3300031911 Bacteria 1251
86 Ga0307409_100185770 3300031995 Bacteria 1845
87 Ga0307409_100198129 3300031995 Bacteria 1794
88 Ga0307409_100774566 3300031995 Bacteria 965
89 Ga0307416_100529045 3300032002 Bacteria 1249
90 Ga0307416_101103892 3300032002 Bacteria 898
91 Ga0307414_10086854 3300032004 Bacteria 2309
92 Ga0307414_10107864 3300032004 Bacteria 2111
93 Ga0307414_11228103 3300032004 Bacteria 694
94 Ga0307414_11347054 3300032004 Bacteria 663
95 Ga0307411_11285368 3300032005 Bacteria 666
96 Ga0307415_100067491 3300032126 Bacteria 2500
97 Ga0307415_100192191 3300032126 Bacteria 1612
98 Ga0395898_0114095 3300037466 Bacteria 2589
99 Ga0395898_0178437 3300037466 Bacteria 2030
100 Ga0395901_0131452 3300038443 Bacteria 2630
101 Ga0439465_0148475 3300041413 Bacteria 836
102 Ga0451789_0303884 3300041443 Bacteria 1333
103 Ga0451791_1499039 3300041451 Bacteria 1403
104 Ga0451797_0026632 3300041453 Bacteria 614
105 Ga0451841_1039008 3300041498 Bacteria 1754
106 Ga0451841_1165843 3300041498 Bacteria 1529
107 Ga0451847_0347010 3300041503 Bacteria 1127
108 Ga0451853_1690663 3300041512 Bacteria 1106
109 Ga0450920_036681 3300042122 Bacteria 973
110 Ga0466972_0147301 3300044658 Bacteria 1107
111 Ga0466968_0139471 3300044735 Bacteria 1108
112 Ga0466968_0169124 3300044735 Bacteria 1012
113 Ga0466970_0000004 3300044765 Bacteria 108620
114 Ga0466970_0054681 3300044765 Bacteria 2132
115 Ga0466957_0538404 3300044842 Bacteria 813
116 Ga0466960_0780705 3300044901 Bacteria 577
117 Ga0466967_0411923 3300045976 Bacteria 1316
118 Ga0495627_000214 3300046453 Bacteria 62803
119 Ga0495654_0036011 3300046530 Bacteria 2489
120 Ga0495645_0050685 3300046543 Bacteria 3022
121 Ga0495656_0576281 3300046615 Bacteria 601
122 Ga0495671_0320092 3300046692 Bacteria 745
123 Ga0496100_0852972 3300048903 Bacteria 714
124 Ga0496101_0033704 3300048904 Bacteria 3613
125 Ga0496102_0019244 3300048905 Bacteria 6014
126 Ga0496102_0571387 3300048905 Bacteria 1053
127 Ga0496103_0164750 3300048906 Bacteria 1422
128 Ga0496104_0049226 3300048907 Bacteria 3975
129 Ga0496105_0151989 3300048908 Bacteria 1902
130 Ga0496105_0515669 3300048908 Bacteria 937
131 Ga0496105_0689172 3300048908 Bacteria 785
132 Ga0496108_0027156 3300048911 Bacteria 4724
133 Ga0496108_1298753 3300048911 Bacteria 612
134 Ga0496109_1769408 3300048912 Bacteria 551
135 Ga0496110_0280273 3300048913 Bacteria 1518
136 Ga0496111_0328116 3300048914 Bacteria 1133
137 Ga0496112_0171615 3300048915 Bacteria 2134
138 Ga0496113_0080582 3300048916 Bacteria 2494
139 Ga0496113_0818438 3300048916 Bacteria 739
140 Ga0496114_0021169 3300048917 Bacteria 5288
141 Ga0496114_0033837 3300048917 Bacteria 4214
142 Ga0496114_0134787 3300048917 Bacteria 2135
143 Ga0496114_0150976 3300048917 Bacteria 2015
144 Ga0496114_0470776 3300048917 Bacteria 1112
145 Ga0496115_0510920 3300048918 Bacteria 964
146 Ga0496116_0041678 3300048919 Bacteria 3147
147 Ga0496117_0000232 3300048920 Bacteria 105479
148 Ga0496117_0001383 3300048920 Bacteria 35268
149 Ga0496117_0002730 3300048920 Bacteria 21670
150 Ga0496117_0007872 3300048920 Bacteria 10249
151 Ga0496117_0042271 3300048920 Bacteria 3327
152 Ga0496117_0194103 3300048920 Bacteria 1153
153 Ga0496118_0018901 3300048921 Bacteria 6182
154 Ga0496118_0055945 3300048921 Bacteria 2971
155 Ga0496118_0056049 3300048921 Bacteria 2966
156 Ga0496118_0303135 3300048921 Bacteria 876
157 Ga0496119_0001189 3300048922 Bacteria 32563
158 Ga0496119_0004205 3300048922 Bacteria 14453
159 Ga0496119_0005825 3300048922 Bacteria 11646
160 Ga0496119_0010849 3300048922 Bacteria 7619
161 Ga0496120_0001174 3300048923 Bacteria 33434
162 Ga0496120_0001282 3300048923 Bacteria 31373
163 Ga0496120_0004149 3300048923 Bacteria 12462
164 Ga0496120_0004696 3300048923 Bacteria 11275
165 Ga0496120_0068079 3300048923 Bacteria 1965
166 Ga0496122_0000030 3300048925 Bacteria 331586
167 Ga0496122_0002594 3300048925 Bacteria 25336
168 Ga0496122_0002595 3300048925 Bacteria 25327
169 Ga0496122_0004089 3300048925 Bacteria 18484
170 Ga0496122_0012980 3300048925 Bacteria 8216
171 Ga0496122_0014711 3300048925 Bacteria 7544
172 Ga0496123_0000024 3300048926 Bacteria 331587
173 Ga0496123_0000051 3300048926 Bacteria 237095
174 Ga0496123_0001071 3300048926 Bacteria 41360
175 Ga0496123_0002826 3300048926 Bacteria 20537
176 Ga0496124_0007705 3300048927 Bacteria 11387
177 Ga0496124_0034504 3300048927 Bacteria 4439
178 Ga0496124_0043063 3300048927 Bacteria 3882
179 Ga0496124_0122324 3300048927 Bacteria 2078
180 Ga0496125_0000097 3300048928 Bacteria 204607
181 Ga0496125_0002398 3300048928 Bacteria 24410
182 Ga0496125_0004040 3300048928 Bacteria 17201
183 Ga0496125_0024198 3300048928 Bacteria 5587
184 Ga0496125_0031196 3300048928 Bacteria 4753
185 Ga0496125_0051500 3300048928 Bacteria 3395
186 Ga0496125_0221658 3300048928 Bacteria 1218
187 Ga0496126_0002454 3300048929 Bacteria 25035
188 Ga0496126_0008783 3300048929 Bacteria 10845
189 Ga0496126_0067819 3300048929 Bacteria 3186
190 Ga0496126_0199301 3300048929 Bacteria 1691
191 Ga0501033_0274934 3300049570 Bacteria 1190
192 Ga0501034_0000227 3300049571 Bacteria 106244
193 Ga0501034_0064650 3300049571 Bacteria 3672
194 Ga0501034_0657450 3300049571 Bacteria 949
195 Ga0501038_0303993 3300049574 Bacteria 1251
196 Ga0501039_0098897 3300049575 Bacteria 2276
197 Ga0501039_0613959 3300049575 Bacteria 852
198 Ga0501079_0576511 3300049741 Bacteria 885
199 nmdc:mga03n38_177843_c1 3300050490 Bacteria 1088
200 nmdc:mga00v17_134606_c1 3300050491 Bacteria 1581
201 nmdc:mga00v17_224221_c1 3300050491 Bacteria 1217
202 nmdc:mga00v17_227894_c1 3300050491 Bacteria 1207
203 nmdc:mga00v17_37855_c1 3300050491 Bacteria 2882
204 nmdc:mga00v17_63555_c2 3300050491 Bacteria 1685
205 nmdc:mga00v17_73084_c1 3300050491 Bacteria 2129
206 nmdc:mga00v17_85963_c1 3300050491 Bacteria 1970
207 nmdc:mga0yw44_5524_c1 3300050492 Bacteria 5990
208 nmdc:mga06z11_52975_c1 3300050494 Bacteria 2085
209 nmdc:mga07m45_318760_c1 3300050496 Bacteria 904
210 nmdc:mga08y16_387712_c1 3300050511 Bacteria 1431
211 nmdc:mga0sz30_63282_c1 3300050516 Bacteria 1583
212 Ga0500650_0016204 3300053098 Bacteria 3193
213 Ga0500577_0001723 3300053142 Bacteria 5601
214 Ga0500577_0015773 3300053142 Bacteria 2368
215 Ga0500577_0308333 3300053142 Bacteria 691

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041498 Ga0451841_1165843 Ga0451841_1165843_657_1112 151
2 3300032126 Ga0307415_100192191 Ga0307415_1001921912 153
3 3300050491 nmdc:mga00v17_63555_c2 nmdc:mga00v17_63555_c2_592_1062 156
4 iso_pu_bacteria 2773857759 2774384752 158
5 iso_pu_bacteria 2977251589 2977253665 158
6 iso_pu_bacteria 2585427649 2586062753 159
7 iso_pu_bacteria 2585428094 2587862503 159
8 iso_pu_bacteria 2585428157 2588108170 159
9 iso_pu_bacteria 2643221542 2643733325 159
10 iso_pu_bacteria 2643221546 2643753547 159
11 iso_pu_bacteria 2643221553 2643786186 159
12 iso_pu_bacteria 2643221566 2643848038 159
13 iso_pu_bacteria 2643221575 2643885065 159
14 iso_pu_bacteria 2643221630 2644169899 159
15 iso_pu_bacteria 2643221635 2644199441 159
16 iso_pu_bacteria 2643221724 2644680579 159
17 iso_pu_bacteria 2728369380 2730230039 159
18 iso_pu_bacteria 2747842429 2747952762 159
19 iso_pu_bacteria 2757320536 2758227212 159
20 iso_pu_bacteria 2773857758 2774381615 159
21 iso_pu_bacteria 2773857763 2774399864 159
22 iso_pu_bacteria 2808606306 2808631478 159
23 iso_pu_bacteria 2808606368 2808885364 159
24 iso_pu_bacteria 2808606447 2809227116 159
25 iso_pu_bacteria 2811994872 2812322797 159
26 iso_pu_bacteria 2821268502 2821269673 159
27 iso_pu_bacteria 2833709550 2833710620 159
28 iso_pu_bacteria 2852632344 2852633503 159
29 iso_pu_bacteria 2852646457 2852648740 159
30 iso_pu_bacteria 2852663356 2852666887 159
31 iso_pu_bacteria 2857720070 2857720523 159
32 iso_pu_bacteria 2857723135 2857724244 159
33 iso_pu_bacteria 2870622029 2870623302 159
34 iso_pu_bacteria 2870628048 2870630039 159
35 iso_pu_bacteria 2895660088 2895661100 159
36 iso_pu_bacteria 2904509784 2904512729 159
37 iso_pu_bacteria 2908678064 2908681273 159
38 iso_pu_bacteria 2919069694 2919071437 159
39 iso_pu_bacteria 2919443155 2919445893 159
40 iso_pu_bacteria 2928090899 2928092393 159
41 iso_pu_bacteria 2939657138 2939657736 159
42 iso_pu_bacteria 2939660829 2939660917 159
43 iso_pu_bacteria 2945968032 2945968166 159
44 iso_pu_bacteria 2946033335 2946033420 159
45 iso_pu_bacteria 2946041624 2946044665 159
46 iso_pu_bacteria 2946080515 2946080565 159
47 iso_pu_bacteria 2966924647 2966924692 159
48 iso_pu_bacteria 2974294766 2974297749 159
49 iso_pu_bacteria 2974324384 2974326017 159
50 iso_pu_bacteria 2977228692 2977230979 159
51 iso_pu_bacteria 2977236895 2977239775 159
52 iso_pu_bacteria 2977264416 2977266216 159
53 iso_pu_bacteria 2984542743 2984545952 159
54 iso_pu_bacteria 2984580707 2984580841 159
55 iso_pu_bacteria 2995726249 2995728263 159
56 iso_pu_bacteria 8002811521 8002812873 159
57 iso_pu_bacteria 8004182704 8004184811 159
58 iso_pu_bacteria 8004212874 8004214418 159
59 iso_pu_bacteria 8016254467 8016257925 159
60 iso_pu_bacteria 8045830549 8045830847 159
61 iso_pu_bacteria 8055034563 8055035719 159
62 iso_pu_bacteria 8055037949 8055038725 159
63 3300005614 Ga0068856_100954821 Ga0068856_1009548212 162
64 3300010375 Ga0105239_11855669 Ga0105239_118556691 162
65 3300013102 Ga0157371_10024678 Ga0157371_100246783 162
66 3300013105 Ga0157369_10341558 Ga0157369_103415582 162
67 3300013306 Ga0163162_10105762 Ga0163162_101057622 162
68 3300048903 Ga0496100_0852972 Ga0496100_0852972_34_522 162
69 3300048904 Ga0496101_0033704 Ga0496101_0033704_1509_1997 162
70 3300048905 Ga0496102_0019244 Ga0496102_0019244_2402_2890 162
71 3300048906 Ga0496103_0164750 Ga0496103_0164750_718_1206 162
72 3300048908 Ga0496105_0151989 Ga0496105_0151989_1110_1598 162
73 3300048911 Ga0496108_1298753 Ga0496108_1298753_36_524 162
74 3300048914 Ga0496111_0328116 Ga0496111_0328116_188_676 162
75 3300048915 Ga0496112_0171615 Ga0496112_0171615_927_1415 162
76 3300048917 Ga0496114_0150976 Ga0496114_0150976_77_565 162
77 3300048917 Ga0496114_0470776 Ga0496114_0470776_460_948 162
78 3300048918 Ga0496115_0510920 Ga0496115_0510920_242_730 162
79 3300048921 Ga0496118_0303135 Ga0496118_0303135_280_768 162
80 3300048923 Ga0496120_0068079 Ga0496120_0068079_1408_1896 162
81 3300001979 JGI24740J21852_10034079 JGI24740J21852_100340792 163
82 3300005334 Ga0068869_100362382 Ga0068869_1003623822 163
83 3300005338 Ga0068868_100358043 Ga0068868_1003580432 163
84 3300005339 Ga0070660_100784209 Ga0070660_1007842092 163
85 3300005347 Ga0070668_100069216 Ga0070668_1000692162 163
86 3300005354 Ga0070675_100398716 Ga0070675_1003987162 163
87 3300005455 Ga0070663_100594314 Ga0070663_1005943142 163
88 3300005456 Ga0070678_100210380 Ga0070678_1002103802 163
89 3300005456 Ga0070678_100319672 Ga0070678_1003196722 163
90 3300005456 Ga0070678_100752016 Ga0070678_1007520162 163
91 3300005530 Ga0070679_100755787 Ga0070679_1007557872 163
92 3300005539 Ga0068853_100281873 Ga0068853_1002818732 163
93 3300005543 Ga0070672_101038973 Ga0070672_1010389732 163
94 3300005546 Ga0070696_100686631 Ga0070696_1006866311 163
95 3300005548 Ga0070665_100072188 Ga0070665_1000721883 163
96 3300005563 Ga0068855_101472172 Ga0068855_1014721722 163
97 3300005614 Ga0068856_100873702 Ga0068856_1008737022 163
98 3300005719 Ga0068861_100037062 Ga0068861_1000370621 163
99 3300005840 Ga0068870_10005248 Ga0068870_100052483 163
100 3300005844 Ga0068862_100374698 Ga0068862_1003746982 163
101 3300006038 Ga0075365_10092204 Ga0075365_100922042 163
102 3300006038 Ga0075365_10121732 Ga0075365_101217322 163
103 3300006048 Ga0075363_100130795 Ga0075363_1001307952 163
104 3300006051 Ga0075364_10027048 Ga0075364_100270482 163
105 3300006051 Ga0075364_10076653 Ga0075364_100766532 163
106 3300006051 Ga0075364_10128972 Ga0075364_101289722 163
107 3300006051 Ga0075364_10143671 Ga0075364_101436712 163
108 3300006051 Ga0075364_10168267 Ga0075364_101682672 163
109 3300006051 Ga0075364_10223205 Ga0075364_102232052 163
110 3300006051 Ga0075364_10328250 Ga0075364_103282502 163
111 3300006178 Ga0075367_10021822 Ga0075367_100218222 163
112 3300006178 Ga0075367_10121733 Ga0075367_101217331 163
113 3300006186 Ga0075369_10014400 Ga0075369_100144003 163
114 3300006353 Ga0075370_10059678 Ga0075370_100596782 163
115 3300006844 Ga0075428_100946748 Ga0075428_1009467481 163
116 3300009036 Ga0105244_10016628 Ga0105244_100166282 163
117 3300009036 Ga0105244_10016629 Ga0105244_100166292 163
118 3300009036 Ga0105244_10167782 Ga0105244_101677821 163
119 3300009094 Ga0111539_10376384 Ga0111539_103763842 163
120 3300009148 Ga0105243_10039989 Ga0105243_100399893 163
121 3300009148 Ga0105243_10352680 Ga0105243_103526802 163
122 3300009148 Ga0105243_10387639 Ga0105243_103876392 163
123 3300009148 Ga0105243_11285085 Ga0105243_112850852 163
124 3300013104 Ga0157370_10123261 Ga0157370_101232612 163
125 3300013250 Ga0171462_1003 Ga0171462_1003732 163
126 3300013307 Ga0157372_10480056 Ga0157372_104800562 163
127 3300013308 Ga0157375_10468855 Ga0157375_104688552 163
128 3300014325 Ga0163163_10933004 Ga0163163_109330042 163
129 3300014326 Ga0157380_10014779 Ga0157380_100147792 163
130 3300025246 Ga0209646_1000248 Ga0209646_100024823 163
131 3300025256 Ga0209759_1030182 Ga0209759_10301821 163
132 3300025728 Ga0207655_1005377 Ga0207655_10053777 163
133 3300025728 Ga0207655_1179026 Ga0207655_11790261 163
134 3300025898 Ga0207692_10013042 Ga0207692_100130423 163
135 3300025898 Ga0207692_10281555 Ga0207692_102815552 163
136 3300025901 Ga0207688_10128205 Ga0207688_101282052 163
137 3300025904 Ga0207647_10022807 Ga0207647_100228072 163
138 3300025918 Ga0207662_10118322 Ga0207662_101183222 163
139 3300025921 Ga0207652_10353899 Ga0207652_103538992 163
140 3300025935 Ga0207709_10247003 Ga0207709_102470032 163
141 3300025940 Ga0207691_10909550 Ga0207691_109095502 163
142 3300025942 Ga0207689_10158367 Ga0207689_101583672 163
143 3300025949 Ga0207667_10610866 Ga0207667_106108662 163
144 3300026041 Ga0207639_10336738 Ga0207639_103367382 163
145 3300026067 Ga0207678_10242782 Ga0207678_102427822 163
146 3300026067 Ga0207678_10532863 Ga0207678_105328632 163
147 3300026078 Ga0207702_10766270 Ga0207702_107662702 163
148 3300026118 Ga0207675_100411690 Ga0207675_1004116902 163
149 3300026121 Ga0207683_10279938 Ga0207683_102799382 163
150 3300026121 Ga0207683_10351856 Ga0207683_103518562 163
151 3300031251 Ga0265327_10182760 Ga0265327_101827602 163
152 3300031649 Ga0307514_10001412 Ga0307514_100014122 163
153 3300031731 Ga0307405_10298533 Ga0307405_102985332 163
154 3300031901 Ga0307406_10000034 Ga0307406_1000003441 163
155 3300031901 Ga0307406_10000392 Ga0307406_100003925 163
156 3300031901 Ga0307406_10009054 Ga0307406_100090543 163
157 3300031901 Ga0307406_10019285 Ga0307406_100192853 163
158 3300031901 Ga0307406_10199709 Ga0307406_101997092 163
159 3300031901 Ga0307406_10340321 Ga0307406_103403212 163
160 3300031911 Ga0307412_10310247 Ga0307412_103102472 163
161 3300031995 Ga0307409_100185770 Ga0307409_1001857702 163
162 3300031995 Ga0307409_100198129 Ga0307409_1001981292 163
163 3300031995 Ga0307409_100774566 Ga0307409_1007745662 163
164 3300032002 Ga0307416_100529045 Ga0307416_1005290452 163
165 3300032002 Ga0307416_101103892 Ga0307416_1011038922 163
166 3300032004 Ga0307414_10086854 Ga0307414_100868542 163
167 3300032004 Ga0307414_10107864 Ga0307414_101078642 163
168 3300032004 Ga0307414_11228103 Ga0307414_112281032 163
169 3300032004 Ga0307414_11347054 Ga0307414_113470542 163
170 3300032005 Ga0307411_11285368 Ga0307411_112853682 163
171 3300032126 Ga0307415_100067491 Ga0307415_1000674912 163
172 3300037466 Ga0395898_0114095 Ga0395898_0114095_1793_2284 163
173 3300037466 Ga0395898_0178437 Ga0395898_0178437_584_1075 163
174 3300038443 Ga0395901_0131452 Ga0395901_0131452_84_575 163
175 3300041413 Ga0439465_0148475 Ga0439465_0148475_204_710 163
176 3300041443 Ga0451789_0303884 Ga0451789_0303884_307_798 163
177 3300041451 Ga0451791_1499039 Ga0451791_1499039_517_1011 163
178 3300041453 Ga0451797_0026632 Ga0451797_0026632_90_581 163
179 3300041498 Ga0451841_1039008 Ga0451841_1039008_185_676 163
180 3300041503 Ga0451847_0347010 Ga0451847_0347010_133_651 163
181 3300041512 Ga0451853_1690663 Ga0451853_1690663_172_663 163
182 3300042122 Ga0450920_036681 Ga0450920_036681_27_518 163
183 3300044658 Ga0466972_0147301 Ga0466972_0147301_595_1086 163
184 3300044735 Ga0466968_0139471 Ga0466968_0139471_337_831 163
185 3300044735 Ga0466968_0169124 Ga0466968_0169124_376_867 163
186 3300044765 Ga0466970_0000004 Ga0466970_0000004_35946_36437 163
187 3300044765 Ga0466970_0054681 Ga0466970_0054681_1229_1720 163
188 3300044842 Ga0466957_0538404 Ga0466957_0538404_23_574 163
189 3300044901 Ga0466960_0780705 Ga0466960_0780705_59_550 163
190 3300045976 Ga0466967_0411923 Ga0466967_0411923_700_1191 163
191 3300046453 Ga0495627_000214 Ga0495627_000214_2827_3318 163
192 3300046530 Ga0495654_0036011 Ga0495654_0036011_1095_1586 163
193 3300046543 Ga0495645_0050685 Ga0495645_0050685_343_834 163
194 3300046615 Ga0495656_0576281 Ga0495656_0576281_19_510 163
195 3300046692 Ga0495671_0320092 Ga0495671_0320092_64_555 163
196 3300048905 Ga0496102_0571387 Ga0496102_0571387_10_501 163
197 3300048907 Ga0496104_0049226 Ga0496104_0049226_1049_1540 163
198 3300048908 Ga0496105_0515669 Ga0496105_0515669_399_890 163
199 3300048908 Ga0496105_0689172 Ga0496105_0689172_16_507 163
200 3300048911 Ga0496108_0027156 Ga0496108_0027156_4055_4546 163
201 3300048912 Ga0496109_1769408 Ga0496109_1769408_49_540 163
202 3300048913 Ga0496110_0280273 Ga0496110_0280273_870_1361 163
203 3300048916 Ga0496113_0080582 Ga0496113_0080582_393_884 163
204 3300048916 Ga0496113_0818438 Ga0496113_0818438_222_713 163
205 3300048917 Ga0496114_0021169 Ga0496114_0021169_1948_2439 163
206 3300048917 Ga0496114_0033837 Ga0496114_0033837_3488_3979 163
207 3300048917 Ga0496114_0134787 Ga0496114_0134787_1403_1894 163
208 3300048919 Ga0496116_0041678 Ga0496116_0041678_845_1336 163
209 3300048920 Ga0496117_0000232 Ga0496117_0000232_13330_13821 163
210 3300048920 Ga0496117_0001383 Ga0496117_0001383_5557_6048 163
211 3300048920 Ga0496117_0002730 Ga0496117_0002730_5234_5725 163
212 3300048920 Ga0496117_0007872 Ga0496117_0007872_9612_10103 163
213 3300048920 Ga0496117_0042271 Ga0496117_0042271_2798_3289 163
214 3300048920 Ga0496117_0194103 Ga0496117_0194103_605_1096 163
215 3300048921 Ga0496118_0018901 Ga0496118_0018901_1607_2098 163
216 3300048921 Ga0496118_0055945 Ga0496118_0055945_1778_2269 163
217 3300048921 Ga0496118_0056049 Ga0496118_0056049_15_506 163
218 3300048922 Ga0496119_0001189 Ga0496119_0001189_626_1117 163
219 3300048922 Ga0496119_0004205 Ga0496119_0004205_9486_9977 163
220 3300048922 Ga0496119_0005825 Ga0496119_0005825_8217_8708 163
221 3300048922 Ga0496119_0010849 Ga0496119_0010849_970_1461 163
222 3300048923 Ga0496120_0001174 Ga0496120_0001174_9288_9779 163
223 3300048923 Ga0496120_0001282 Ga0496120_0001282_3523_4014 163
224 3300048923 Ga0496120_0004149 Ga0496120_0004149_9320_9811 163
225 3300048923 Ga0496120_0004696 Ga0496120_0004696_6820_7311 163
226 3300048925 Ga0496122_0000030 Ga0496122_0000030_195505_195996 163
227 3300048925 Ga0496122_0002594 Ga0496122_0002594_24529_25020 163
228 3300048925 Ga0496122_0002595 Ga0496122_0002595_4415_4906 163
229 3300048925 Ga0496122_0004089 Ga0496122_0004089_5256_5747 163
230 3300048925 Ga0496122_0012980 Ga0496122_0012980_6839_7330 163
231 3300048925 Ga0496122_0014711 Ga0496122_0014711_424_915 163
232 3300048926 Ga0496123_0000024 Ga0496123_0000024_195506_195997 163
233 3300048926 Ga0496123_0000051 Ga0496123_0000051_5023_5514 163
234 3300048926 Ga0496123_0001071 Ga0496123_0001071_26950_27441 163
235 3300048926 Ga0496123_0002826 Ga0496123_0002826_17551_18042 163
236 3300048927 Ga0496124_0007705 Ga0496124_0007705_5138_5629 163
237 3300048927 Ga0496124_0034504 Ga0496124_0034504_1119_1610 163
238 3300048927 Ga0496124_0043063 Ga0496124_0043063_2202_2693 163
239 3300048927 Ga0496124_0122324 Ga0496124_0122324_45_536 163
240 3300048928 Ga0496125_0000097 Ga0496125_0000097_84509_85000 163
241 3300048928 Ga0496125_0002398 Ga0496125_0002398_20395_20886 163
242 3300048928 Ga0496125_0004040 Ga0496125_0004040_15356_15847 163
243 3300048928 Ga0496125_0024198 Ga0496125_0024198_4102_4593 163
244 3300048928 Ga0496125_0031196 Ga0496125_0031196_385_876 163
245 3300048928 Ga0496125_0051500 Ga0496125_0051500_1698_2189 163
246 3300048928 Ga0496125_0221658 Ga0496125_0221658_82_573 163
247 3300048929 Ga0496126_0002454 Ga0496126_0002454_4738_5229 163
248 3300048929 Ga0496126_0008783 Ga0496126_0008783_1243_1734 163
249 3300048929 Ga0496126_0067819 Ga0496126_0067819_64_555 163
250 3300048929 Ga0496126_0199301 Ga0496126_0199301_14_505 163
251 3300049570 Ga0501033_0274934 Ga0501033_0274934_543_1034 163
252 3300049571 Ga0501034_0000227 Ga0501034_0000227_17305_17796 163
253 3300049571 Ga0501034_0064650 Ga0501034_0064650_541_1032 163
254 3300049571 Ga0501034_0657450 Ga0501034_0657450_291_782 163
255 3300049574 Ga0501038_0303993 Ga0501038_0303993_328_819 163
256 3300049575 Ga0501039_0098897 Ga0501039_0098897_989_1480 163
257 3300049575 Ga0501039_0613959 Ga0501039_0613959_240_731 163
258 3300049741 Ga0501079_0576511 Ga0501079_0576511_81_572 163
259 3300050490 nmdc:mga03n38_177843_c1 nmdc:mga03n38_177843_c1_232_723 163
260 3300050491 nmdc:mga00v17_134606_c1 nmdc:mga00v17_134606_c1_133_624 163
261 3300050491 nmdc:mga00v17_224221_c1 nmdc:mga00v17_224221_c1_315_806 163
262 3300050491 nmdc:mga00v17_227894_c1 nmdc:mga00v17_227894_c1_41_532 163
263 3300050491 nmdc:mga00v17_37855_c1 nmdc:mga00v17_37855_c1_63_554 163
264 3300050491 nmdc:mga00v17_73084_c1 nmdc:mga00v17_73084_c1_562_1053 163
265 3300050491 nmdc:mga00v17_85963_c1 nmdc:mga00v17_85963_c1_759_1250 163
266 3300050492 nmdc:mga0yw44_5524_c1 nmdc:mga0yw44_5524_c1_2629_3120 163
267 3300050494 nmdc:mga06z11_52975_c1 nmdc:mga06z11_52975_c1_466_957 163
268 3300050496 nmdc:mga07m45_318760_c1 nmdc:mga07m45_318760_c1_132_623 163
269 3300050511 nmdc:mga08y16_387712_c1 nmdc:mga08y16_387712_c1_373_864 163
270 3300050516 nmdc:mga0sz30_63282_c1 nmdc:mga0sz30_63282_c1_643_1134 163
271 3300053098 Ga0500650_0016204 Ga0500650_0016204_2674_3168 163
272 3300053142 Ga0500577_0001723 Ga0500577_0001723_1917_2411 163
273 3300053142 Ga0500577_0015773 Ga0500577_0015773_1519_2013 163
274 3300053142 Ga0500577_0308333 Ga0500577_0308333_186_680 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

3

150

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pn3-assembly1.cif.gz_A crystal structure of arabidopsis thaliana petide deformylase 1b (atpdf1b) in complex with inhibitor 21 0.9401 5 159
3pn5-assembly1.cif.gz_A crystal structure of arabidopsis thaliana petide deformylase 1b (atpdf1b) g41q mutant 0.9357 5 159
6jf4-assembly1.cif.gz_A k1u bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii 0.9335 1 144
5mte-assembly2.cif.gz_B crystal structure of pdf from the vibrio parahaemolyticus bacteriophage vp16t in complex with actinonin - crystal form ii 0.9317 5 140
6jf4-assembly1.cif.gz_B k1u bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii 0.9316 1 145
ID Description Score Start End Superfamily
5mtdB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9307 5 140 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9303 1 147 3.90.45.10
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.93 1 145 3.90.45.10
3e3uA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9285 2 159 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9243 1 147 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A1R4HLG4-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9965 25 163 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A840DQ41-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9934 1 163 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A2S5UX42-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9913 1 163 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A373DT04-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9912 1 163 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A6J7CII7-F1-model_v4 peptide deformylase (EC 3.5.1.88) 0.9911 1 163 GO:0042586
GO:0043686

Feature Viewer

pLDDT pTM Quality
96.25 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map