F380002
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 274 | 183 | 215 | 162 |
Family's Representative Sequence
| Representative Sequence | 3300048921|Ga0496118_0303135|Ga0496118_0303135_280_768 |
| Length | 162 |
| Sequence | MAVRPIRIFGDPVLRGTCAPIDDIDDGVRSLVTDLVDSVAEPGRAGVAAPQIGVALRAFSYNVDGVIGYVLNPVLEVSGDPEPTGEGCLSVPGLWHDALRHPWARVTGLGLDGAEIVIEGEGLLAQALQHECDHLDGILYLDRLPKDVRRQAMREVRESDWF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 2 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 3 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 4 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 5 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 6 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 7 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 8 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 9 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 10 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 11 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 12 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 13 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 14 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 15 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 16 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 17 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 18 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 19 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 20 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 21 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 22 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 23 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 24 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 25 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 26 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 27 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 28 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 29 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 30 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 31 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 32 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 33 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 34 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 35 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 36 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 37 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 38 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 39 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 40 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 41 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 42 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 43 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 44 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 45 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 46 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 47 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 48 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 49 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 50 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 51 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 52 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 53 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 54 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 92 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 93 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 109 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 110 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 111 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 112 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 113 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 114 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 115 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 116 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 117 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 118 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 119 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 120 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 121 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 122 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 123 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 124 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 125 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 126 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 127 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 128 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 129 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 130 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 131 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 132 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 133 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 134 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 142 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 143 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 144 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 145 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 148 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 149 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 150 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 151 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 152 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 153 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 154 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 155 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 156 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 157 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 158 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 159 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 160 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 161 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 162 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 163 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 169 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 170 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 171 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 172 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 173 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 175 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 176 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 177 | 8002811521 | Leucobacter chinensis NC76-1 | Isolate | Rhizosphere |
| 178 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 179 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 180 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 181 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 182 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 183 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.47 |
| Metatranscriptomes | 0 |
| Isolates | 21.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.73 |
| Bulb | 0 |
| Endosphere | 10.95 |
| Nodule | 0 |
| Rhizoplane | 9.49 |
| Rhizosphere | 48.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 30.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10034079 | 3300001979 | Bacteria | 1608 |
| 2 | Ga0068869_100362382 | 3300005334 | Bacteria | 1184 |
| 3 | Ga0068868_100358043 | 3300005338 | Bacteria | 1251 |
| 4 | Ga0070660_100784209 | 3300005339 | Bacteria | 801 |
| 5 | Ga0070668_100069216 | 3300005347 | Bacteria | 2745 |
| 6 | Ga0070675_100398716 | 3300005354 | Bacteria | 1227 |
| 7 | Ga0070663_100594314 | 3300005455 | Bacteria | 930 |
| 8 | Ga0070678_100210380 | 3300005456 | Bacteria | 1611 |
| 9 | Ga0070678_100319672 | 3300005456 | Bacteria | 1325 |
| 10 | Ga0070678_100752016 | 3300005456 | Bacteria | 882 |
| 11 | Ga0070679_100755787 | 3300005530 | Bacteria | 915 |
| 12 | Ga0068853_100281873 | 3300005539 | Bacteria | 1532 |
| 13 | Ga0070672_101038973 | 3300005543 | Bacteria | 727 |
| 14 | Ga0070696_100686631 | 3300005546 | Bacteria | 833 |
| 15 | Ga0070665_100072188 | 3300005548 | Bacteria | 3460 |
| 16 | Ga0068855_101472172 | 3300005563 | Bacteria | 700 |
| 17 | Ga0068856_100873702 | 3300005614 | Bacteria | 918 |
| 18 | Ga0068856_100954821 | 3300005614 | Bacteria | 876 |
| 19 | Ga0068861_100037062 | 3300005719 | Bacteria | 3624 |
| 20 | Ga0068870_10005248 | 3300005840 | Bacteria | 5640 |
| 21 | Ga0068862_100374698 | 3300005844 | Bacteria | 1326 |
| 22 | Ga0075365_10092204 | 3300006038 | Bacteria | 2065 |
| 23 | Ga0075365_10121732 | 3300006038 | Bacteria | 1800 |
| 24 | Ga0075363_100130795 | 3300006048 | Bacteria | 1407 |
| 25 | Ga0075364_10027048 | 3300006051 | Bacteria | 3661 |
| 26 | Ga0075364_10076653 | 3300006051 | Bacteria | 2206 |
| 27 | Ga0075364_10128972 | 3300006051 | Bacteria | 1697 |
| 28 | Ga0075364_10143671 | 3300006051 | Bacteria | 1606 |
| 29 | Ga0075364_10168267 | 3300006051 | Bacteria | 1481 |
| 30 | Ga0075364_10223205 | 3300006051 | Bacteria | 1279 |
| 31 | Ga0075364_10328250 | 3300006051 | Bacteria | 1042 |
| 32 | Ga0075367_10021822 | 3300006178 | Bacteria | 3584 |
| 33 | Ga0075367_10121733 | 3300006178 | Bacteria | 1608 |
| 34 | Ga0075369_10014400 | 3300006186 | Bacteria | 3158 |
| 35 | Ga0075370_10059678 | 3300006353 | Bacteria | 2171 |
| 36 | Ga0075428_100946748 | 3300006844 | Bacteria | 913 |
| 37 | Ga0105244_10016628 | 3300009036 | Bacteria | 4184 |
| 38 | Ga0105244_10016629 | 3300009036 | Bacteria | 4184 |
| 39 | Ga0105244_10167782 | 3300009036 | Bacteria | 1046 |
| 40 | Ga0111539_10376384 | 3300009094 | Bacteria | 1653 |
| 41 | Ga0105243_10039989 | 3300009148 | Bacteria | 3659 |
| 42 | Ga0105243_10352680 | 3300009148 | Bacteria | 1352 |
| 43 | Ga0105243_10387639 | 3300009148 | Bacteria | 1294 |
| 44 | Ga0105243_11285085 | 3300009148 | Bacteria | 748 |
| 45 | Ga0105239_11855669 | 3300010375 | Bacteria | 699 |
| 46 | Ga0157371_10024678 | 3300013102 | Bacteria | 4387 |
| 47 | Ga0157370_10123261 | 3300013104 | Bacteria | 2420 |
| 48 | Ga0157369_10341558 | 3300013105 | Bacteria | 1555 |
| 49 | Ga0171462_1003 | 3300013250 | Bacteria | 853796 |
| 50 | Ga0163162_10105762 | 3300013306 | Bacteria | 2908 |
| 51 | Ga0157372_10480056 | 3300013307 | Bacteria | 1449 |
| 52 | Ga0157375_10468855 | 3300013308 | Bacteria | 1424 |
| 53 | Ga0163163_10933004 | 3300014325 | Bacteria | 931 |
| 54 | Ga0157380_10014779 | 3300014326 | Bacteria | 5717 |
| 55 | Ga0209646_1000248 | 3300025246 | Bacteria | 54666 |
| 56 | Ga0209759_1030182 | 3300025256 | Bacteria | 1075 |
| 57 | Ga0207655_1005377 | 3300025728 | Bacteria | 8721 |
| 58 | Ga0207655_1179026 | 3300025728 | Bacteria | 649 |
| 59 | Ga0207692_10013042 | 3300025898 | Bacteria | 3593 |
| 60 | Ga0207692_10281555 | 3300025898 | Bacteria | 1006 |
| 61 | Ga0207688_10128205 | 3300025901 | Bacteria | 1486 |
| 62 | Ga0207647_10022807 | 3300025904 | Bacteria | 4152 |
| 63 | Ga0207662_10118322 | 3300025918 | Bacteria | 1659 |
| 64 | Ga0207652_10353899 | 3300025921 | Bacteria | 1325 |
| 65 | Ga0207709_10247003 | 3300025935 | Bacteria | 1301 |
| 66 | Ga0207691_10909550 | 3300025940 | Bacteria | 736 |
| 67 | Ga0207689_10158367 | 3300025942 | Bacteria | 1866 |
| 68 | Ga0207667_10610866 | 3300025949 | Bacteria | 1099 |
| 69 | Ga0207639_10336738 | 3300026041 | Bacteria | 1344 |
| 70 | Ga0207678_10242782 | 3300026067 | Bacteria | 1543 |
| 71 | Ga0207678_10532863 | 3300026067 | Bacteria | 1026 |
| 72 | Ga0207702_10766270 | 3300026078 | Bacteria | 953 |
| 73 | Ga0207675_100411690 | 3300026118 | Bacteria | 1334 |
| 74 | Ga0207683_10279938 | 3300026121 | Bacteria | 1524 |
| 75 | Ga0207683_10351856 | 3300026121 | Bacteria | 1352 |
| 76 | Ga0265327_10182760 | 3300031251 | Bacteria | 958 |
| 77 | Ga0307514_10001412 | 3300031649 | Bacteria | 29641 |
| 78 | Ga0307405_10298533 | 3300031731 | Bacteria | 1221 |
| 79 | Ga0307406_10000034 | 3300031901 | Bacteria | 83739 |
| 80 | Ga0307406_10000392 | 3300031901 | Bacteria | 25311 |
| 81 | Ga0307406_10009054 | 3300031901 | Bacteria | 5568 |
| 82 | Ga0307406_10019285 | 3300031901 | Bacteria | 4001 |
| 83 | Ga0307406_10199709 | 3300031901 | Bacteria | 1471 |
| 84 | Ga0307406_10340321 | 3300031901 | Bacteria | 1168 |
| 85 | Ga0307412_10310247 | 3300031911 | Bacteria | 1251 |
| 86 | Ga0307409_100185770 | 3300031995 | Bacteria | 1845 |
| 87 | Ga0307409_100198129 | 3300031995 | Bacteria | 1794 |
| 88 | Ga0307409_100774566 | 3300031995 | Bacteria | 965 |
| 89 | Ga0307416_100529045 | 3300032002 | Bacteria | 1249 |
| 90 | Ga0307416_101103892 | 3300032002 | Bacteria | 898 |
| 91 | Ga0307414_10086854 | 3300032004 | Bacteria | 2309 |
| 92 | Ga0307414_10107864 | 3300032004 | Bacteria | 2111 |
| 93 | Ga0307414_11228103 | 3300032004 | Bacteria | 694 |
| 94 | Ga0307414_11347054 | 3300032004 | Bacteria | 663 |
| 95 | Ga0307411_11285368 | 3300032005 | Bacteria | 666 |
| 96 | Ga0307415_100067491 | 3300032126 | Bacteria | 2500 |
| 97 | Ga0307415_100192191 | 3300032126 | Bacteria | 1612 |
| 98 | Ga0395898_0114095 | 3300037466 | Bacteria | 2589 |
| 99 | Ga0395898_0178437 | 3300037466 | Bacteria | 2030 |
| 100 | Ga0395901_0131452 | 3300038443 | Bacteria | 2630 |
| 101 | Ga0439465_0148475 | 3300041413 | Bacteria | 836 |
| 102 | Ga0451789_0303884 | 3300041443 | Bacteria | 1333 |
| 103 | Ga0451791_1499039 | 3300041451 | Bacteria | 1403 |
| 104 | Ga0451797_0026632 | 3300041453 | Bacteria | 614 |
| 105 | Ga0451841_1039008 | 3300041498 | Bacteria | 1754 |
| 106 | Ga0451841_1165843 | 3300041498 | Bacteria | 1529 |
| 107 | Ga0451847_0347010 | 3300041503 | Bacteria | 1127 |
| 108 | Ga0451853_1690663 | 3300041512 | Bacteria | 1106 |
| 109 | Ga0450920_036681 | 3300042122 | Bacteria | 973 |
| 110 | Ga0466972_0147301 | 3300044658 | Bacteria | 1107 |
| 111 | Ga0466968_0139471 | 3300044735 | Bacteria | 1108 |
| 112 | Ga0466968_0169124 | 3300044735 | Bacteria | 1012 |
| 113 | Ga0466970_0000004 | 3300044765 | Bacteria | 108620 |
| 114 | Ga0466970_0054681 | 3300044765 | Bacteria | 2132 |
| 115 | Ga0466957_0538404 | 3300044842 | Bacteria | 813 |
| 116 | Ga0466960_0780705 | 3300044901 | Bacteria | 577 |
| 117 | Ga0466967_0411923 | 3300045976 | Bacteria | 1316 |
| 118 | Ga0495627_000214 | 3300046453 | Bacteria | 62803 |
| 119 | Ga0495654_0036011 | 3300046530 | Bacteria | 2489 |
| 120 | Ga0495645_0050685 | 3300046543 | Bacteria | 3022 |
| 121 | Ga0495656_0576281 | 3300046615 | Bacteria | 601 |
| 122 | Ga0495671_0320092 | 3300046692 | Bacteria | 745 |
| 123 | Ga0496100_0852972 | 3300048903 | Bacteria | 714 |
| 124 | Ga0496101_0033704 | 3300048904 | Bacteria | 3613 |
| 125 | Ga0496102_0019244 | 3300048905 | Bacteria | 6014 |
| 126 | Ga0496102_0571387 | 3300048905 | Bacteria | 1053 |
| 127 | Ga0496103_0164750 | 3300048906 | Bacteria | 1422 |
| 128 | Ga0496104_0049226 | 3300048907 | Bacteria | 3975 |
| 129 | Ga0496105_0151989 | 3300048908 | Bacteria | 1902 |
| 130 | Ga0496105_0515669 | 3300048908 | Bacteria | 937 |
| 131 | Ga0496105_0689172 | 3300048908 | Bacteria | 785 |
| 132 | Ga0496108_0027156 | 3300048911 | Bacteria | 4724 |
| 133 | Ga0496108_1298753 | 3300048911 | Bacteria | 612 |
| 134 | Ga0496109_1769408 | 3300048912 | Bacteria | 551 |
| 135 | Ga0496110_0280273 | 3300048913 | Bacteria | 1518 |
| 136 | Ga0496111_0328116 | 3300048914 | Bacteria | 1133 |
| 137 | Ga0496112_0171615 | 3300048915 | Bacteria | 2134 |
| 138 | Ga0496113_0080582 | 3300048916 | Bacteria | 2494 |
| 139 | Ga0496113_0818438 | 3300048916 | Bacteria | 739 |
| 140 | Ga0496114_0021169 | 3300048917 | Bacteria | 5288 |
| 141 | Ga0496114_0033837 | 3300048917 | Bacteria | 4214 |
| 142 | Ga0496114_0134787 | 3300048917 | Bacteria | 2135 |
| 143 | Ga0496114_0150976 | 3300048917 | Bacteria | 2015 |
| 144 | Ga0496114_0470776 | 3300048917 | Bacteria | 1112 |
| 145 | Ga0496115_0510920 | 3300048918 | Bacteria | 964 |
| 146 | Ga0496116_0041678 | 3300048919 | Bacteria | 3147 |
| 147 | Ga0496117_0000232 | 3300048920 | Bacteria | 105479 |
| 148 | Ga0496117_0001383 | 3300048920 | Bacteria | 35268 |
| 149 | Ga0496117_0002730 | 3300048920 | Bacteria | 21670 |
| 150 | Ga0496117_0007872 | 3300048920 | Bacteria | 10249 |
| 151 | Ga0496117_0042271 | 3300048920 | Bacteria | 3327 |
| 152 | Ga0496117_0194103 | 3300048920 | Bacteria | 1153 |
| 153 | Ga0496118_0018901 | 3300048921 | Bacteria | 6182 |
| 154 | Ga0496118_0055945 | 3300048921 | Bacteria | 2971 |
| 155 | Ga0496118_0056049 | 3300048921 | Bacteria | 2966 |
| 156 | Ga0496118_0303135 | 3300048921 | Bacteria | 876 |
| 157 | Ga0496119_0001189 | 3300048922 | Bacteria | 32563 |
| 158 | Ga0496119_0004205 | 3300048922 | Bacteria | 14453 |
| 159 | Ga0496119_0005825 | 3300048922 | Bacteria | 11646 |
| 160 | Ga0496119_0010849 | 3300048922 | Bacteria | 7619 |
| 161 | Ga0496120_0001174 | 3300048923 | Bacteria | 33434 |
| 162 | Ga0496120_0001282 | 3300048923 | Bacteria | 31373 |
| 163 | Ga0496120_0004149 | 3300048923 | Bacteria | 12462 |
| 164 | Ga0496120_0004696 | 3300048923 | Bacteria | 11275 |
| 165 | Ga0496120_0068079 | 3300048923 | Bacteria | 1965 |
| 166 | Ga0496122_0000030 | 3300048925 | Bacteria | 331586 |
| 167 | Ga0496122_0002594 | 3300048925 | Bacteria | 25336 |
| 168 | Ga0496122_0002595 | 3300048925 | Bacteria | 25327 |
| 169 | Ga0496122_0004089 | 3300048925 | Bacteria | 18484 |
| 170 | Ga0496122_0012980 | 3300048925 | Bacteria | 8216 |
| 171 | Ga0496122_0014711 | 3300048925 | Bacteria | 7544 |
| 172 | Ga0496123_0000024 | 3300048926 | Bacteria | 331587 |
| 173 | Ga0496123_0000051 | 3300048926 | Bacteria | 237095 |
| 174 | Ga0496123_0001071 | 3300048926 | Bacteria | 41360 |
| 175 | Ga0496123_0002826 | 3300048926 | Bacteria | 20537 |
| 176 | Ga0496124_0007705 | 3300048927 | Bacteria | 11387 |
| 177 | Ga0496124_0034504 | 3300048927 | Bacteria | 4439 |
| 178 | Ga0496124_0043063 | 3300048927 | Bacteria | 3882 |
| 179 | Ga0496124_0122324 | 3300048927 | Bacteria | 2078 |
| 180 | Ga0496125_0000097 | 3300048928 | Bacteria | 204607 |
| 181 | Ga0496125_0002398 | 3300048928 | Bacteria | 24410 |
| 182 | Ga0496125_0004040 | 3300048928 | Bacteria | 17201 |
| 183 | Ga0496125_0024198 | 3300048928 | Bacteria | 5587 |
| 184 | Ga0496125_0031196 | 3300048928 | Bacteria | 4753 |
| 185 | Ga0496125_0051500 | 3300048928 | Bacteria | 3395 |
| 186 | Ga0496125_0221658 | 3300048928 | Bacteria | 1218 |
| 187 | Ga0496126_0002454 | 3300048929 | Bacteria | 25035 |
| 188 | Ga0496126_0008783 | 3300048929 | Bacteria | 10845 |
| 189 | Ga0496126_0067819 | 3300048929 | Bacteria | 3186 |
| 190 | Ga0496126_0199301 | 3300048929 | Bacteria | 1691 |
| 191 | Ga0501033_0274934 | 3300049570 | Bacteria | 1190 |
| 192 | Ga0501034_0000227 | 3300049571 | Bacteria | 106244 |
| 193 | Ga0501034_0064650 | 3300049571 | Bacteria | 3672 |
| 194 | Ga0501034_0657450 | 3300049571 | Bacteria | 949 |
| 195 | Ga0501038_0303993 | 3300049574 | Bacteria | 1251 |
| 196 | Ga0501039_0098897 | 3300049575 | Bacteria | 2276 |
| 197 | Ga0501039_0613959 | 3300049575 | Bacteria | 852 |
| 198 | Ga0501079_0576511 | 3300049741 | Bacteria | 885 |
| 199 | nmdc:mga03n38_177843_c1 | 3300050490 | Bacteria | 1088 |
| 200 | nmdc:mga00v17_134606_c1 | 3300050491 | Bacteria | 1581 |
| 201 | nmdc:mga00v17_224221_c1 | 3300050491 | Bacteria | 1217 |
| 202 | nmdc:mga00v17_227894_c1 | 3300050491 | Bacteria | 1207 |
| 203 | nmdc:mga00v17_37855_c1 | 3300050491 | Bacteria | 2882 |
| 204 | nmdc:mga00v17_63555_c2 | 3300050491 | Bacteria | 1685 |
| 205 | nmdc:mga00v17_73084_c1 | 3300050491 | Bacteria | 2129 |
| 206 | nmdc:mga00v17_85963_c1 | 3300050491 | Bacteria | 1970 |
| 207 | nmdc:mga0yw44_5524_c1 | 3300050492 | Bacteria | 5990 |
| 208 | nmdc:mga06z11_52975_c1 | 3300050494 | Bacteria | 2085 |
| 209 | nmdc:mga07m45_318760_c1 | 3300050496 | Bacteria | 904 |
| 210 | nmdc:mga08y16_387712_c1 | 3300050511 | Bacteria | 1431 |
| 211 | nmdc:mga0sz30_63282_c1 | 3300050516 | Bacteria | 1583 |
| 212 | Ga0500650_0016204 | 3300053098 | Bacteria | 3193 |
| 213 | Ga0500577_0001723 | 3300053142 | Bacteria | 5601 |
| 214 | Ga0500577_0015773 | 3300053142 | Bacteria | 2368 |
| 215 | Ga0500577_0308333 | 3300053142 | Bacteria | 691 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041498 | Ga0451841_1165843 | Ga0451841_1165843_657_1112 | 151 |
| 2 | 3300032126 | Ga0307415_100192191 | Ga0307415_1001921912 | 153 |
| 3 | 3300050491 | nmdc:mga00v17_63555_c2 | nmdc:mga00v17_63555_c2_592_1062 | 156 |
| 4 | iso_pu_bacteria | 2773857759 | 2774384752 | 158 |
| 5 | iso_pu_bacteria | 2977251589 | 2977253665 | 158 |
| 6 | iso_pu_bacteria | 2585427649 | 2586062753 | 159 |
| 7 | iso_pu_bacteria | 2585428094 | 2587862503 | 159 |
| 8 | iso_pu_bacteria | 2585428157 | 2588108170 | 159 |
| 9 | iso_pu_bacteria | 2643221542 | 2643733325 | 159 |
| 10 | iso_pu_bacteria | 2643221546 | 2643753547 | 159 |
| 11 | iso_pu_bacteria | 2643221553 | 2643786186 | 159 |
| 12 | iso_pu_bacteria | 2643221566 | 2643848038 | 159 |
| 13 | iso_pu_bacteria | 2643221575 | 2643885065 | 159 |
| 14 | iso_pu_bacteria | 2643221630 | 2644169899 | 159 |
| 15 | iso_pu_bacteria | 2643221635 | 2644199441 | 159 |
| 16 | iso_pu_bacteria | 2643221724 | 2644680579 | 159 |
| 17 | iso_pu_bacteria | 2728369380 | 2730230039 | 159 |
| 18 | iso_pu_bacteria | 2747842429 | 2747952762 | 159 |
| 19 | iso_pu_bacteria | 2757320536 | 2758227212 | 159 |
| 20 | iso_pu_bacteria | 2773857758 | 2774381615 | 159 |
| 21 | iso_pu_bacteria | 2773857763 | 2774399864 | 159 |
| 22 | iso_pu_bacteria | 2808606306 | 2808631478 | 159 |
| 23 | iso_pu_bacteria | 2808606368 | 2808885364 | 159 |
| 24 | iso_pu_bacteria | 2808606447 | 2809227116 | 159 |
| 25 | iso_pu_bacteria | 2811994872 | 2812322797 | 159 |
| 26 | iso_pu_bacteria | 2821268502 | 2821269673 | 159 |
| 27 | iso_pu_bacteria | 2833709550 | 2833710620 | 159 |
| 28 | iso_pu_bacteria | 2852632344 | 2852633503 | 159 |
| 29 | iso_pu_bacteria | 2852646457 | 2852648740 | 159 |
| 30 | iso_pu_bacteria | 2852663356 | 2852666887 | 159 |
| 31 | iso_pu_bacteria | 2857720070 | 2857720523 | 159 |
| 32 | iso_pu_bacteria | 2857723135 | 2857724244 | 159 |
| 33 | iso_pu_bacteria | 2870622029 | 2870623302 | 159 |
| 34 | iso_pu_bacteria | 2870628048 | 2870630039 | 159 |
| 35 | iso_pu_bacteria | 2895660088 | 2895661100 | 159 |
| 36 | iso_pu_bacteria | 2904509784 | 2904512729 | 159 |
| 37 | iso_pu_bacteria | 2908678064 | 2908681273 | 159 |
| 38 | iso_pu_bacteria | 2919069694 | 2919071437 | 159 |
| 39 | iso_pu_bacteria | 2919443155 | 2919445893 | 159 |
| 40 | iso_pu_bacteria | 2928090899 | 2928092393 | 159 |
| 41 | iso_pu_bacteria | 2939657138 | 2939657736 | 159 |
| 42 | iso_pu_bacteria | 2939660829 | 2939660917 | 159 |
| 43 | iso_pu_bacteria | 2945968032 | 2945968166 | 159 |
| 44 | iso_pu_bacteria | 2946033335 | 2946033420 | 159 |
| 45 | iso_pu_bacteria | 2946041624 | 2946044665 | 159 |
| 46 | iso_pu_bacteria | 2946080515 | 2946080565 | 159 |
| 47 | iso_pu_bacteria | 2966924647 | 2966924692 | 159 |
| 48 | iso_pu_bacteria | 2974294766 | 2974297749 | 159 |
| 49 | iso_pu_bacteria | 2974324384 | 2974326017 | 159 |
| 50 | iso_pu_bacteria | 2977228692 | 2977230979 | 159 |
| 51 | iso_pu_bacteria | 2977236895 | 2977239775 | 159 |
| 52 | iso_pu_bacteria | 2977264416 | 2977266216 | 159 |
| 53 | iso_pu_bacteria | 2984542743 | 2984545952 | 159 |
| 54 | iso_pu_bacteria | 2984580707 | 2984580841 | 159 |
| 55 | iso_pu_bacteria | 2995726249 | 2995728263 | 159 |
| 56 | iso_pu_bacteria | 8002811521 | 8002812873 | 159 |
| 57 | iso_pu_bacteria | 8004182704 | 8004184811 | 159 |
| 58 | iso_pu_bacteria | 8004212874 | 8004214418 | 159 |
| 59 | iso_pu_bacteria | 8016254467 | 8016257925 | 159 |
| 60 | iso_pu_bacteria | 8045830549 | 8045830847 | 159 |
| 61 | iso_pu_bacteria | 8055034563 | 8055035719 | 159 |
| 62 | iso_pu_bacteria | 8055037949 | 8055038725 | 159 |
| 63 | 3300005614 | Ga0068856_100954821 | Ga0068856_1009548212 | 162 |
| 64 | 3300010375 | Ga0105239_11855669 | Ga0105239_118556691 | 162 |
| 65 | 3300013102 | Ga0157371_10024678 | Ga0157371_100246783 | 162 |
| 66 | 3300013105 | Ga0157369_10341558 | Ga0157369_103415582 | 162 |
| 67 | 3300013306 | Ga0163162_10105762 | Ga0163162_101057622 | 162 |
| 68 | 3300048903 | Ga0496100_0852972 | Ga0496100_0852972_34_522 | 162 |
| 69 | 3300048904 | Ga0496101_0033704 | Ga0496101_0033704_1509_1997 | 162 |
| 70 | 3300048905 | Ga0496102_0019244 | Ga0496102_0019244_2402_2890 | 162 |
| 71 | 3300048906 | Ga0496103_0164750 | Ga0496103_0164750_718_1206 | 162 |
| 72 | 3300048908 | Ga0496105_0151989 | Ga0496105_0151989_1110_1598 | 162 |
| 73 | 3300048911 | Ga0496108_1298753 | Ga0496108_1298753_36_524 | 162 |
| 74 | 3300048914 | Ga0496111_0328116 | Ga0496111_0328116_188_676 | 162 |
| 75 | 3300048915 | Ga0496112_0171615 | Ga0496112_0171615_927_1415 | 162 |
| 76 | 3300048917 | Ga0496114_0150976 | Ga0496114_0150976_77_565 | 162 |
| 77 | 3300048917 | Ga0496114_0470776 | Ga0496114_0470776_460_948 | 162 |
| 78 | 3300048918 | Ga0496115_0510920 | Ga0496115_0510920_242_730 | 162 |
| 79 | 3300048921 | Ga0496118_0303135 | Ga0496118_0303135_280_768 | 162 |
| 80 | 3300048923 | Ga0496120_0068079 | Ga0496120_0068079_1408_1896 | 162 |
| 81 | 3300001979 | JGI24740J21852_10034079 | JGI24740J21852_100340792 | 163 |
| 82 | 3300005334 | Ga0068869_100362382 | Ga0068869_1003623822 | 163 |
| 83 | 3300005338 | Ga0068868_100358043 | Ga0068868_1003580432 | 163 |
| 84 | 3300005339 | Ga0070660_100784209 | Ga0070660_1007842092 | 163 |
| 85 | 3300005347 | Ga0070668_100069216 | Ga0070668_1000692162 | 163 |
| 86 | 3300005354 | Ga0070675_100398716 | Ga0070675_1003987162 | 163 |
| 87 | 3300005455 | Ga0070663_100594314 | Ga0070663_1005943142 | 163 |
| 88 | 3300005456 | Ga0070678_100210380 | Ga0070678_1002103802 | 163 |
| 89 | 3300005456 | Ga0070678_100319672 | Ga0070678_1003196722 | 163 |
| 90 | 3300005456 | Ga0070678_100752016 | Ga0070678_1007520162 | 163 |
| 91 | 3300005530 | Ga0070679_100755787 | Ga0070679_1007557872 | 163 |
| 92 | 3300005539 | Ga0068853_100281873 | Ga0068853_1002818732 | 163 |
| 93 | 3300005543 | Ga0070672_101038973 | Ga0070672_1010389732 | 163 |
| 94 | 3300005546 | Ga0070696_100686631 | Ga0070696_1006866311 | 163 |
| 95 | 3300005548 | Ga0070665_100072188 | Ga0070665_1000721883 | 163 |
| 96 | 3300005563 | Ga0068855_101472172 | Ga0068855_1014721722 | 163 |
| 97 | 3300005614 | Ga0068856_100873702 | Ga0068856_1008737022 | 163 |
| 98 | 3300005719 | Ga0068861_100037062 | Ga0068861_1000370621 | 163 |
| 99 | 3300005840 | Ga0068870_10005248 | Ga0068870_100052483 | 163 |
| 100 | 3300005844 | Ga0068862_100374698 | Ga0068862_1003746982 | 163 |
| 101 | 3300006038 | Ga0075365_10092204 | Ga0075365_100922042 | 163 |
| 102 | 3300006038 | Ga0075365_10121732 | Ga0075365_101217322 | 163 |
| 103 | 3300006048 | Ga0075363_100130795 | Ga0075363_1001307952 | 163 |
| 104 | 3300006051 | Ga0075364_10027048 | Ga0075364_100270482 | 163 |
| 105 | 3300006051 | Ga0075364_10076653 | Ga0075364_100766532 | 163 |
| 106 | 3300006051 | Ga0075364_10128972 | Ga0075364_101289722 | 163 |
| 107 | 3300006051 | Ga0075364_10143671 | Ga0075364_101436712 | 163 |
| 108 | 3300006051 | Ga0075364_10168267 | Ga0075364_101682672 | 163 |
| 109 | 3300006051 | Ga0075364_10223205 | Ga0075364_102232052 | 163 |
| 110 | 3300006051 | Ga0075364_10328250 | Ga0075364_103282502 | 163 |
| 111 | 3300006178 | Ga0075367_10021822 | Ga0075367_100218222 | 163 |
| 112 | 3300006178 | Ga0075367_10121733 | Ga0075367_101217331 | 163 |
| 113 | 3300006186 | Ga0075369_10014400 | Ga0075369_100144003 | 163 |
| 114 | 3300006353 | Ga0075370_10059678 | Ga0075370_100596782 | 163 |
| 115 | 3300006844 | Ga0075428_100946748 | Ga0075428_1009467481 | 163 |
| 116 | 3300009036 | Ga0105244_10016628 | Ga0105244_100166282 | 163 |
| 117 | 3300009036 | Ga0105244_10016629 | Ga0105244_100166292 | 163 |
| 118 | 3300009036 | Ga0105244_10167782 | Ga0105244_101677821 | 163 |
| 119 | 3300009094 | Ga0111539_10376384 | Ga0111539_103763842 | 163 |
| 120 | 3300009148 | Ga0105243_10039989 | Ga0105243_100399893 | 163 |
| 121 | 3300009148 | Ga0105243_10352680 | Ga0105243_103526802 | 163 |
| 122 | 3300009148 | Ga0105243_10387639 | Ga0105243_103876392 | 163 |
| 123 | 3300009148 | Ga0105243_11285085 | Ga0105243_112850852 | 163 |
| 124 | 3300013104 | Ga0157370_10123261 | Ga0157370_101232612 | 163 |
| 125 | 3300013250 | Ga0171462_1003 | Ga0171462_1003732 | 163 |
| 126 | 3300013307 | Ga0157372_10480056 | Ga0157372_104800562 | 163 |
| 127 | 3300013308 | Ga0157375_10468855 | Ga0157375_104688552 | 163 |
| 128 | 3300014325 | Ga0163163_10933004 | Ga0163163_109330042 | 163 |
| 129 | 3300014326 | Ga0157380_10014779 | Ga0157380_100147792 | 163 |
| 130 | 3300025246 | Ga0209646_1000248 | Ga0209646_100024823 | 163 |
| 131 | 3300025256 | Ga0209759_1030182 | Ga0209759_10301821 | 163 |
| 132 | 3300025728 | Ga0207655_1005377 | Ga0207655_10053777 | 163 |
| 133 | 3300025728 | Ga0207655_1179026 | Ga0207655_11790261 | 163 |
| 134 | 3300025898 | Ga0207692_10013042 | Ga0207692_100130423 | 163 |
| 135 | 3300025898 | Ga0207692_10281555 | Ga0207692_102815552 | 163 |
| 136 | 3300025901 | Ga0207688_10128205 | Ga0207688_101282052 | 163 |
| 137 | 3300025904 | Ga0207647_10022807 | Ga0207647_100228072 | 163 |
| 138 | 3300025918 | Ga0207662_10118322 | Ga0207662_101183222 | 163 |
| 139 | 3300025921 | Ga0207652_10353899 | Ga0207652_103538992 | 163 |
| 140 | 3300025935 | Ga0207709_10247003 | Ga0207709_102470032 | 163 |
| 141 | 3300025940 | Ga0207691_10909550 | Ga0207691_109095502 | 163 |
| 142 | 3300025942 | Ga0207689_10158367 | Ga0207689_101583672 | 163 |
| 143 | 3300025949 | Ga0207667_10610866 | Ga0207667_106108662 | 163 |
| 144 | 3300026041 | Ga0207639_10336738 | Ga0207639_103367382 | 163 |
| 145 | 3300026067 | Ga0207678_10242782 | Ga0207678_102427822 | 163 |
| 146 | 3300026067 | Ga0207678_10532863 | Ga0207678_105328632 | 163 |
| 147 | 3300026078 | Ga0207702_10766270 | Ga0207702_107662702 | 163 |
| 148 | 3300026118 | Ga0207675_100411690 | Ga0207675_1004116902 | 163 |
| 149 | 3300026121 | Ga0207683_10279938 | Ga0207683_102799382 | 163 |
| 150 | 3300026121 | Ga0207683_10351856 | Ga0207683_103518562 | 163 |
| 151 | 3300031251 | Ga0265327_10182760 | Ga0265327_101827602 | 163 |
| 152 | 3300031649 | Ga0307514_10001412 | Ga0307514_100014122 | 163 |
| 153 | 3300031731 | Ga0307405_10298533 | Ga0307405_102985332 | 163 |
| 154 | 3300031901 | Ga0307406_10000034 | Ga0307406_1000003441 | 163 |
| 155 | 3300031901 | Ga0307406_10000392 | Ga0307406_100003925 | 163 |
| 156 | 3300031901 | Ga0307406_10009054 | Ga0307406_100090543 | 163 |
| 157 | 3300031901 | Ga0307406_10019285 | Ga0307406_100192853 | 163 |
| 158 | 3300031901 | Ga0307406_10199709 | Ga0307406_101997092 | 163 |
| 159 | 3300031901 | Ga0307406_10340321 | Ga0307406_103403212 | 163 |
| 160 | 3300031911 | Ga0307412_10310247 | Ga0307412_103102472 | 163 |
| 161 | 3300031995 | Ga0307409_100185770 | Ga0307409_1001857702 | 163 |
| 162 | 3300031995 | Ga0307409_100198129 | Ga0307409_1001981292 | 163 |
| 163 | 3300031995 | Ga0307409_100774566 | Ga0307409_1007745662 | 163 |
| 164 | 3300032002 | Ga0307416_100529045 | Ga0307416_1005290452 | 163 |
| 165 | 3300032002 | Ga0307416_101103892 | Ga0307416_1011038922 | 163 |
| 166 | 3300032004 | Ga0307414_10086854 | Ga0307414_100868542 | 163 |
| 167 | 3300032004 | Ga0307414_10107864 | Ga0307414_101078642 | 163 |
| 168 | 3300032004 | Ga0307414_11228103 | Ga0307414_112281032 | 163 |
| 169 | 3300032004 | Ga0307414_11347054 | Ga0307414_113470542 | 163 |
| 170 | 3300032005 | Ga0307411_11285368 | Ga0307411_112853682 | 163 |
| 171 | 3300032126 | Ga0307415_100067491 | Ga0307415_1000674912 | 163 |
| 172 | 3300037466 | Ga0395898_0114095 | Ga0395898_0114095_1793_2284 | 163 |
| 173 | 3300037466 | Ga0395898_0178437 | Ga0395898_0178437_584_1075 | 163 |
| 174 | 3300038443 | Ga0395901_0131452 | Ga0395901_0131452_84_575 | 163 |
| 175 | 3300041413 | Ga0439465_0148475 | Ga0439465_0148475_204_710 | 163 |
| 176 | 3300041443 | Ga0451789_0303884 | Ga0451789_0303884_307_798 | 163 |
| 177 | 3300041451 | Ga0451791_1499039 | Ga0451791_1499039_517_1011 | 163 |
| 178 | 3300041453 | Ga0451797_0026632 | Ga0451797_0026632_90_581 | 163 |
| 179 | 3300041498 | Ga0451841_1039008 | Ga0451841_1039008_185_676 | 163 |
| 180 | 3300041503 | Ga0451847_0347010 | Ga0451847_0347010_133_651 | 163 |
| 181 | 3300041512 | Ga0451853_1690663 | Ga0451853_1690663_172_663 | 163 |
| 182 | 3300042122 | Ga0450920_036681 | Ga0450920_036681_27_518 | 163 |
| 183 | 3300044658 | Ga0466972_0147301 | Ga0466972_0147301_595_1086 | 163 |
| 184 | 3300044735 | Ga0466968_0139471 | Ga0466968_0139471_337_831 | 163 |
| 185 | 3300044735 | Ga0466968_0169124 | Ga0466968_0169124_376_867 | 163 |
| 186 | 3300044765 | Ga0466970_0000004 | Ga0466970_0000004_35946_36437 | 163 |
| 187 | 3300044765 | Ga0466970_0054681 | Ga0466970_0054681_1229_1720 | 163 |
| 188 | 3300044842 | Ga0466957_0538404 | Ga0466957_0538404_23_574 | 163 |
| 189 | 3300044901 | Ga0466960_0780705 | Ga0466960_0780705_59_550 | 163 |
| 190 | 3300045976 | Ga0466967_0411923 | Ga0466967_0411923_700_1191 | 163 |
| 191 | 3300046453 | Ga0495627_000214 | Ga0495627_000214_2827_3318 | 163 |
| 192 | 3300046530 | Ga0495654_0036011 | Ga0495654_0036011_1095_1586 | 163 |
| 193 | 3300046543 | Ga0495645_0050685 | Ga0495645_0050685_343_834 | 163 |
| 194 | 3300046615 | Ga0495656_0576281 | Ga0495656_0576281_19_510 | 163 |
| 195 | 3300046692 | Ga0495671_0320092 | Ga0495671_0320092_64_555 | 163 |
| 196 | 3300048905 | Ga0496102_0571387 | Ga0496102_0571387_10_501 | 163 |
| 197 | 3300048907 | Ga0496104_0049226 | Ga0496104_0049226_1049_1540 | 163 |
| 198 | 3300048908 | Ga0496105_0515669 | Ga0496105_0515669_399_890 | 163 |
| 199 | 3300048908 | Ga0496105_0689172 | Ga0496105_0689172_16_507 | 163 |
| 200 | 3300048911 | Ga0496108_0027156 | Ga0496108_0027156_4055_4546 | 163 |
| 201 | 3300048912 | Ga0496109_1769408 | Ga0496109_1769408_49_540 | 163 |
| 202 | 3300048913 | Ga0496110_0280273 | Ga0496110_0280273_870_1361 | 163 |
| 203 | 3300048916 | Ga0496113_0080582 | Ga0496113_0080582_393_884 | 163 |
| 204 | 3300048916 | Ga0496113_0818438 | Ga0496113_0818438_222_713 | 163 |
| 205 | 3300048917 | Ga0496114_0021169 | Ga0496114_0021169_1948_2439 | 163 |
| 206 | 3300048917 | Ga0496114_0033837 | Ga0496114_0033837_3488_3979 | 163 |
| 207 | 3300048917 | Ga0496114_0134787 | Ga0496114_0134787_1403_1894 | 163 |
| 208 | 3300048919 | Ga0496116_0041678 | Ga0496116_0041678_845_1336 | 163 |
| 209 | 3300048920 | Ga0496117_0000232 | Ga0496117_0000232_13330_13821 | 163 |
| 210 | 3300048920 | Ga0496117_0001383 | Ga0496117_0001383_5557_6048 | 163 |
| 211 | 3300048920 | Ga0496117_0002730 | Ga0496117_0002730_5234_5725 | 163 |
| 212 | 3300048920 | Ga0496117_0007872 | Ga0496117_0007872_9612_10103 | 163 |
| 213 | 3300048920 | Ga0496117_0042271 | Ga0496117_0042271_2798_3289 | 163 |
| 214 | 3300048920 | Ga0496117_0194103 | Ga0496117_0194103_605_1096 | 163 |
| 215 | 3300048921 | Ga0496118_0018901 | Ga0496118_0018901_1607_2098 | 163 |
| 216 | 3300048921 | Ga0496118_0055945 | Ga0496118_0055945_1778_2269 | 163 |
| 217 | 3300048921 | Ga0496118_0056049 | Ga0496118_0056049_15_506 | 163 |
| 218 | 3300048922 | Ga0496119_0001189 | Ga0496119_0001189_626_1117 | 163 |
| 219 | 3300048922 | Ga0496119_0004205 | Ga0496119_0004205_9486_9977 | 163 |
| 220 | 3300048922 | Ga0496119_0005825 | Ga0496119_0005825_8217_8708 | 163 |
| 221 | 3300048922 | Ga0496119_0010849 | Ga0496119_0010849_970_1461 | 163 |
| 222 | 3300048923 | Ga0496120_0001174 | Ga0496120_0001174_9288_9779 | 163 |
| 223 | 3300048923 | Ga0496120_0001282 | Ga0496120_0001282_3523_4014 | 163 |
| 224 | 3300048923 | Ga0496120_0004149 | Ga0496120_0004149_9320_9811 | 163 |
| 225 | 3300048923 | Ga0496120_0004696 | Ga0496120_0004696_6820_7311 | 163 |
| 226 | 3300048925 | Ga0496122_0000030 | Ga0496122_0000030_195505_195996 | 163 |
| 227 | 3300048925 | Ga0496122_0002594 | Ga0496122_0002594_24529_25020 | 163 |
| 228 | 3300048925 | Ga0496122_0002595 | Ga0496122_0002595_4415_4906 | 163 |
| 229 | 3300048925 | Ga0496122_0004089 | Ga0496122_0004089_5256_5747 | 163 |
| 230 | 3300048925 | Ga0496122_0012980 | Ga0496122_0012980_6839_7330 | 163 |
| 231 | 3300048925 | Ga0496122_0014711 | Ga0496122_0014711_424_915 | 163 |
| 232 | 3300048926 | Ga0496123_0000024 | Ga0496123_0000024_195506_195997 | 163 |
| 233 | 3300048926 | Ga0496123_0000051 | Ga0496123_0000051_5023_5514 | 163 |
| 234 | 3300048926 | Ga0496123_0001071 | Ga0496123_0001071_26950_27441 | 163 |
| 235 | 3300048926 | Ga0496123_0002826 | Ga0496123_0002826_17551_18042 | 163 |
| 236 | 3300048927 | Ga0496124_0007705 | Ga0496124_0007705_5138_5629 | 163 |
| 237 | 3300048927 | Ga0496124_0034504 | Ga0496124_0034504_1119_1610 | 163 |
| 238 | 3300048927 | Ga0496124_0043063 | Ga0496124_0043063_2202_2693 | 163 |
| 239 | 3300048927 | Ga0496124_0122324 | Ga0496124_0122324_45_536 | 163 |
| 240 | 3300048928 | Ga0496125_0000097 | Ga0496125_0000097_84509_85000 | 163 |
| 241 | 3300048928 | Ga0496125_0002398 | Ga0496125_0002398_20395_20886 | 163 |
| 242 | 3300048928 | Ga0496125_0004040 | Ga0496125_0004040_15356_15847 | 163 |
| 243 | 3300048928 | Ga0496125_0024198 | Ga0496125_0024198_4102_4593 | 163 |
| 244 | 3300048928 | Ga0496125_0031196 | Ga0496125_0031196_385_876 | 163 |
| 245 | 3300048928 | Ga0496125_0051500 | Ga0496125_0051500_1698_2189 | 163 |
| 246 | 3300048928 | Ga0496125_0221658 | Ga0496125_0221658_82_573 | 163 |
| 247 | 3300048929 | Ga0496126_0002454 | Ga0496126_0002454_4738_5229 | 163 |
| 248 | 3300048929 | Ga0496126_0008783 | Ga0496126_0008783_1243_1734 | 163 |
| 249 | 3300048929 | Ga0496126_0067819 | Ga0496126_0067819_64_555 | 163 |
| 250 | 3300048929 | Ga0496126_0199301 | Ga0496126_0199301_14_505 | 163 |
| 251 | 3300049570 | Ga0501033_0274934 | Ga0501033_0274934_543_1034 | 163 |
| 252 | 3300049571 | Ga0501034_0000227 | Ga0501034_0000227_17305_17796 | 163 |
| 253 | 3300049571 | Ga0501034_0064650 | Ga0501034_0064650_541_1032 | 163 |
| 254 | 3300049571 | Ga0501034_0657450 | Ga0501034_0657450_291_782 | 163 |
| 255 | 3300049574 | Ga0501038_0303993 | Ga0501038_0303993_328_819 | 163 |
| 256 | 3300049575 | Ga0501039_0098897 | Ga0501039_0098897_989_1480 | 163 |
| 257 | 3300049575 | Ga0501039_0613959 | Ga0501039_0613959_240_731 | 163 |
| 258 | 3300049741 | Ga0501079_0576511 | Ga0501079_0576511_81_572 | 163 |
| 259 | 3300050490 | nmdc:mga03n38_177843_c1 | nmdc:mga03n38_177843_c1_232_723 | 163 |
| 260 | 3300050491 | nmdc:mga00v17_134606_c1 | nmdc:mga00v17_134606_c1_133_624 | 163 |
| 261 | 3300050491 | nmdc:mga00v17_224221_c1 | nmdc:mga00v17_224221_c1_315_806 | 163 |
| 262 | 3300050491 | nmdc:mga00v17_227894_c1 | nmdc:mga00v17_227894_c1_41_532 | 163 |
| 263 | 3300050491 | nmdc:mga00v17_37855_c1 | nmdc:mga00v17_37855_c1_63_554 | 163 |
| 264 | 3300050491 | nmdc:mga00v17_73084_c1 | nmdc:mga00v17_73084_c1_562_1053 | 163 |
| 265 | 3300050491 | nmdc:mga00v17_85963_c1 | nmdc:mga00v17_85963_c1_759_1250 | 163 |
| 266 | 3300050492 | nmdc:mga0yw44_5524_c1 | nmdc:mga0yw44_5524_c1_2629_3120 | 163 |
| 267 | 3300050494 | nmdc:mga06z11_52975_c1 | nmdc:mga06z11_52975_c1_466_957 | 163 |
| 268 | 3300050496 | nmdc:mga07m45_318760_c1 | nmdc:mga07m45_318760_c1_132_623 | 163 |
| 269 | 3300050511 | nmdc:mga08y16_387712_c1 | nmdc:mga08y16_387712_c1_373_864 | 163 |
| 270 | 3300050516 | nmdc:mga0sz30_63282_c1 | nmdc:mga0sz30_63282_c1_643_1134 | 163 |
| 271 | 3300053098 | Ga0500650_0016204 | Ga0500650_0016204_2674_3168 | 163 |
| 272 | 3300053142 | Ga0500577_0001723 | Ga0500577_0001723_1917_2411 | 163 |
| 273 | 3300053142 | Ga0500577_0015773 | Ga0500577_0015773_1519_2013 | 163 |
| 274 | 3300053142 | Ga0500577_0308333 | Ga0500577_0308333_186_680 | 163 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3pn3-assembly1.cif.gz_A | crystal structure of arabidopsis thaliana petide deformylase 1b (atpdf1b) in complex with inhibitor 21 | 0.9401 | 5 | 159 |
| 3pn5-assembly1.cif.gz_A | crystal structure of arabidopsis thaliana petide deformylase 1b (atpdf1b) g41q mutant | 0.9357 | 5 | 159 |
| 6jf4-assembly1.cif.gz_A | k1u bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii | 0.9335 | 1 | 144 |
| 5mte-assembly2.cif.gz_B | crystal structure of pdf from the vibrio parahaemolyticus bacteriophage vp16t in complex with actinonin - crystal form ii | 0.9317 | 5 | 140 |
| 6jf4-assembly1.cif.gz_B | k1u bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii | 0.9316 | 1 | 145 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5mtdB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9307 | 5 | 140 | 3.90.45.10 |
| 1lmeB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9303 | 1 | 147 | 3.90.45.10 |
| 1ws1A00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.93 | 1 | 145 | 3.90.45.10 |
| 3e3uA00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9285 | 2 | 159 | 3.90.45.10 |
| 1lmeB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9243 | 1 | 147 | 3.90.45.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1R4HLG4-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9965 | 25 | 163 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A840DQ41-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9934 | 1 | 163 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A2S5UX42-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9913 | 1 | 163 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A373DT04-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9912 | 1 | 163 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A6J7CII7-F1-model_v4 | peptide deformylase (EC 3.5.1.88) | 0.9911 | 1 | 163 |
GO:0042586
GO:0043686 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar