F379888

General Info

Members Datasets Scaffolds Average Seq Length
274 197 548 240

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1831890|Ga0436365_1831890_2863_3672
Length 269
Sequence MNGFQNDPPAASAALISQRAASCEVSDSREPGVFLTAEWRFLAMLNFTIDPCVLADQVPRGTELDEFGGETFVSVVGFRFLNTRVRGLPIPFHRNFDEVNLRFYVRRKSVDGTWRRGVVFVKEIVPRCAIAIIARCFYNENYSAMPMRHRVELERGDFAYEWKHGGSWSGISARIAMKSDASFVRENSIEEFITEHYWGYSRQRDGGTVEDRVEHPKWRVWPAAQTRFSCTEVATLYGTMFKECLNSPPASVFVADGSPVTVFRGVRIC

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
166 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
169 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
195 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
196 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
197 2808606394 Promicromonospora sp. C35 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 0
Isolates 1.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.09
Nodule 0
Rhizoplane 6.2
Rhizosphere 89.42
Stem 0
Stem Tuber 0
Unclassified 5.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1831890 3300039437 Bacteria 6947
2 JGI24737J22298_10050098 3300001990 Bacteria 1270
3 JGI24749J21850_1004344 3300002076 Bacteria 1981
4 rootH2_10184607 3300003320 Bacteria 2310
5 Ga0070658_10001588 3300005327 Bacteria 19209
6 Ga0070676_10000290 3300005328 Bacteria 22266
7 Ga0070676_10047316 3300005328 Bacteria 2512
8 Ga0070683_100001772 3300005329 Bacteria 16802
9 Ga0070683_100058044 3300005329 Bacteria 3596
10 Ga0070683_100576240 3300005329 Bacteria 1076
11 Ga0070690_100002296 3300005330 Bacteria 10254
12 Ga0070677_10000904 3300005333 Bacteria 9739
13 Ga0070677_10155250 3300005333 Bacteria 1069
14 Ga0068869_100017395 3300005334 Bacteria 4871
15 Ga0070666_10008618 3300005335 Bacteria 6338
16 Ga0068868_100035022 3300005338 Bacteria 3879
17 Ga0070660_100003223 3300005339 Bacteria 11215
18 Ga0070689_100001678 3300005340 Bacteria 14140
19 Ga0070687_100000134 3300005343 Bacteria 25638
20 Ga0070661_100005981 3300005344 Bacteria 8376
21 Ga0070668_100004595 3300005347 Bacteria 10225
22 Ga0070668_100005138 3300005347 Bacteria 9704
23 Ga0070669_100004995 3300005353 Bacteria 9583
24 Ga0070669_100230739 3300005353 Bacteria 1467
25 Ga0070675_100002647 3300005354 Bacteria 13454
26 Ga0070671_100004204 3300005355 Bacteria 11386
27 Ga0070671_100150802 3300005355 Bacteria 1963
28 Ga0070674_100015294 3300005356 Bacteria 4788
29 Ga0070674_100046891 3300005356 Bacteria 2959
30 Ga0070673_100001726 3300005364 Bacteria 12989
31 Ga0070673_100418996 3300005364 Bacteria 1200
32 Ga0070688_100000725 3300005365 Bacteria 16228
33 Ga0070659_100022953 3300005366 Bacteria 4769
34 Ga0070659_100036431 3300005366 Bacteria 3836
35 Ga0070667_100008779 3300005367 Bacteria 8376
36 Ga0070667_100040935 3300005367 Bacteria 3887
37 Ga0070667_100270309 3300005367 Bacteria 1524
38 Ga0070714_100076546 3300005435 Unclassified 2905
39 Ga0070713_100520197 3300005436 Bacteria 1124
40 Ga0070701_10002737 3300005438 Bacteria 6834
41 Ga0070705_100000915 3300005440 Bacteria 16501
42 Ga0070700_100039955 3300005441 Bacteria 2869
43 Ga0070694_100266410 3300005444 Bacteria 1301
44 Ga0070694_100316815 3300005444 Bacteria 1199
45 Ga0070708_100023328 3300005445 Bacteria 5261
46 Ga0070663_100000805 3300005455 Bacteria 17079
47 Ga0070678_100002119 3300005456 Bacteria 10760
48 Ga0070678_100698925 3300005456 Bacteria 913
49 Ga0070681_10001161 3300005458 Bacteria 22712
50 Ga0070681_10061975 3300005458 Unclassified 3714
51 Ga0070681_10441451 3300005458 Bacteria 1213
52 Ga0070685_10000823 3300005466 Bacteria 16890
53 Ga0070699_100070125 3300005518 Bacteria 3047
54 Ga0070699_100661538 3300005518 Bacteria 954
55 Ga0070684_100183680 3300005535 Bacteria 1902
56 Ga0070684_100192656 3300005535 Unclassified 1855
57 Ga0068853_100000288 3300005539 Bacteria 35623
58 Ga0068853_100423834 3300005539 Bacteria 1248
59 Ga0070672_100002431 3300005543 Bacteria 11810
60 Ga0070672_100068298 3300005543 Bacteria 2819
61 Ga0070686_100015192 3300005544 Bacteria 4452
62 Ga0070696_100007067 3300005546 Bacteria 7496
63 Ga0070696_100031518 3300005546 Bacteria 3633
64 Ga0070696_100047119 3300005546 Bacteria 2990
65 Ga0070696_100373221 3300005546 Bacteria 1110
66 Ga0070693_100009539 3300005547 Bacteria 4828
67 Ga0070665_100410322 3300005548 Bacteria 1363
68 Ga0070704_100008242 3300005549 Bacteria 6236
69 Ga0068855_100000202 3300005563 Bacteria 76682
70 Ga0070664_100000880 3300005564 Bacteria 23311
71 Ga0070664_100022922 3300005564 Bacteria 5151
72 Ga0070664_100315960 3300005564 Bacteria 1414
73 Ga0068857_100007319 3300005577 Bacteria 9508
74 Ga0068854_100000406 3300005578 Bacteria 27042
75 Ga0068854_100198089 3300005578 Unclassified 1577
76 Ga0068856_100003305 3300005614 Bacteria 16389
77 Ga0068852_100001279 3300005616 Bacteria 16796
78 Ga0068852_100111663 3300005616 Bacteria 2486
79 Ga0068864_100007399 3300005618 Bacteria 9038
80 Ga0068866_10000446 3300005718 Bacteria 19086
81 Ga0068866_10270710 3300005718 Bacteria 1048
82 Ga0068861_100000909 3300005719 Bacteria 17941
83 Ga0068851_10000065 3300005834 Bacteria 58958
84 Ga0068870_10000197 3300005840 Bacteria 21559
85 Ga0068863_100001270 3300005841 Bacteria 25170
86 Ga0068863_100264059 3300005841 Bacteria 1665
87 Ga0068858_100026447 3300005842 Bacteria 5390
88 Ga0068858_100181260 3300005842 Unclassified 1989
89 Ga0068860_100035419 3300005843 Bacteria 4787
90 Ga0068862_100010400 3300005844 Bacteria 7681
91 Ga0081540_1000632 3300005983 Bacteria 33503
92 Ga0081540_1001798 3300005983 Bacteria 17972
93 Ga0097621_100000918 3300006237 Bacteria 20604
94 Ga0068871_100001441 3300006358 Bacteria 15931
95 Ga0075430_100019610 3300006846 Bacteria 5753
96 Ga0075431_100181966 3300006847 Bacteria 2157
97 Ga0075434_100099016 3300006871 Bacteria 2921
98 Ga0075429_100031474 3300006880 Bacteria 4611
99 Ga0068865_100003309 3300006881 Bacteria 9643
100 Ga0068865_100041290 3300006881 Bacteria 3138
101 Ga0075436_100113728 3300006914 Bacteria 1890
102 Ga0105240_10000362 3300009093 Bacteria 85169
103 Ga0105240_10003064 3300009093 Bacteria 26280
104 Ga0105245_10003290 3300009098 Bacteria 14505
105 Ga0105247_10000835 3300009101 Bacteria 23400
106 Ga0114129_10468494 3300009147 Bacteria 1650
107 Ga0105243_10004796 3300009148 Bacteria 10628
108 Ga0105241_10000829 3300009174 Bacteria 23452
109 Ga0105242_10003636 3300009176 Bacteria 12005
110 Ga0105242_10022732 3300009176 Bacteria 4936
111 Ga0105248_10004044 3300009177 Bacteria 16204
112 Ga0105248_10024266 3300009177 Bacteria 6742
113 Ga0105248_10102329 3300009177 Bacteria 3229
114 Ga0105248_10137379 3300009177 Archaea 2757
115 Ga0105248_10413007 3300009177 Bacteria 1520
116 Ga0105237_10000190 3300009545 Bacteria 87182
117 Ga0105237_10004664 3300009545 Bacteria 15788
118 Ga0105238_10003095 3300009551 Bacteria 16587
119 Ga0105249_10000986 3300009553 Bacteria 25228
120 Ga0105239_10003835 3300010375 Bacteria 18255
121 Ga0105246_10000988 3300011119 Bacteria 16346
122 Ga0157373_10024751 3300013100 Bacteria 4346
123 Ga0157371_10004934 3300013102 Bacteria 11461
124 Ga0157371_10084288 3300013102 Unclassified 2251
125 Ga0157369_10000161 3300013105 Bacteria 94988
126 Ga0157374_10002380 3300013296 Bacteria 15849
127 Ga0157378_10018649 3300013297 Bacteria 6100
128 Ga0163162_10020106 3300013306 Bacteria 6555
129 Ga0163162_10398099 3300013306 Bacteria 1510
130 Ga0157372_10043708 3300013307 Bacteria 4962
131 Ga0157372_10312888 3300013307 Bacteria 1828
132 Ga0157372_10361120 3300013307 Unclassified 1692
133 Ga0157375_10005980 3300013308 Bacteria 10612
134 Ga0157375_10016529 3300013308 Bacteria 6633
135 Ga0157375_10997260 3300013308 Bacteria 977
136 Ga0163163_10005677 3300014325 Bacteria 10820
137 Ga0157377_10000141 3300014745 Bacteria 45798
138 Ga0157379_10000079 3300014968 Bacteria 63166
139 Ga0163161_10004026 3300017792 Bacteria 10288
140 Ga0213873_10006819 3300021358 Bacteria 2262
141 Ga0213874_10019848 3300021377 Unclassified 1835
142 Ga0213876_10001804 3300021384 Bacteria 12963
143 Ga0207656_10001519 3300025321 Bacteria 7687
144 Ga0207682_10000319 3300025893 Bacteria 21917
145 Ga0207642_10007301 3300025899 Bacteria 3724
146 Ga0207642_10167561 3300025899 Bacteria 1185
147 Ga0207710_10009237 3300025900 Bacteria 4146
148 Ga0207688_10000015 3300025901 Bacteria 57722
149 Ga0207645_10000025 3300025907 Bacteria 98264
150 Ga0207645_10010587 3300025907 Bacteria 6328
151 Ga0207645_10055357 3300025907 Bacteria 2532
152 Ga0207643_10000023 3300025908 Bacteria 104515
153 Ga0207654_10005233 3300025911 Bacteria 6548
154 Ga0207695_10002963 3300025913 Bacteria 24490
155 Ga0207695_10032041 3300025913 Bacteria 5757
156 Ga0207671_10010649 3300025914 Bacteria 7566
157 Ga0207671_10014816 3300025914 Bacteria 6141
158 Ga0207662_10000346 3300025918 Bacteria 20992
159 Ga0207657_10000067 3300025919 Bacteria 97934
160 Ga0207657_10363998 3300025919 Bacteria 1140
161 Ga0207649_10005875 3300025920 Bacteria 6651
162 Ga0207681_10005928 3300025923 Bacteria 7493
163 Ga0207694_10013669 3300025924 Bacteria 6118
164 Ga0207650_10001179 3300025925 Bacteria 19191
165 Ga0207659_10009111 3300025926 Bacteria 6195
166 Ga0207687_10003535 3300025927 Bacteria 10516
167 Ga0207700_10442052 3300025928 Bacteria 1145
168 Ga0207644_10003180 3300025931 Bacteria 10570
169 Ga0207644_10294028 3300025931 Bacteria 1307
170 Ga0207690_10218234 3300025932 Bacteria 1458
171 Ga0207706_10000119 3300025933 Bacteria 84681
172 Ga0207686_10005186 3300025934 Bacteria 6999
173 Ga0207709_10006135 3300025935 Bacteria 6772
174 Ga0207670_10015676 3300025936 Bacteria 4534
175 Ga0207669_10006708 3300025937 Bacteria 5279
176 Ga0207669_10065867 3300025937 Bacteria 2250
177 Ga0207704_10002681 3300025938 Bacteria 8029
178 Ga0207704_10008640 3300025938 Bacteria 4881
179 Ga0207665_10202640 3300025939 Bacteria 1446
180 Ga0207691_10000079 3300025940 Bacteria 82300
181 Ga0207691_10040009 3300025940 Unclassified 4335
182 Ga0207711_10001940 3300025941 Bacteria 18767
183 Ga0207711_10087226 3300025941 Bacteria 2737
184 Ga0207689_10001164 3300025942 Bacteria 25319
185 Ga0207661_10029118 3300025944 Unclassified 4238
186 Ga0207661_10070815 3300025944 Bacteria 2847
187 Ga0207679_10001426 3300025945 Bacteria 15043
188 Ga0207679_10012698 3300025945 Bacteria 5499
189 Ga0207667_10011756 3300025949 Bacteria 10151
190 Ga0207651_10001904 3300025960 Bacteria 9791
191 Ga0207712_10000157 3300025961 Bacteria 70058
192 Ga0207640_10005886 3300025981 Bacteria 6693
193 Ga0207640_10087198 3300025981 Bacteria 2151
194 Ga0207658_10000885 3300025986 Bacteria 24958
195 Ga0207658_10432534 3300025986 Bacteria 1162
196 Ga0207677_10001750 3300026023 Bacteria 11508
197 Ga0207703_10004731 3300026035 Bacteria 11108
198 Ga0207703_10753267 3300026035 Unclassified 928
199 Ga0207678_10004402 3300026067 Bacteria 12666
200 Ga0207708_10028209 3300026075 Bacteria 4250
201 Ga0207702_10011996 3300026078 Bacteria 7204
202 Ga0207641_10006324 3300026088 Bacteria 10008
203 Ga0207641_10047583 3300026088 Bacteria 3617
204 Ga0207641_10361085 3300026088 Bacteria 1387
205 Ga0207648_10000095 3300026089 Bacteria 84340
206 Ga0207648_10011651 3300026089 Bacteria 8276
207 Ga0207676_10052751 3300026095 Bacteria 3180
208 Ga0207674_10001904 3300026116 Bacteria 26535
209 Ga0207674_10301973 3300026116 Bacteria 1550
210 Ga0207675_100001269 3300026118 Bacteria 25244
211 Ga0207683_10000050 3300026121 Bacteria 87435
212 Ga0207698_10002408 3300026142 Bacteria 11070
213 Ga0268266_10006711 3300028379 Bacteria 10496
214 Ga0268266_10465887 3300028379 Bacteria 1203
215 Ga0268265_10010106 3300028380 Bacteria 6372
216 Ga0268264_10001060 3300028381 Bacteria 27306
217 Ga0268264_10553792 3300028381 Bacteria 1128
218 Ga0265332_10050396 3300031238 Bacteria 1789
219 Ga0265327_10033016 3300031251 Bacteria 2891
220 Ga0307408_100157145 3300031548 Bacteria 1802
221 Ga0265314_10151487 3300031711 Bacteria 1421
222 Ga0307410_10049916 3300031852 Bacteria 2811
223 Ga0307406_10152156 3300031901 Bacteria 1652
224 Ga0307412_10120531 3300031911 Bacteria 1888
225 Ga0307416_100182743 3300032002 Bacteria 1967
226 Ga0307416_100332198 3300032002 Bacteria 1528
227 Ga0373926_0103739 3300035083 Bacteria 1065
228 Ga0373931_0014466 3300035691 Bacteria 3858
229 Ga0373931_0058541 3300035691 Bacteria 2070
230 Ga0373935_0311803 3300035692 Bacteria 1114
231 Ga0373927_0130700 3300035695 Bacteria 1640
232 Ga0373925_0169752 3300037068 Bacteria 1722
233 Ga0395905_0206064 3300037471 Bacteria 1843
234 Ga0395905_0576291 3300037471 Bacteria 1027
235 Ga0242420_000771 3300038996 Bacteria 3882
236 Ga0436365_1287470 3300039437 Bacteria 21320
237 Ga0436360_0885059 3300039438 Bacteria 4037
238 Ga0436363_1305149 3300039450 Unclassified 1582
239 Ga0436362_0211425 3300039453 Bacteria 11138
240 Ga0453683_0252710 3300044673 Bacteria 1124
241 Ga0453684_0186058 3300044712 Bacteria 2434
242 Ga0453684_0319776 3300044712 Bacteria 1758
243 Ga0451576_0734397 3300045051 Bacteria 1037
244 Ga0495627_018041 3300046453 Bacteria 2388
245 Ga0495580_0092844 3300046472 Bacteria 2101
246 Ga0495680_0518176 3300047322 Bacteria 807
247 Ga0496101_0699202 3300048904 Bacteria 800
248 Ga0496102_0001170 3300048905 Bacteria 23917
249 Ga0496104_0114530 3300048907 Bacteria 2586
250 Ga0496104_0391470 3300048907 Bacteria 1302
251 Ga0496105_0268659 3300048908 Bacteria 1378
252 Ga0496106_0002989 3300048909 Bacteria 12592
253 Ga0496106_0015684 3300048909 Bacteria 5605
254 Ga0496107_0085161 3300048910 Bacteria 2307
255 Ga0496108_0057738 3300048911 Bacteria 3261
256 Ga0496108_0115403 3300048911 Bacteria 2300
257 Ga0496109_0005986 3300048912 Bacteria 10216
258 Ga0496109_0235920 3300048912 Bacteria 1721
259 Ga0496110_0474357 3300048913 Bacteria 1140
260 Ga0496112_0013894 3300048915 Bacteria 7449
261 Ga0496113_0294678 3300048916 Bacteria 1298
262 Ga0496113_0460840 3300048916 Bacteria 1021
263 Ga0496115_0171084 3300048918 Bacteria 1797
264 Ga0501034_0452800 3300049571 Unclassified 1201
265 Ga0501069_0022580 3300049585 Bacteria 3425
266 Ga0501076_0271135 3300049592 Bacteria 1390
267 nmdc:mga05p37_471101_c1 3300050507 Bacteria 1449
268 nmdc:mga0n895_278201_c1 3300050512 Unclassified 1697
269 Ga0500555_002531 3300053103 Bacteria 5284
270 Ga0500568_0030026 3300053139 Bacteria 2252
271 Ga0500645_001018 3300053730 Bacteria 15707
272 2739605153 2739367654 Bacteria 6049412
273 2760305751 2758568522 Bacteria 5953541
274 2809028359 2808606394 Bacteria 6248540
275 Ga0436365_1831890
276 JGI24737J22298_10050098
277 JGI24749J21850_1004344
278 rootH2_10184607
279 Ga0070658_10001588
280 Ga0070676_10000290
281 Ga0070676_10047316
282 Ga0070683_100001772
283 Ga0070683_100058044
284 Ga0070683_100576240
285 Ga0070690_100002296
286 Ga0070677_10000904
287 Ga0070677_10155250
288 Ga0068869_100017395
289 Ga0070666_10008618
290 Ga0068868_100035022
291 Ga0070660_100003223
292 Ga0070689_100001678
293 Ga0070687_100000134
294 Ga0070661_100005981
295 Ga0070668_100004595
296 Ga0070668_100005138
297 Ga0070669_100004995
298 Ga0070669_100230739
299 Ga0070675_100002647
300 Ga0070671_100004204
301 Ga0070671_100150802
302 Ga0070674_100015294
303 Ga0070674_100046891
304 Ga0070673_100001726
305 Ga0070673_100418996
306 Ga0070688_100000725
307 Ga0070659_100022953
308 Ga0070659_100036431
309 Ga0070667_100008779
310 Ga0070667_100040935
311 Ga0070667_100270309
312 Ga0070714_100076546
313 Ga0070713_100520197
314 Ga0070701_10002737
315 Ga0070705_100000915
316 Ga0070700_100039955
317 Ga0070694_100266410
318 Ga0070694_100316815
319 Ga0070708_100023328
320 Ga0070663_100000805
321 Ga0070678_100002119
322 Ga0070678_100698925
323 Ga0070681_10001161
324 Ga0070681_10061975
325 Ga0070681_10441451
326 Ga0070685_10000823
327 Ga0070699_100070125
328 Ga0070699_100661538
329 Ga0070684_100183680
330 Ga0070684_100192656
331 Ga0068853_100000288
332 Ga0068853_100423834
333 Ga0070672_100002431
334 Ga0070672_100068298
335 Ga0070686_100015192
336 Ga0070696_100007067
337 Ga0070696_100031518
338 Ga0070696_100047119
339 Ga0070696_100373221
340 Ga0070693_100009539
341 Ga0070665_100410322
342 Ga0070704_100008242
343 Ga0068855_100000202
344 Ga0070664_100000880
345 Ga0070664_100022922
346 Ga0070664_100315960
347 Ga0068857_100007319
348 Ga0068854_100000406
349 Ga0068854_100198089
350 Ga0068856_100003305
351 Ga0068852_100001279
352 Ga0068852_100111663
353 Ga0068864_100007399
354 Ga0068866_10000446
355 Ga0068866_10270710
356 Ga0068861_100000909
357 Ga0068851_10000065
358 Ga0068870_10000197
359 Ga0068863_100001270
360 Ga0068863_100264059
361 Ga0068858_100026447
362 Ga0068858_100181260
363 Ga0068860_100035419
364 Ga0068862_100010400
365 Ga0081540_1000632
366 Ga0081540_1001798
367 Ga0097621_100000918
368 Ga0068871_100001441
369 Ga0075430_100019610
370 Ga0075431_100181966
371 Ga0075434_100099016
372 Ga0075429_100031474
373 Ga0068865_100003309
374 Ga0068865_100041290
375 Ga0075436_100113728
376 Ga0105240_10000362
377 Ga0105240_10003064
378 Ga0105245_10003290
379 Ga0105247_10000835
380 Ga0114129_10468494
381 Ga0105243_10004796
382 Ga0105241_10000829
383 Ga0105242_10003636
384 Ga0105242_10022732
385 Ga0105248_10004044
386 Ga0105248_10024266
387 Ga0105248_10102329
388 Ga0105248_10137379
389 Ga0105248_10413007
390 Ga0105237_10000190
391 Ga0105237_10004664
392 Ga0105238_10003095
393 Ga0105249_10000986
394 Ga0105239_10003835
395 Ga0105246_10000988
396 Ga0157373_10024751
397 Ga0157371_10004934
398 Ga0157371_10084288
399 Ga0157369_10000161
400 Ga0157374_10002380
401 Ga0157378_10018649
402 Ga0163162_10020106
403 Ga0163162_10398099
404 Ga0157372_10043708
405 Ga0157372_10312888
406 Ga0157372_10361120
407 Ga0157375_10005980
408 Ga0157375_10016529
409 Ga0157375_10997260
410 Ga0163163_10005677
411 Ga0157377_10000141
412 Ga0157379_10000079
413 Ga0163161_10004026
414 Ga0213873_10006819
415 Ga0213874_10019848
416 Ga0213876_10001804
417 Ga0207656_10001519
418 Ga0207682_10000319
419 Ga0207642_10007301
420 Ga0207642_10167561
421 Ga0207710_10009237
422 Ga0207688_10000015
423 Ga0207645_10000025
424 Ga0207645_10010587
425 Ga0207645_10055357
426 Ga0207643_10000023
427 Ga0207654_10005233
428 Ga0207695_10002963
429 Ga0207695_10032041
430 Ga0207671_10010649
431 Ga0207671_10014816
432 Ga0207662_10000346
433 Ga0207657_10000067
434 Ga0207657_10363998
435 Ga0207649_10005875
436 Ga0207681_10005928
437 Ga0207694_10013669
438 Ga0207650_10001179
439 Ga0207659_10009111
440 Ga0207687_10003535
441 Ga0207700_10442052
442 Ga0207644_10003180
443 Ga0207644_10294028
444 Ga0207690_10218234
445 Ga0207706_10000119
446 Ga0207686_10005186
447 Ga0207709_10006135
448 Ga0207670_10015676
449 Ga0207669_10006708
450 Ga0207669_10065867
451 Ga0207704_10002681
452 Ga0207704_10008640
453 Ga0207665_10202640
454 Ga0207691_10000079
455 Ga0207691_10040009
456 Ga0207711_10001940
457 Ga0207711_10087226
458 Ga0207689_10001164
459 Ga0207661_10029118
460 Ga0207661_10070815
461 Ga0207679_10001426
462 Ga0207679_10012698
463 Ga0207667_10011756
464 Ga0207651_10001904
465 Ga0207712_10000157
466 Ga0207640_10005886
467 Ga0207640_10087198
468 Ga0207658_10000885
469 Ga0207658_10432534
470 Ga0207677_10001750
471 Ga0207703_10004731
472 Ga0207703_10753267
473 Ga0207678_10004402
474 Ga0207708_10028209
475 Ga0207702_10011996
476 Ga0207641_10006324
477 Ga0207641_10047583
478 Ga0207641_10361085
479 Ga0207648_10000095
480 Ga0207648_10011651
481 Ga0207676_10052751
482 Ga0207674_10001904
483 Ga0207674_10301973
484 Ga0207675_100001269
485 Ga0207683_10000050
486 Ga0207698_10002408
487 Ga0268266_10006711
488 Ga0268266_10465887
489 Ga0268265_10010106
490 Ga0268264_10001060
491 Ga0268264_10553792
492 Ga0265332_10050396
493 Ga0265327_10033016
494 Ga0307408_100157145
495 Ga0265314_10151487
496 Ga0307410_10049916
497 Ga0307406_10152156
498 Ga0307412_10120531
499 Ga0307416_100182743
500 Ga0307416_100332198
501 Ga0373926_0103739
502 Ga0373931_0014466
503 Ga0373931_0058541
504 Ga0373935_0311803
505 Ga0373927_0130700
506 Ga0373925_0169752
507 Ga0395905_0206064
508 Ga0395905_0576291
509 Ga0242420_000771
510 Ga0436365_1287470
511 Ga0436360_0885059
512 Ga0436363_1305149
513 Ga0436362_0211425
514 Ga0453683_0252710
515 Ga0453684_0186058
516 Ga0453684_0319776
517 Ga0451576_0734397
518 Ga0495627_018041
519 Ga0495580_0092844
520 Ga0495680_0518176
521 Ga0496101_0699202
522 Ga0496102_0001170
523 Ga0496104_0114530
524 Ga0496104_0391470
525 Ga0496105_0268659
526 Ga0496106_0002989
527 Ga0496106_0015684
528 Ga0496107_0085161
529 Ga0496108_0057738
530 Ga0496108_0115403
531 Ga0496109_0005986
532 Ga0496109_0235920
533 Ga0496110_0474357
534 Ga0496112_0013894
535 Ga0496113_0294678
536 Ga0496113_0460840
537 Ga0496115_0171084
538 Ga0501034_0452800
539 Ga0501069_0022580
540 Ga0501076_0271135
541 nmdc:mga05p37_471101_c1
542 nmdc:mga0n895_278201_c1
543 Ga0500555_002531
544 Ga0500568_0030026
545 Ga0500645_001018
546 2739605153
547 2760305751
548 2809028359

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09844

DUF2071

Uncharacterized conserved protein (COG2071)

36

259

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bgt-assembly1.cif.gz_D structural studies of acetoacetate decarboxylase 0.7525 8 236
3bh2-assembly1.cif.gz_A structural studies of acetoacetate decarboxylase 0.7387 7 236
3c8w-assembly1.cif.gz_A crystal structure of acetoacetate decarboxylase (adc) (yp_094708.1) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.60 a resolution 0.7355 6 237
4jm3-assembly1.cif.gz_B enduracididine biosynthesis enzyme mppr with hepes buffer bound 0.6901 4 237
3bgt-assembly1.cif.gz_D structural studies of acetoacetate decarboxylase 0.6877 8 236
ID Description Score Start End Superfamily
af_P95287_35_247_2.40.400.10 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.8316 10 225 2.40.400.10
af_P95287_35_247_2.40.400.10 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.817 10 225 2.40.400.10
3bgtC01 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.7264 5 236 2.40.400.10
4jmcB00 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.6986 4 237 2.40.400.10
3bgtC01 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.6876 5 236 2.40.400.10
ID Description Score Start End GO Terms
AF-A0A7R8AYM4-F1-model_v4 deleted 0.9774 6 237
AF-A0A6I4ZTK6-F1-model_v4 DUF2071 domain-containing protein 0.9736 3 236
AF-A0A1Y0H6C1-F1-model_v4 DUF2071 domain-containing protein 0.9735 6 238
AF-A0A5B9Q1Y4-F1-model_v4 DUF2071 domain-containing protein 0.9732 5 237
AF-A0A2V6QIP8-F1-model_v4 DUF2071 domain-containing protein 0.9714 6 236

Map