F379627

General Info

Members Datasets Scaffolds Average Seq Length
274 147 548 442

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100044724|Ga0075363_1000447242
Length 479
Sequence MTSAVGGPSLPVYCLFPRYIARKQVAKKSVAFTVFLEVDSPMSSSVRVRFAPSPTGFLHVGGARTALFNWLFARHNQGTFVLRIEDTDESREQEQAVQVIYDGLRWLGLDWDEGGDLGGNYGPYFQSERNAIYEEYLEKLQQKGTIYEDEGALRFHSVHKTVVVDDLVCGRIEFDRSLEPDMTIRRPDGSWIFHFVNVVDDIEMQISHVIRGEDHLTNTSKHMELYQTLDIEPPRFAHIPLILNQDGSKMSKRDAASSLTSYIDQGYAPEAVRNYLCLLGWSPKDNREKIDLEEVVQLFDLAKINRRNAAFDLDKCFWLNGRYIIQMPLARFHELSEPFIRDAGIMISDEGYLLKVLGIVKEKIKLFKDVPDWIACFFNEDFAFEPEAVKKSIRKLGALDHLDHLRQKYFTQKDWSAAGLEAGLKEVATAIGCKTGDLVHPARVAVSGRSVGPSFYHMLEVMGKERVLRRFERALQQLA

Samples

Sample ID Description Type Environment
1 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
141 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
142 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
145 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
146 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
147 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.28
Nodule 0
Rhizoplane 3.65
Rhizosphere 91.61
Stem 0
Stem Tuber 0
Unclassified 4.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075363_100044724 3300006048 Bacteria 2346
2 JGI25406J46586_10000020 3300003203 Bacteria 86123
3 JGI25405J52794_10014191 3300003911 Bacteria 1553
4 Ga0065704_10019798 3300005289 Bacteria 1360
5 Ga0065704_10108537 3300005289 Bacteria 1979
6 Ga0065712_10023592 3300005290 Bacteria 1774
7 Ga0065712_10024310 3300005290 Bacteria 1678
8 Ga0065715_10000456 3300005293 Bacteria 17468
9 Ga0065715_10021284 3300005293 Bacteria 1796
10 Ga0065707_10003424 3300005295 Bacteria 7804
11 Ga0065707_10010367 3300005295 Bacteria 2142
12 Ga0065707_10022391 3300005295 Bacteria 1732
13 Ga0070683_100016490 3300005329 Bacteria 6517
14 Ga0070670_100019714 3300005331 Bacteria 5791
15 Ga0070670_100071643 3300005331 Bacteria 2976
16 Ga0070666_10006322 3300005335 Bacteria 7287
17 Ga0070666_10010951 3300005335 Bacteria 5683
18 Ga0070666_10011028 3300005335 Bacteria 5664
19 Ga0070680_100191666 3300005336 Bacteria 1722
20 Ga0068868_100084259 3300005338 Bacteria 2552
21 Ga0068868_100140609 3300005338 Bacteria 1981
22 Ga0068868_100156636 3300005338 Bacteria 1879
23 Ga0070689_100010414 3300005340 Bacteria 6625
24 Ga0070668_100101387 3300005347 Bacteria 2281
25 Ga0070669_100033181 3300005353 Bacteria 3732
26 Ga0070669_100037925 3300005353 Bacteria 3497
27 Ga0070675_100014422 3300005354 Bacteria 6231
28 Ga0070675_100086651 3300005354 Bacteria 2618
29 Ga0070675_100229644 3300005354 Bacteria 1618
30 Ga0070671_100005933 3300005355 Bacteria 9736
31 Ga0070671_100027856 3300005355 Bacteria 4651
32 Ga0070671_100129183 3300005355 Bacteria 2127
33 Ga0070671_100207517 3300005355 Bacteria 1662
34 Ga0070674_100010704 3300005356 Bacteria 5558
35 Ga0070674_100015120 3300005356 Bacteria 4811
36 Ga0070674_100153991 3300005356 Bacteria 1737
37 Ga0070673_100004479 3300005364 Bacteria 8836
38 Ga0070667_100022491 3300005367 Bacteria 5228
39 Ga0070667_100061362 3300005367 Bacteria 3183
40 Ga0070667_100173866 3300005367 Bacteria 1902
41 Ga0070703_10030401 3300005406 Bacteria 1627
42 Ga0070709_10051080 3300005434 Bacteria 2594
43 Ga0070714_100039382 3300005435 Bacteria 3979
44 Ga0070711_100050573 3300005439 Bacteria 2850
45 Ga0070700_100119866 3300005441 Bacteria 1761
46 Ga0070708_100051447 3300005445 Bacteria 3650
47 Ga0070708_100087360 3300005445 Bacteria 2833
48 Ga0070708_100099336 3300005445 Bacteria 2662
49 Ga0070708_100194062 3300005445 Bacteria 1900
50 Ga0070663_100057287 3300005455 Bacteria 2795
51 Ga0070678_100033820 3300005456 Bacteria 3554
52 Ga0070678_100077558 3300005456 Bacteria 2507
53 Ga0070662_100039630 3300005457 Bacteria 3351
54 Ga0068867_100015964 3300005459 Bacteria 5331
55 Ga0068867_100100245 3300005459 Bacteria 2211
56 Ga0070706_100000069 3300005467 Bacteria 119582
57 Ga0070706_100000506 3300005467 Bacteria 45748
58 Ga0070706_100051548 3300005467 Bacteria 3798
59 Ga0070706_100123453 3300005467 Bacteria 2414
60 Ga0070706_100144327 3300005467 Bacteria 2223
61 Ga0070707_100000320 3300005468 Bacteria 47282
62 Ga0070707_100023221 3300005468 Bacteria 5866
63 Ga0070707_100029846 3300005468 Bacteria 5190
64 Ga0070707_100047745 3300005468 Bacteria 4099
65 Ga0070707_100285578 3300005468 Bacteria 1603
66 Ga0070698_100000413 3300005471 Bacteria 45525
67 Ga0070698_100002320 3300005471 Bacteria 21056
68 Ga0070698_100021493 3300005471 Bacteria 6759
69 Ga0070698_100061873 3300005471 Bacteria 3777
70 Ga0070699_100093150 3300005518 Bacteria 2636
71 Ga0070679_100027178 3300005530 Bacteria 5628
72 Ga0070684_100000277 3300005535 Bacteria 35509
73 Ga0070684_100069946 3300005535 Bacteria 3087
74 Ga0070684_100283115 3300005535 Bacteria 1519
75 Ga0070697_100029066 3300005536 Bacteria 4430
76 Ga0070697_100050603 3300005536 Bacteria 3373
77 Ga0070697_100056087 3300005536 Bacteria 3204
78 Ga0070697_100056624 3300005536 Bacteria 3189
79 Ga0070697_100063241 3300005536 Bacteria 3022
80 Ga0070697_100101817 3300005536 Bacteria 2386
81 Ga0070672_100015920 3300005543 Bacteria 5371
82 Ga0070672_100027892 3300005543 Bacteria 4217
83 Ga0070672_100041302 3300005543 Bacteria 3545
84 Ga0070665_100010675 3300005548 Bacteria 9297
85 Ga0070665_100024816 3300005548 Bacteria 6040
86 Ga0070665_100075592 3300005548 Bacteria 3375
87 Ga0070665_100197418 3300005548 Bacteria 2013
88 Ga0070665_100203942 3300005548 Bacteria 1978
89 Ga0070665_100268525 3300005548 Bacteria 1707
90 Ga0070664_100027322 3300005564 Bacteria 4742
91 Ga0068852_100022128 3300005616 Bacteria 5092
92 Ga0068858_100040718 3300005842 Bacteria 4309
93 Ga0081455_10000547 3300005937 Bacteria 48774
94 Ga0081455_10001048 3300005937 Bacteria 34800
95 Ga0081455_10012219 3300005937 Bacteria 8574
96 Ga0081455_10041861 3300005937 Bacteria 4024
97 Ga0081455_10061124 3300005937 Bacteria 3172
98 Ga0081455_10076892 3300005937 Bacteria 2748
99 Ga0081540_1000016 3300005983 Bacteria 165370
100 Ga0081539_10000052 3300005985 Bacteria 268240
101 Ga0081539_10000621 3300005985 Bacteria 71799
102 Ga0081539_10016106 3300005985 Bacteria 5370
103 Ga0081539_10031561 3300005985 Unclassified 3262
104 Ga0081539_10051888 3300005985 Bacteria 2308
105 Ga0070717_10003436 3300006028 Bacteria 11330
106 Ga0070717_10004552 3300006028 Bacteria 10032
107 Ga0070717_10017608 3300006028 Bacteria 5562
108 Ga0070717_10056676 3300006028 Bacteria 3238
109 Ga0070717_10058110 3300006028 Bacteria 3198
110 Ga0070717_10244047 3300006028 Bacteria 1585
111 Ga0070712_100005541 3300006175 Bacteria 7812
112 Ga0070712_100010726 3300006175 Bacteria 5789
113 Ga0075362_10000188 3300006177 Bacteria 17086
114 Ga0097621_100041624 3300006237 Bacteria 3699
115 Ga0075370_10020087 3300006353 Unclassified 3646
116 Ga0068871_100038420 3300006358 Bacteria 3823
117 Ga0068871_100097477 3300006358 Bacteria 2458
118 Ga0068871_100231775 3300006358 Bacteria 1603
119 Ga0068865_100012846 3300006881 Bacteria 5280
120 Ga0068865_100027414 3300006881 Bacteria 3764
121 Ga0075436_100028965 3300006914 Bacteria 3809
122 Ga0099794_10045719 3300007265 Bacteria 2095
123 Ga0105240_10000149 3300009093 Bacteria 141753
124 Ga0105247_10093165 3300009101 Bacteria 1915
125 Ga0114129_10016262 3300009147 Bacteria 10589
126 Ga0105249_10016442 3300009553 Bacteria 6565
127 Ga0099796_10029250 3300010159 Bacteria 1776
128 Ga0157369_10098483 3300013105 Bacteria 3118
129 Ga0157374_10025023 3300013296 Bacteria 5356
130 Ga0157374_10034844 3300013296 Bacteria 4602
131 Ga0157374_10220925 3300013296 Unclassified 1859
132 Ga0157374_10232477 3300013296 Bacteria 1811
133 Ga0157374_10288334 3300013296 Bacteria 1622
134 Ga0157378_10064713 3300013297 Bacteria 3272
135 Ga0157378_10101908 3300013297 Bacteria 2622
136 Ga0163162_10014331 3300013306 Bacteria 7746
137 Ga0163162_10031802 3300013306 Bacteria 5236
138 Ga0163162_10128185 3300013306 Bacteria 2645
139 Ga0163162_10282145 3300013306 Bacteria 1793
140 Ga0157372_10206221 3300013307 Bacteria 2278
141 Ga0157375_10002574 3300013308 Bacteria 15753
142 Ga0157375_10010467 3300013308 Bacteria 8162
143 Ga0157375_10094335 3300013308 Unclassified 3061
144 Ga0157376_10006658 3300014969 Bacteria 8180
145 Ga0163161_10146073 3300017792 Bacteria 1794
146 Ga0207697_10000270 3300025315 Bacteria 28614
147 Ga0207697_10002125 3300025315 Bacteria 10396
148 Ga0207697_10003493 3300025315 Bacteria 7762
149 Ga0207697_10006050 3300025315 Bacteria 5532
150 Ga0207697_10021638 3300025315 Bacteria 2633
151 Ga0207697_10043435 3300025315 Bacteria 1848
152 Ga0207653_10030868 3300025885 Bacteria 1730
153 Ga0207692_10036023 3300025898 Bacteria 2409
154 Ga0207688_10000453 3300025901 Bacteria 19458
155 Ga0207680_10066036 3300025903 Bacteria 2223
156 Ga0207680_10153726 3300025903 Bacteria 1536
157 Ga0207647_10047513 3300025904 Bacteria 2669
158 Ga0207645_10006868 3300025907 Bacteria 8123
159 Ga0207645_10038336 3300025907 Bacteria 3073
160 Ga0207645_10101686 3300025907 Bacteria 1855
161 Ga0207684_10000243 3300025910 Bacteria 81628
162 Ga0207684_10000669 3300025910 Bacteria 40655
163 Ga0207684_10008405 3300025910 Bacteria 9178
164 Ga0207684_10008877 3300025910 Bacteria 8925
165 Ga0207684_10042861 3300025910 Bacteria 3837
166 Ga0207684_10045999 3300025910 Bacteria 3703
167 Ga0207684_10097544 3300025910 Unclassified 2509
168 Ga0207684_10099593 3300025910 Bacteria 2482
169 Ga0207654_10142510 3300025911 Bacteria 1530
170 Ga0207695_10000562 3300025913 Bacteria 76120
171 Ga0207693_10006040 3300025915 Bacteria 10032
172 Ga0207693_10010796 3300025915 Bacteria 7415
173 Ga0207693_10232636 3300025915 Bacteria 1447
174 Ga0207663_10036375 3300025916 Bacteria 2962
175 Ga0207662_10035699 3300025918 Bacteria 2904
176 Ga0207662_10068080 3300025918 Bacteria 2149
177 Ga0207657_10028219 3300025919 Bacteria 5123
178 Ga0207646_10001827 3300025922 Bacteria 25695
179 Ga0207646_10003425 3300025922 Bacteria 17922
180 Ga0207646_10028250 3300025922 Bacteria 5108
181 Ga0207646_10143767 3300025922 Bacteria 2149
182 Ga0207681_10047581 3300025923 Bacteria 2891
183 Ga0207681_10060615 3300025923 Bacteria 2598
184 Ga0207681_10179028 3300025923 Unclassified 1613
185 Ga0207650_10142667 3300025925 Bacteria 1884
186 Ga0207659_10025597 3300025926 Bacteria 3967
187 Ga0207659_10074616 3300025926 Bacteria 2486
188 Ga0207659_10164063 3300025926 Bacteria 1747
189 Ga0207700_10271323 3300025928 Bacteria 1456
190 Ga0207644_10008984 3300025931 Bacteria 6548
191 Ga0207644_10049548 3300025931 Bacteria 3008
192 Ga0207644_10076530 3300025931 Bacteria 2462
193 Ga0207706_10007020 3300025933 Bacteria 10411
194 Ga0207706_10068822 3300025933 Bacteria 3114
195 Ga0207669_10020754 3300025937 Bacteria 3452
196 Ga0207665_10059469 3300025939 Bacteria 2586
197 Ga0207691_10000689 3300025940 Bacteria 33393
198 Ga0207691_10045996 3300025940 Bacteria 4012
199 Ga0207691_10128691 3300025940 Bacteria 2238
200 Ga0207691_10218719 3300025940 Bacteria 1652
201 Ga0207689_10186542 3300025942 Bacteria 1711
202 Ga0207661_10052350 3300025944 Bacteria 3261
203 Ga0207651_10046948 3300025960 Bacteria 2908
204 Ga0207668_10094246 3300025972 Bacteria 2207
205 Ga0207658_10115982 3300025986 Bacteria 2126
206 Ga0207658_10192250 3300025986 Bacteria 1697
207 Ga0207658_10192769 3300025986 Bacteria 1695
208 Ga0207703_10015393 3300026035 Bacteria 5966
209 Ga0207678_10004331 3300026067 Bacteria 12738
210 Ga0207678_10201653 3300026067 Bacteria 1701
211 Ga0207708_10021439 3300026075 Bacteria 4873
212 Ga0207702_10034551 3300026078 Bacteria 4227
213 Ga0207641_10079708 3300026088 Bacteria 2839
214 Ga0207683_10003062 3300026121 Bacteria 14615
215 Ga0207683_10020133 3300026121 Bacteria 5703
216 Ga0207683_10110616 3300026121 Bacteria 2460
217 Ga0268266_10026995 3300028379 Bacteria 4885
218 Ga0268266_10070560 3300028379 Bacteria 3027
219 Ga0373944_0023769 3300035089 Bacteria 1791
220 Ga0373943_0031449 3300035170 Bacteria 2518
221 Ga0373943_0038179 3300035170 Bacteria 2308
222 Ga0373943_0055312 3300035170 Bacteria 1965
223 Ga0373955_0021113 3300035172 Bacteria 3282
224 Ga0373947_0031407 3300035725 Bacteria 3126
225 Ga0373937_0032482 3300036401 Bacteria 4734
226 Ga0373925_0088264 3300037068 Bacteria 2368
227 Ga0395899_0075147 3300037312 Bacteria 2468
228 Ga0395900_0006583 3300037418 Bacteria 12090
229 Ga0395900_0008119 3300037418 Bacteria 10809
230 Ga0395898_0003094 3300037466 Bacteria 18828
231 Ga0395898_0013808 3300037466 Bacteria 8303
232 Ga0395905_0006134 3300037471 Bacteria 12134
233 Ga0436364_1043169 3300037853 Unclassified 4151
234 Ga0395901_0001836 3300038443 Bacteria 21943
235 Ga0436365_0920385 3300039437 Bacteria 2143
236 Ga0436365_1082830 3300039437 Bacteria 23089
237 Ga0436360_0941997 3300039438 Bacteria 2237
238 Ga0436361_0016156 3300039447 Bacteria 1693
239 Ga0436361_0289960 3300039447 Unclassified 4295
240 Ga0436361_0314526 3300039447 Bacteria 29245
241 Ga0436363_1714044 3300039450 Bacteria 27583
242 Ga0466967_0052815 3300045976 Bacteria 3570
243 Ga0495592_0007170 3300046454 Bacteria 8350
244 Ga0495629_0066034 3300046459 Bacteria 2525
245 Ga0495651_0106590 3300046462 Bacteria 2077
246 Ga0495664_0057243 3300046477 Bacteria 2319
247 Ga0495584_0136012 3300046491 Unclassified 1248
248 Ga0495628_0015019 3300046516 Bacteria 6471
249 Ga0495587_0022243 3300046536 Bacteria 3904
250 Ga0495645_0016161 3300046543 Bacteria 5321
251 Ga0495667_0077001 3300046559 Bacteria 2170
252 Ga0495674_0038180 3300047319 Bacteria 4312
253 Ga0495675_0112305 3300047444 Bacteria 1700
254 Ga0495684_0083451 3300047471 Bacteria 2423
255 Ga0495602_0113528 3300048088 Bacteria 2195
256 Ga0496105_0199200 3300048908 Bacteria 1635
257 Ga0496106_0021818 3300048909 Bacteria 4756
258 Ga0496106_0157376 3300048909 Bacteria 1795
259 Ga0496106_0186088 3300048909 Bacteria 1650
260 Ga0496109_0065828 3300048912 Bacteria 3318
261 Ga0496112_0122694 3300048915 Bacteria 2569
262 Ga0496112_0165046 3300048915 Bacteria 2181
263 Ga0496113_0002003 3300048916 Bacteria 11677
264 Ga0496115_0019128 3300048918 Bacteria 5268
265 Ga0496115_0167629 3300048918 Bacteria 1816
266 nmdc:mga03683_120_c1 3300050489 Bacteria 25836
267 nmdc:mga0k408_22863_c1 3300050493 Unclassified 3523
268 nmdc:mga07m45_1048_c2 3300050496 Unclassified 3607
269 nmdc:mga0n895_143881_c1 3300050512 Bacteria 2413
270 nmdc:mga0n895_36023_c1 3300050512 Bacteria 4775
271 Ga0495601_0046518 3300053077 Bacteria 2731
272 Ga0500555_000307 3300053103 Bacteria 21087
273 Ga0500556_0000205 3300053104 Bacteria 48547
274 Ga0500642_0001572 3300053130 Bacteria 6578
275 Ga0075363_100044724
276 JGI25406J46586_10000020
277 JGI25405J52794_10014191
278 Ga0065704_10019798
279 Ga0065704_10108537
280 Ga0065712_10023592
281 Ga0065712_10024310
282 Ga0065715_10000456
283 Ga0065715_10021284
284 Ga0065707_10003424
285 Ga0065707_10010367
286 Ga0065707_10022391
287 Ga0070683_100016490
288 Ga0070670_100019714
289 Ga0070670_100071643
290 Ga0070666_10006322
291 Ga0070666_10010951
292 Ga0070666_10011028
293 Ga0070680_100191666
294 Ga0068868_100084259
295 Ga0068868_100140609
296 Ga0068868_100156636
297 Ga0070689_100010414
298 Ga0070668_100101387
299 Ga0070669_100033181
300 Ga0070669_100037925
301 Ga0070675_100014422
302 Ga0070675_100086651
303 Ga0070675_100229644
304 Ga0070671_100005933
305 Ga0070671_100027856
306 Ga0070671_100129183
307 Ga0070671_100207517
308 Ga0070674_100010704
309 Ga0070674_100015120
310 Ga0070674_100153991
311 Ga0070673_100004479
312 Ga0070667_100022491
313 Ga0070667_100061362
314 Ga0070667_100173866
315 Ga0070703_10030401
316 Ga0070709_10051080
317 Ga0070714_100039382
318 Ga0070711_100050573
319 Ga0070700_100119866
320 Ga0070708_100051447
321 Ga0070708_100087360
322 Ga0070708_100099336
323 Ga0070708_100194062
324 Ga0070663_100057287
325 Ga0070678_100033820
326 Ga0070678_100077558
327 Ga0070662_100039630
328 Ga0068867_100015964
329 Ga0068867_100100245
330 Ga0070706_100000069
331 Ga0070706_100000506
332 Ga0070706_100051548
333 Ga0070706_100123453
334 Ga0070706_100144327
335 Ga0070707_100000320
336 Ga0070707_100023221
337 Ga0070707_100029846
338 Ga0070707_100047745
339 Ga0070707_100285578
340 Ga0070698_100000413
341 Ga0070698_100002320
342 Ga0070698_100021493
343 Ga0070698_100061873
344 Ga0070699_100093150
345 Ga0070679_100027178
346 Ga0070684_100000277
347 Ga0070684_100069946
348 Ga0070684_100283115
349 Ga0070697_100029066
350 Ga0070697_100050603
351 Ga0070697_100056087
352 Ga0070697_100056624
353 Ga0070697_100063241
354 Ga0070697_100101817
355 Ga0070672_100015920
356 Ga0070672_100027892
357 Ga0070672_100041302
358 Ga0070665_100010675
359 Ga0070665_100024816
360 Ga0070665_100075592
361 Ga0070665_100197418
362 Ga0070665_100203942
363 Ga0070665_100268525
364 Ga0070664_100027322
365 Ga0068852_100022128
366 Ga0068858_100040718
367 Ga0081455_10000547
368 Ga0081455_10001048
369 Ga0081455_10012219
370 Ga0081455_10041861
371 Ga0081455_10061124
372 Ga0081455_10076892
373 Ga0081540_1000016
374 Ga0081539_10000052
375 Ga0081539_10000621
376 Ga0081539_10016106
377 Ga0081539_10031561
378 Ga0081539_10051888
379 Ga0070717_10003436
380 Ga0070717_10004552
381 Ga0070717_10017608
382 Ga0070717_10056676
383 Ga0070717_10058110
384 Ga0070717_10244047
385 Ga0070712_100005541
386 Ga0070712_100010726
387 Ga0075362_10000188
388 Ga0097621_100041624
389 Ga0075370_10020087
390 Ga0068871_100038420
391 Ga0068871_100097477
392 Ga0068871_100231775
393 Ga0068865_100012846
394 Ga0068865_100027414
395 Ga0075436_100028965
396 Ga0099794_10045719
397 Ga0105240_10000149
398 Ga0105247_10093165
399 Ga0114129_10016262
400 Ga0105249_10016442
401 Ga0099796_10029250
402 Ga0157369_10098483
403 Ga0157374_10025023
404 Ga0157374_10034844
405 Ga0157374_10220925
406 Ga0157374_10232477
407 Ga0157374_10288334
408 Ga0157378_10064713
409 Ga0157378_10101908
410 Ga0163162_10014331
411 Ga0163162_10031802
412 Ga0163162_10128185
413 Ga0163162_10282145
414 Ga0157372_10206221
415 Ga0157375_10002574
416 Ga0157375_10010467
417 Ga0157375_10094335
418 Ga0157376_10006658
419 Ga0163161_10146073
420 Ga0207697_10000270
421 Ga0207697_10002125
422 Ga0207697_10003493
423 Ga0207697_10006050
424 Ga0207697_10021638
425 Ga0207697_10043435
426 Ga0207653_10030868
427 Ga0207692_10036023
428 Ga0207688_10000453
429 Ga0207680_10066036
430 Ga0207680_10153726
431 Ga0207647_10047513
432 Ga0207645_10006868
433 Ga0207645_10038336
434 Ga0207645_10101686
435 Ga0207684_10000243
436 Ga0207684_10000669
437 Ga0207684_10008405
438 Ga0207684_10008877
439 Ga0207684_10042861
440 Ga0207684_10045999
441 Ga0207684_10097544
442 Ga0207684_10099593
443 Ga0207654_10142510
444 Ga0207695_10000562
445 Ga0207693_10006040
446 Ga0207693_10010796
447 Ga0207693_10232636
448 Ga0207663_10036375
449 Ga0207662_10035699
450 Ga0207662_10068080
451 Ga0207657_10028219
452 Ga0207646_10001827
453 Ga0207646_10003425
454 Ga0207646_10028250
455 Ga0207646_10143767
456 Ga0207681_10047581
457 Ga0207681_10060615
458 Ga0207681_10179028
459 Ga0207650_10142667
460 Ga0207659_10025597
461 Ga0207659_10074616
462 Ga0207659_10164063
463 Ga0207700_10271323
464 Ga0207644_10008984
465 Ga0207644_10049548
466 Ga0207644_10076530
467 Ga0207706_10007020
468 Ga0207706_10068822
469 Ga0207669_10020754
470 Ga0207665_10059469
471 Ga0207691_10000689
472 Ga0207691_10045996
473 Ga0207691_10128691
474 Ga0207691_10218719
475 Ga0207689_10186542
476 Ga0207661_10052350
477 Ga0207651_10046948
478 Ga0207668_10094246
479 Ga0207658_10115982
480 Ga0207658_10192250
481 Ga0207658_10192769
482 Ga0207703_10015393
483 Ga0207678_10004331
484 Ga0207678_10201653
485 Ga0207708_10021439
486 Ga0207702_10034551
487 Ga0207641_10079708
488 Ga0207683_10003062
489 Ga0207683_10020133
490 Ga0207683_10110616
491 Ga0268266_10026995
492 Ga0268266_10070560
493 Ga0373944_0023769
494 Ga0373943_0031449
495 Ga0373943_0038179
496 Ga0373943_0055312
497 Ga0373955_0021113
498 Ga0373947_0031407
499 Ga0373937_0032482
500 Ga0373925_0088264
501 Ga0395899_0075147
502 Ga0395900_0006583
503 Ga0395900_0008119
504 Ga0395898_0003094
505 Ga0395898_0013808
506 Ga0395905_0006134
507 Ga0436364_1043169
508 Ga0395901_0001836
509 Ga0436365_0920385
510 Ga0436365_1082830
511 Ga0436360_0941997
512 Ga0436361_0016156
513 Ga0436361_0289960
514 Ga0436361_0314526
515 Ga0436363_1714044
516 Ga0466967_0052815
517 Ga0495592_0007170
518 Ga0495629_0066034
519 Ga0495651_0106590
520 Ga0495664_0057243
521 Ga0495584_0136012
522 Ga0495628_0015019
523 Ga0495587_0022243
524 Ga0495645_0016161
525 Ga0495667_0077001
526 Ga0495674_0038180
527 Ga0495675_0112305
528 Ga0495684_0083451
529 Ga0495602_0113528
530 Ga0496105_0199200
531 Ga0496106_0021818
532 Ga0496106_0157376
533 Ga0496106_0186088
534 Ga0496109_0065828
535 Ga0496112_0122694
536 Ga0496112_0165046
537 Ga0496113_0002003
538 Ga0496115_0019128
539 Ga0496115_0167629
540 nmdc:mga03683_120_c1
541 nmdc:mga0k408_22863_c1
542 nmdc:mga07m45_1048_c2
543 nmdc:mga0n895_143881_c1
544 nmdc:mga0n895_36023_c1
545 Ga0495601_0046518
546 Ga0500555_000307
547 Ga0500556_0000205
548 Ga0500642_0001572

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00749

tRNA-synt_1c

tRNA synthetases class I (E and Q), catalytic domain

45

152

0.98

PF00749

tRNA-synt_1c

tRNA synthetases class I (E and Q), catalytic domain

148

318

0.95

PF19269

Anticodon_2

Anticodon binding domain

331

475

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cv1-assembly1.cif.gz_A glutamyl-trna synthetase from thermus thermophilus in complex with trna(glu), atp, and an analog of l-glutamate: a quaternary complex 0.9383 5 437
1g59-assembly1.cif.gz_A glutamyl-trna synthetase complexed with trna(glu). 0.9379 5 437
3pnv-assembly1.cif.gz_A v369m mutant of glutamyl-trna synthetase from mycobacterium tuberculosis 0.9305 5 435
3pny-assembly1.cif.gz_B structure of glutamyl-trna synthetase from mycobacterium tuberculosis in space group p21 0.919 1 435
2cv1-assembly1.cif.gz_A glutamyl-trna synthetase from thermus thermophilus in complex with trna(glu), atp, and an analog of l-glutamate: a quaternary complex 0.9079 5 437
ID Description Score Start End Superfamily
3akzC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9681 5 205 3.40.50.620
3akzC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9526 5 205 3.40.50.620
af_Q9FEA2_46_378_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9516 3 286 3.40.50.620
1glnA05 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9477 338 435 1.10.10.350
3pnvA03 Mainly Alpha;Orthogonal Bundle;Glutamyl-tRNA Synthetase; domain 2;Glutamyl-trna Synthetase; Domain 2 0.9444 206 289 1.10.1160.10
ID Description Score Start End GO Terms
AF-A0A2V6NX05-F1-model_v4 Glutamate--tRNA ligase 0.9879 1 225 GO:0004818
GO:0005524
GO:0005829
GO:0006424
GO:0008270
AF-A0A2V6NX05-F1-model_v4 Glutamate--tRNA ligase 0.9793 1 225 GO:0004818
GO:0005524
GO:0005829
GO:0006424
GO:0008270
AF-A0A031M9B7-F1-model_v4 Glutamyl-tRNA synthetase (tRNA synthetases class I (E and Q), catalytic domain) 0.9774 4 97 GO:0004818
GO:0005524
GO:0005829
GO:0006424
AF-A0A512ME46-F1-model_v4 Glutamate--tRNA ligase (EC 6.1.1.17) (Glutamyl-tRNA synthetase) (GluRS) 0.9725 5 438 GO:0000049
GO:0004818
GO:0005524
GO:0005829
GO:0006424
GO:0008270
AF-A0A2D5WI72-F1-model_v4 Glutamate--tRNA ligase 0.9713 311 439 GO:0000049
GO:0004818
GO:0005524
GO:0005829
GO:0006424

Map