F379943

General Info

Members Datasets Scaffolds Average Seq Length
274 145 548 408

Family's Representative Sequence

Representative Sequence 3300046475|Ga0495639_0015409|Ga0495639_0015409_1941_3278
Length 445
Sequence VDLNGVFKWVKYPGASNDGEWIAICRGDSTFGGSDELMRILVLNSGSSSQKACLYEIGETLPEHPPACIWEGKVDFNGDTAAVVVKHSPGVVQKEQITFSSREQVVRHLLGTLVEVPGLSNSLKIDVVGHRIVHGGPHFEDPVVVTAEVRAAIASVSELAPLHLRAELESMKLVDSIFGAVPQVAVFDTGFHRQMPLAAAVYPGPYSWFESGIHRYGFHGINHQYCAKRAAQLLGKDPSSLKLISCHLGNGCSLAAISGGRSVDTTMGFTPLDGLMMGTRSGSVDPGILIFLMRQSHLDAQQLDHMLNHESGLLGVSGISSDLRDILAAIQNGSERAKLAFDVFVHRLQTAIGGMAAVLGGMDALVFTAGMGENSPDLRAAACSTLGFLDLKIDSELNARPSGDTDIASADSRVRVLVIRAEEDWSIATECWKLTQKTQETIIQR

Samples

Sample ID Description Type Environment
1 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
119 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
120 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.46
Rhizosphere 96.72
Stem 0
Stem Tuber 0
Unclassified 4.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495639_0015409 3300046475 Bacteria 3316
2 Ga0065707_10118362 3300005295 Bacteria 2187
3 Ga0070683_100014651 3300005329 Bacteria 6867
4 Ga0070670_100001641 3300005331 Bacteria 18107
5 Ga0070680_100001210 3300005336 Bacteria 18578
6 Ga0070680_100056749 3300005336 Bacteria 3201
7 Ga0068868_100002868 3300005338 Bacteria 11958
8 Ga0068868_100026703 3300005338 Bacteria 4402
9 Ga0068868_100040758 3300005338 Bacteria 3615
10 Ga0070689_100072211 3300005340 Bacteria 2697
11 Ga0070673_100032561 3300005364 Bacteria 3927
12 Ga0070703_10005902 3300005406 Bacteria 3430
13 Ga0070714_100002836 3300005435 Bacteria 12794
14 Ga0070714_100077346 3300005435 Bacteria 2890
15 Ga0070713_100004168 3300005436 Bacteria 9645
16 Ga0070713_100009308 3300005436 Bacteria 7022
17 Ga0070713_100023473 3300005436 Bacteria 4787
18 Ga0070713_100069665 3300005436 Bacteria 2967
19 Ga0070711_100286966 3300005439 Bacteria 1304
20 Ga0070705_100060320 3300005440 Unclassified 2249
21 Ga0070705_100066358 3300005440 Bacteria 2163
22 Ga0070694_100018403 3300005444 Bacteria 4433
23 Ga0070708_100005972 3300005445 Bacteria 9678
24 Ga0070708_100015278 3300005445 Bacteria 6335
25 Ga0070708_100058358 3300005445 Bacteria 3438
26 Ga0070681_10000851 3300005458 Bacteria 25637
27 Ga0070681_10008275 3300005458 Bacteria 10182
28 Ga0070681_10021631 3300005458 Bacteria 6449
29 Ga0070706_100002531 3300005467 Bacteria 18381
30 Ga0070706_100003206 3300005467 Bacteria 16149
31 Ga0070706_100126309 3300005467 Unclassified 2385
32 Ga0070706_100239721 3300005467 Bacteria 1693
33 Ga0070707_100000682 3300005468 Bacteria 33609
34 Ga0070707_100001865 3300005468 Bacteria 20262
35 Ga0070707_100025640 3300005468 Bacteria 5596
36 Ga0070707_100205665 3300005468 Unclassified 1919
37 Ga0070707_100209175 3300005468 Bacteria 1901
38 Ga0070698_100046269 3300005471 Bacteria 4449
39 Ga0070698_100051762 3300005471 Bacteria 4181
40 Ga0070698_100060457 3300005471 Bacteria 3824
41 Ga0070699_100001080 3300005518 Bacteria 25375
42 Ga0070699_100023221 3300005518 Bacteria 5343
43 Ga0070699_100031276 3300005518 Bacteria 4594
44 Ga0070699_100165454 3300005518 Bacteria 1959
45 Ga0070679_100000028 3300005530 Bacteria 113940
46 Ga0070679_100002531 3300005530 Bacteria 16572
47 Ga0070679_100076281 3300005530 Bacteria 3342
48 Ga0070684_100072977 3300005535 Bacteria 3023
49 Ga0070684_100089037 3300005535 Bacteria 2743
50 Ga0070697_100000268 3300005536 Bacteria 42446
51 Ga0070697_100001056 3300005536 Bacteria 20813
52 Ga0070697_100009779 3300005536 Bacteria 7481
53 Ga0070697_100010001 3300005536 Bacteria 7401
54 Ga0070697_100012210 3300005536 Bacteria 6726
55 Ga0070697_100033126 3300005536 Bacteria 4161
56 Ga0070697_100075023 3300005536 Unclassified 2779
57 Ga0070697_100085107 3300005536 Bacteria 2609
58 Ga0070697_100152648 3300005536 Bacteria 1947
59 Ga0068853_100029104 3300005539 Bacteria 4653
60 Ga0068853_100061657 3300005539 Bacteria 3244
61 Ga0070695_100067215 3300005545 Bacteria 2337
62 Ga0070695_100107331 3300005545 Bacteria 1889
63 Ga0070693_100092598 3300005547 Bacteria 1825
64 Ga0068855_100004334 3300005563 Bacteria 17348
65 Ga0068855_100013796 3300005563 Bacteria 9740
66 Ga0068855_100025824 3300005563 Bacteria 7024
67 Ga0070664_100051748 3300005564 Bacteria 3477
68 Ga0070664_100107994 3300005564 Bacteria 2426
69 Ga0068857_100000411 3300005577 Bacteria 30229
70 Ga0068857_100022633 3300005577 Bacteria 5528
71 Ga0068854_100014063 3300005578 Bacteria 5269
72 Ga0068856_100002442 3300005614 Bacteria 19116
73 Ga0068856_100012213 3300005614 Bacteria 8321
74 Ga0068856_100028716 3300005614 Bacteria 5434
75 Ga0068856_100319476 3300005614 Bacteria 1570
76 Ga0068859_100022911 3300005617 Bacteria 6262
77 Ga0068859_100026284 3300005617 Bacteria 5836
78 Ga0068864_100008130 3300005618 Bacteria 8650
79 Ga0068864_100016831 3300005618 Bacteria 6093
80 Ga0068864_100122883 3300005618 Bacteria 2323
81 Ga0068866_10056937 3300005718 Bacteria 2012
82 Ga0068863_100128478 3300005841 Bacteria 2418
83 Ga0068863_100211559 3300005841 Bacteria 1867
84 Ga0068858_100061733 3300005842 Bacteria 3465
85 Ga0068860_100094056 3300005843 Bacteria 2857
86 Ga0070717_10009372 3300006028 Bacteria 7352
87 Ga0070717_10009873 3300006028 Bacteria 7188
88 Ga0070717_10117372 3300006028 Bacteria 2276
89 Ga0070716_100008386 3300006173 Bacteria 5128
90 Ga0070712_100012390 3300006175 Bacteria 5419
91 Ga0097621_100000310 3300006237 Bacteria 32966
92 Ga0097621_100000410 3300006237 Bacteria 29942
93 Ga0068871_100001885 3300006358 Bacteria 14189
94 Ga0068871_100004803 3300006358 Bacteria 9450
95 Ga0068871_100064387 3300006358 Bacteria 3002
96 Ga0075433_10128108 3300006852 Bacteria 2254
97 Ga0075434_100000048 3300006871 Bacteria 57433
98 Ga0075434_100000235 3300006871 Bacteria 38289
99 Ga0075434_100002111 3300006871 Bacteria 17303
100 Ga0075434_100008870 3300006871 Bacteria 9362
101 Ga0075434_100160040 3300006871 Bacteria 2271
102 Ga0068865_100008172 3300006881 Bacteria 6458
103 Ga0075436_100011158 3300006914 Bacteria 6160
104 Ga0075436_100052751 3300006914 Bacteria 2807
105 Ga0097620_100022911 3300006931 Bacteria 6262
106 Ga0097620_100026284 3300006931 Bacteria 5836
107 Ga0075435_100000099 3300007076 Bacteria 46122
108 Ga0075435_100000913 3300007076 Bacteria 18604
109 Ga0075435_100118518 3300007076 Bacteria 2207
110 Ga0105240_10011923 3300009093 Bacteria 12054
111 Ga0105240_10037218 3300009093 Bacteria 6254
112 Ga0105240_10038543 3300009093 Bacteria 6130
113 Ga0105245_10414019 3300009098 Bacteria 1349
114 Ga0114129_10082465 3300009147 Bacteria 4468
115 Ga0114129_10110886 3300009147 Bacteria 3787
116 Ga0114129_10295442 3300009147 Bacteria 2161
117 Ga0105241_10008291 3300009174 Bacteria 7649
118 Ga0105242_10130326 3300009176 Unclassified 2170
119 Ga0105248_10005822 3300009177 Bacteria 13548
120 Ga0105248_10270866 3300009177 Bacteria 1912
121 Ga0105237_10010074 3300009545 Bacteria 10083
122 Ga0105238_10001073 3300009551 Bacteria 27609
123 Ga0105238_10054690 3300009551 Bacteria 4008
124 Ga0105249_10418102 3300009553 Bacteria 1374
125 Ga0105239_10158962 3300010375 Bacteria 2524
126 Ga0157373_10002325 3300013100 Bacteria 14414
127 Ga0157370_10009809 3300013104 Bacteria 10154
128 Ga0157370_10070643 3300013104 Bacteria 3296
129 Ga0157370_10198869 3300013104 Bacteria 1859
130 Ga0157369_10000226 3300013105 Bacteria 77681
131 Ga0157369_10017307 3300013105 Bacteria 8102
132 Ga0157369_10019453 3300013105 Bacteria 7596
133 Ga0157369_10065553 3300013105 Bacteria 3909
134 Ga0157369_10166500 3300013105 Bacteria 2324
135 Ga0157374_10001532 3300013296 Bacteria 19457
136 Ga0157374_10001626 3300013296 Bacteria 18829
137 Ga0157374_10007370 3300013296 Bacteria 9382
138 Ga0157374_10064729 3300013296 Bacteria 3432
139 Ga0157374_10196565 3300013296 Bacteria 1974
140 Ga0157378_10000545 3300013297 Bacteria 35778
141 Ga0157378_10004410 3300013297 Bacteria 12389
142 Ga0157378_10045293 3300013297 Bacteria 3908
143 Ga0157378_10132974 3300013297 Bacteria 2304
144 Ga0163162_10077402 3300013306 Bacteria 3389
145 Ga0157372_10002806 3300013307 Bacteria 18822
146 Ga0157372_10003562 3300013307 Bacteria 16764
147 Ga0157372_10003649 3300013307 Bacteria 16563
148 Ga0157372_10074309 3300013307 Unclassified 3833
149 Ga0157375_10035238 3300013308 Bacteria 4775
150 Ga0163163_10028534 3300014325 Bacteria 5360
151 Ga0182008_10077090 3300014497 Bacteria 1640
152 Ga0157376_10023669 3300014969 Bacteria 4811
153 Ga0182007_10002124 3300015262 Bacteria 10126
154 Ga0224712_10001962 3300022467 Bacteria 4971
155 Ga0207653_10014625 3300025885 Bacteria 2462
156 Ga0207647_10037675 3300025904 Bacteria 3064
157 Ga0207699_10012060 3300025906 Bacteria 4387
158 Ga0207699_10014781 3300025906 Bacteria 4036
159 Ga0207684_10002859 3300025910 Bacteria 17126
160 Ga0207684_10002865 3300025910 Bacteria 17118
161 Ga0207684_10004052 3300025910 Bacteria 13996
162 Ga0207684_10032716 3300025910 Bacteria 4422
163 Ga0207684_10146224 3300025910 Bacteria 2033
164 Ga0207707_10000014 3300025912 Bacteria 261972
165 Ga0207707_10026289 3300025912 Bacteria 5088
166 Ga0207707_10152742 3300025912 Bacteria 2019
167 Ga0207695_10011610 3300025913 Bacteria 10653
168 Ga0207695_10052735 3300025913 Bacteria 4258
169 Ga0207695_10261155 3300025913 Unclassified 1629
170 Ga0207693_10000815 3300025915 Bacteria 27798
171 Ga0207693_10002457 3300025915 Bacteria 16100
172 Ga0207663_10224364 3300025916 Bacteria 1369
173 Ga0207660_10000966 3300025917 Bacteria 19014
174 Ga0207660_10063841 3300025917 Bacteria 2657
175 Ga0207657_10002249 3300025919 Bacteria 20925
176 Ga0207649_10072809 3300025920 Bacteria 2199
177 Ga0207652_10000031 3300025921 Bacteria 143723
178 Ga0207652_10002182 3300025921 Bacteria 16719
179 Ga0207646_10000243 3300025922 Bacteria 74922
180 Ga0207646_10001292 3300025922 Bacteria 31182
181 Ga0207646_10001512 3300025922 Bacteria 28625
182 Ga0207646_10001578 3300025922 Bacteria 27846
183 Ga0207646_10003115 3300025922 Bacteria 19043
184 Ga0207646_10026406 3300025922 Bacteria 5299
185 Ga0207646_10028545 3300025922 Bacteria 5077
186 Ga0207646_10192488 3300025922 Unclassified 1842
187 Ga0207646_10264268 3300025922 Bacteria 1555
188 Ga0207694_10002635 3300025924 Bacteria 14542
189 Ga0207700_10009877 3300025928 Bacteria 5987
190 Ga0207664_10001858 3300025929 Bacteria 13932
191 Ga0207664_10006671 3300025929 Bacteria 7960
192 Ga0207704_10005372 3300025938 Bacteria 5905
193 Ga0207711_10010471 3300025941 Bacteria 7701
194 Ga0207689_10015821 3300025942 Bacteria 6388
195 Ga0207661_10012998 3300025944 Bacteria 6076
196 Ga0207679_10031917 3300025945 Bacteria 3691
197 Ga0207679_10259016 3300025945 Bacteria 1483
198 Ga0207667_10014106 3300025949 Bacteria 9122
199 Ga0207651_10057755 3300025960 Bacteria 2678
200 Ga0207640_10004940 3300025981 Bacteria 7245
201 Ga0207677_10007774 3300026023 Bacteria 5951
202 Ga0207677_10063558 3300026023 Bacteria 2566
203 Ga0207677_10123892 3300026023 Bacteria 1949
204 Ga0207703_10016539 3300026035 Bacteria 5751
205 Ga0207703_10064100 3300026035 Bacteria 3015
206 Ga0207639_10067571 3300026041 Bacteria 2781
207 Ga0207708_10072291 3300026075 Bacteria 2643
208 Ga0207702_10005881 3300026078 Bacteria 10666
209 Ga0207702_10010023 3300026078 Bacteria 7945
210 Ga0207702_10023496 3300026078 Bacteria 5114
211 Ga0207702_10031155 3300026078 Bacteria 4445
212 Ga0207702_10068902 3300026078 Bacteria 3040
213 Ga0207676_10003536 3300026095 Bacteria 11057
214 Ga0207676_10013101 3300026095 Bacteria 5952
215 Ga0207674_10002224 3300026116 Bacteria 24572
216 Ga0207674_10014251 3300026116 Bacteria 8785
217 Ga0207675_100069782 3300026118 Bacteria 3284
218 Ga0207675_100086721 3300026118 Bacteria 2939
219 Ga0207698_10232429 3300026142 Bacteria 1675
220 Ga0268264_10018321 3300028381 Bacteria 5725
221 Ga0268264_10076675 3300028381 Bacteria 2845
222 Ga0265760_10000809 3300031090 Bacteria 9032
223 Ga0307412_10163404 3300031911 Bacteria 1657
224 Ga0373934_0046532 3300035086 Bacteria 1716
225 Ga0373955_0123606 3300035172 Bacteria 1506
226 Ga0373933_0004512 3300035724 Bacteria 7632
227 Ga0373937_0000071 3300036401 Bacteria 92562
228 Ga0373937_0097486 3300036401 Bacteria 2727
229 Ga0373925_0015960 3300037068 Bacteria 5438
230 Ga0395905_0178704 3300037471 Bacteria 1992
231 Ga0436364_0421959 3300037853 Bacteria 3105
232 Ga0436365_0890453 3300039437 Bacteria 1598
233 Ga0436365_1777915 3300039437 Bacteria 1387
234 Ga0436361_0847909 3300039447 Unclassified 3021
235 Ga0436363_0745643 3300039450 Bacteria 5765
236 Ga0436363_0826261 3300039450 Bacteria 4177
237 Ga0436362_0374620 3300039453 Bacteria 8841
238 Ga0439448_0022799 3300042005 Bacteria 1949
239 Ga0439455_0007939 3300042012 Bacteria 2262
240 Ga0453683_0029019 3300044673 Bacteria 3500
241 Ga0453684_0197125 3300044712 Unclassified 2350
242 Ga0466967_0019706 3300045976 Bacteria 5430
243 Ga0495651_0030145 3300046462 Bacteria 4229
244 Ga0495653_0019532 3300046463 Bacteria 5495
245 Ga0495580_0065861 3300046472 Bacteria 2537
246 Ga0495652_0026958 3300046529 Bacteria 5068
247 Ga0495587_0000293 3300046536 Bacteria 35521
248 Ga0495635_0125310 3300046663 Bacteria 1752
249 Ga0495623_0040057 3300046679 Bacteria 2993
250 Ga0495623_0082848 3300046679 Bacteria 1982
251 Ga0495669_0000782 3300046684 Bacteria 13582
252 Ga0495604_0040160 3300047317 Bacteria 3675
253 Ga0495675_0002734 3300047444 Bacteria 10573
254 Ga0495602_0000111 3300048088 Bacteria 78057
255 Ga0496102_0267986 3300048905 Bacteria 1610
256 Ga0496103_0122869 3300048906 Unclassified 1655
257 Ga0496110_0064909 3300048913 Bacteria 3227
258 Ga0496112_0034091 3300048915 Bacteria 4953
259 Ga0501037_0051009 3300049573 Bacteria 3026
260 nmdc:mga05p37_137558_c1 3300050507 Unclassified 2994
261 nmdc:mga05p37_5636_c1 3300050507 Bacteria 14719
262 nmdc:mga05p37_608675_c1 3300050507 Bacteria 1232
263 nmdc:mga0n895_2395_c1 3300050512 Bacteria 14614
264 nmdc:mga0n895_47731_c1 3300050512 Bacteria 4188
265 nmdc:mga0n895_78945_c1 3300050512 Bacteria 3277
266 nmdc:mga0rr50_101386_c1 3300050513 Bacteria 2263
267 nmdc:mga0rr50_1742_c1 3300050513 Bacteria 12001
268 nmdc:mga0rr50_2897_c1 3300050513 Bacteria 9784
269 nmdc:mga0rr50_97041_c1 3300050513 Bacteria 2307
270 nmdc:mga08x19_25901_c1 3300050514 Bacteria 3657
271 nmdc:mga0a205_11819_c1 3300050515 Bacteria 8058
272 nmdc:mga0a205_51199_c1 3300050515 Bacteria 3986
273 nmdc:mga0a205_596_c1 3300050515 Bacteria 28702
274 Ga0501084_0135958 3300054114 Bacteria 2069
275 Ga0495639_0015409
276 Ga0065707_10118362
277 Ga0070683_100014651
278 Ga0070670_100001641
279 Ga0070680_100001210
280 Ga0070680_100056749
281 Ga0068868_100002868
282 Ga0068868_100026703
283 Ga0068868_100040758
284 Ga0070689_100072211
285 Ga0070673_100032561
286 Ga0070703_10005902
287 Ga0070714_100002836
288 Ga0070714_100077346
289 Ga0070713_100004168
290 Ga0070713_100009308
291 Ga0070713_100023473
292 Ga0070713_100069665
293 Ga0070711_100286966
294 Ga0070705_100060320
295 Ga0070705_100066358
296 Ga0070694_100018403
297 Ga0070708_100005972
298 Ga0070708_100015278
299 Ga0070708_100058358
300 Ga0070681_10000851
301 Ga0070681_10008275
302 Ga0070681_10021631
303 Ga0070706_100002531
304 Ga0070706_100003206
305 Ga0070706_100126309
306 Ga0070706_100239721
307 Ga0070707_100000682
308 Ga0070707_100001865
309 Ga0070707_100025640
310 Ga0070707_100205665
311 Ga0070707_100209175
312 Ga0070698_100046269
313 Ga0070698_100051762
314 Ga0070698_100060457
315 Ga0070699_100001080
316 Ga0070699_100023221
317 Ga0070699_100031276
318 Ga0070699_100165454
319 Ga0070679_100000028
320 Ga0070679_100002531
321 Ga0070679_100076281
322 Ga0070684_100072977
323 Ga0070684_100089037
324 Ga0070697_100000268
325 Ga0070697_100001056
326 Ga0070697_100009779
327 Ga0070697_100010001
328 Ga0070697_100012210
329 Ga0070697_100033126
330 Ga0070697_100075023
331 Ga0070697_100085107
332 Ga0070697_100152648
333 Ga0068853_100029104
334 Ga0068853_100061657
335 Ga0070695_100067215
336 Ga0070695_100107331
337 Ga0070693_100092598
338 Ga0068855_100004334
339 Ga0068855_100013796
340 Ga0068855_100025824
341 Ga0070664_100051748
342 Ga0070664_100107994
343 Ga0068857_100000411
344 Ga0068857_100022633
345 Ga0068854_100014063
346 Ga0068856_100002442
347 Ga0068856_100012213
348 Ga0068856_100028716
349 Ga0068856_100319476
350 Ga0068859_100022911
351 Ga0068859_100026284
352 Ga0068864_100008130
353 Ga0068864_100016831
354 Ga0068864_100122883
355 Ga0068866_10056937
356 Ga0068863_100128478
357 Ga0068863_100211559
358 Ga0068858_100061733
359 Ga0068860_100094056
360 Ga0070717_10009372
361 Ga0070717_10009873
362 Ga0070717_10117372
363 Ga0070716_100008386
364 Ga0070712_100012390
365 Ga0097621_100000310
366 Ga0097621_100000410
367 Ga0068871_100001885
368 Ga0068871_100004803
369 Ga0068871_100064387
370 Ga0075433_10128108
371 Ga0075434_100000048
372 Ga0075434_100000235
373 Ga0075434_100002111
374 Ga0075434_100008870
375 Ga0075434_100160040
376 Ga0068865_100008172
377 Ga0075436_100011158
378 Ga0075436_100052751
379 Ga0097620_100022911
380 Ga0097620_100026284
381 Ga0075435_100000099
382 Ga0075435_100000913
383 Ga0075435_100118518
384 Ga0105240_10011923
385 Ga0105240_10037218
386 Ga0105240_10038543
387 Ga0105245_10414019
388 Ga0114129_10082465
389 Ga0114129_10110886
390 Ga0114129_10295442
391 Ga0105241_10008291
392 Ga0105242_10130326
393 Ga0105248_10005822
394 Ga0105248_10270866
395 Ga0105237_10010074
396 Ga0105238_10001073
397 Ga0105238_10054690
398 Ga0105249_10418102
399 Ga0105239_10158962
400 Ga0157373_10002325
401 Ga0157370_10009809
402 Ga0157370_10070643
403 Ga0157370_10198869
404 Ga0157369_10000226
405 Ga0157369_10017307
406 Ga0157369_10019453
407 Ga0157369_10065553
408 Ga0157369_10166500
409 Ga0157374_10001532
410 Ga0157374_10001626
411 Ga0157374_10007370
412 Ga0157374_10064729
413 Ga0157374_10196565
414 Ga0157378_10000545
415 Ga0157378_10004410
416 Ga0157378_10045293
417 Ga0157378_10132974
418 Ga0163162_10077402
419 Ga0157372_10002806
420 Ga0157372_10003562
421 Ga0157372_10003649
422 Ga0157372_10074309
423 Ga0157375_10035238
424 Ga0163163_10028534
425 Ga0182008_10077090
426 Ga0157376_10023669
427 Ga0182007_10002124
428 Ga0224712_10001962
429 Ga0207653_10014625
430 Ga0207647_10037675
431 Ga0207699_10012060
432 Ga0207699_10014781
433 Ga0207684_10002859
434 Ga0207684_10002865
435 Ga0207684_10004052
436 Ga0207684_10032716
437 Ga0207684_10146224
438 Ga0207707_10000014
439 Ga0207707_10026289
440 Ga0207707_10152742
441 Ga0207695_10011610
442 Ga0207695_10052735
443 Ga0207695_10261155
444 Ga0207693_10000815
445 Ga0207693_10002457
446 Ga0207663_10224364
447 Ga0207660_10000966
448 Ga0207660_10063841
449 Ga0207657_10002249
450 Ga0207649_10072809
451 Ga0207652_10000031
452 Ga0207652_10002182
453 Ga0207646_10000243
454 Ga0207646_10001292
455 Ga0207646_10001512
456 Ga0207646_10001578
457 Ga0207646_10003115
458 Ga0207646_10026406
459 Ga0207646_10028545
460 Ga0207646_10192488
461 Ga0207646_10264268
462 Ga0207694_10002635
463 Ga0207700_10009877
464 Ga0207664_10001858
465 Ga0207664_10006671
466 Ga0207704_10005372
467 Ga0207711_10010471
468 Ga0207689_10015821
469 Ga0207661_10012998
470 Ga0207679_10031917
471 Ga0207679_10259016
472 Ga0207667_10014106
473 Ga0207651_10057755
474 Ga0207640_10004940
475 Ga0207677_10007774
476 Ga0207677_10063558
477 Ga0207677_10123892
478 Ga0207703_10016539
479 Ga0207703_10064100
480 Ga0207639_10067571
481 Ga0207708_10072291
482 Ga0207702_10005881
483 Ga0207702_10010023
484 Ga0207702_10023496
485 Ga0207702_10031155
486 Ga0207702_10068902
487 Ga0207676_10003536
488 Ga0207676_10013101
489 Ga0207674_10002224
490 Ga0207674_10014251
491 Ga0207675_100069782
492 Ga0207675_100086721
493 Ga0207698_10232429
494 Ga0268264_10018321
495 Ga0268264_10076675
496 Ga0265760_10000809
497 Ga0307412_10163404
498 Ga0373934_0046532
499 Ga0373955_0123606
500 Ga0373933_0004512
501 Ga0373937_0000071
502 Ga0373937_0097486
503 Ga0373925_0015960
504 Ga0395905_0178704
505 Ga0436364_0421959
506 Ga0436365_0890453
507 Ga0436365_1777915
508 Ga0436361_0847909
509 Ga0436363_0745643
510 Ga0436363_0826261
511 Ga0436362_0374620
512 Ga0439448_0022799
513 Ga0439455_0007939
514 Ga0453683_0029019
515 Ga0453684_0197125
516 Ga0466967_0019706
517 Ga0495651_0030145
518 Ga0495653_0019532
519 Ga0495580_0065861
520 Ga0495652_0026958
521 Ga0495587_0000293
522 Ga0495635_0125310
523 Ga0495623_0040057
524 Ga0495623_0082848
525 Ga0495669_0000782
526 Ga0495604_0040160
527 Ga0495675_0002734
528 Ga0495602_0000111
529 Ga0496102_0267986
530 Ga0496103_0122869
531 Ga0496110_0064909
532 Ga0496112_0034091
533 Ga0501037_0051009
534 nmdc:mga05p37_137558_c1
535 nmdc:mga05p37_5636_c1
536 nmdc:mga05p37_608675_c1
537 nmdc:mga0n895_2395_c1
538 nmdc:mga0n895_47731_c1
539 nmdc:mga0n895_78945_c1
540 nmdc:mga0rr50_101386_c1
541 nmdc:mga0rr50_1742_c1
542 nmdc:mga0rr50_2897_c1
543 nmdc:mga0rr50_97041_c1
544 nmdc:mga08x19_25901_c1
545 nmdc:mga0a205_11819_c1
546 nmdc:mga0a205_51199_c1
547 nmdc:mga0a205_596_c1
548 Ga0501084_0135958

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00871

Acetate_kinase

Acetokinase family

39

429

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ioy-assembly2.cif.gz_C crystal structure of porphyromonas gingivalis acetate kinase 0.9573 2 395
3khy-assembly1.cif.gz_B crystal structure of a propionate kinase from francisella tularensis subsp. tularensis schu s4 0.9507 2 395
7fjb-assembly1.cif.gz_A kpacka (pduw) with amppnp, sodium acetate complex structure 0.9477 2 395
7fj7-assembly1.cif.gz_B kpacka (pduw) native structure 0.9413 2 395
6ioy-assembly2.cif.gz_C crystal structure of porphyromonas gingivalis acetate kinase 0.9385 2 395
ID Description Score Start End Superfamily
1x3mA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9784 204 399 3.30.420.40
2iirA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9753 201 400 3.30.420.40
3khyB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9538 204 399 3.30.420.40
2iirA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9474 201 400 3.30.420.40
4h0oB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9433 204 399 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A2X3HC35-F1-model_v4 Propionate kinase, propanediol utilization (EC 2.7.2.1) 0.9916 232 363 GO:0006083
GO:0008776
AF-K1SBS7-F1-model_v4 Acetate kinase 0.9915 156 330 GO:0005524
GO:0005737
GO:0006083
GO:0008776
AF-A0A6P0TQA2-F1-model_v4 Acetate/propionate family kinase (EC 2.7.2.1) 0.9912 177 400 GO:0005524
GO:0005737
GO:0006083
GO:0008776
GO:0047761
AF-A0A1Q8ZEX9-F1-model_v4 Acetate kinase (EC 2.7.2.1) (Acetokinase) 0.9904 1 403 GO:0000287
GO:0005524
GO:0005737
GO:0006083
GO:0006085
GO:0008776
AF-A0A7Y0XAY1-F1-model_v4 Acetate kinase (EC 2.7.2.1) 0.9904 235 319 GO:0005829
GO:0006083
GO:0008776

Map