F379619

General Info

Members Datasets Scaffolds Average Seq Length
274 177 548 304

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10001955|Ga0081538_1000195511
Length 342
Sequence VTGPDLTRLVECVPNVSEGRRPEVVEEIVAAFAGAAPRVLVLDVSSDPDHHRSVITLMGPGPALVEAAVAGAEACARLIDLNQHRGVHPRMGALDVLPFVPFGAETRLRGGDDPDLDCVALAERAGRRIADEAGVPVYLYGAAARHPGWAALPAVRGRGFEALRDALAAGDEAGPPDPPAPDFGGPGLHPTAGATAAGAREVLIAYNVELADADLELARRIAAAVRERDGGLPAVRAMGVPLVSRGRGGPGDRRGGPPVDVQVSMNLLDYRVTPPAVAYAAVAALAERAGARVEASEVVGLVPAAALDGVDPADLRLRGFTPGLLLEDRLLQALTTVKELPR

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
103 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
104 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
105 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
106 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
107 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
108 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
109 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
110 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
111 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
112 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
113 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
114 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
117 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
118 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
122 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
123 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.92
Rhizosphere 97.08
Stem 0
Stem Tuber 0
Unclassified 8.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10001955 3300005981 Bacteria 20645
2 JGI25406J46586_10028108 3300003203 Bacteria 2146
3 Ga0070658_10032200 3300005327 Bacteria 4216
4 Ga0070676_10003438 3300005328 Bacteria 8251
5 Ga0070690_100095838 3300005330 Unclassified 1960
6 Ga0070691_10092391 3300005341 Bacteria 1493
7 Ga0070687_100094561 3300005343 Unclassified 1660
8 Ga0070661_100110637 3300005344 Bacteria 2051
9 Ga0070669_100157157 3300005353 Bacteria 1764
10 Ga0070671_100001351 3300005355 Bacteria 18370
11 Ga0070659_100120574 3300005366 Bacteria 2124
12 Ga0070659_100461123 3300005366 Bacteria 1079
13 Ga0070714_100000015 3300005435 Bacteria 208308
14 Ga0070701_10040263 3300005438 Bacteria 2375
15 Ga0070705_100044559 3300005440 Bacteria 2548
16 Ga0070700_100006919 3300005441 Bacteria 6090
17 Ga0070700_100057904 3300005441 Bacteria 2433
18 Ga0070662_100044024 3300005457 Bacteria 3197
19 Ga0070662_100084071 3300005457 Bacteria 2377
20 Ga0070681_10055607 3300005458 Bacteria 3940
21 Ga0070706_100041575 3300005467 Bacteria 4243
22 Ga0070707_100003931 3300005468 Bacteria 13989
23 Ga0070698_100005724 3300005471 Bacteria 13593
24 Ga0070698_100322460 3300005471 Bacteria 1475
25 Ga0070699_100035110 3300005518 Bacteria 4333
26 Ga0070699_100067933 3300005518 Bacteria 3095
27 Ga0070699_100171533 3300005518 Bacteria 1922
28 Ga0070699_100280570 3300005518 Bacteria 1492
29 Ga0070679_100348158 3300005530 Bacteria 1429
30 Ga0070697_100008177 3300005536 Bacteria 8166
31 Ga0070697_100019595 3300005536 Bacteria 5344
32 Ga0070686_100002392 3300005544 Bacteria 10341
33 Ga0070695_100008365 3300005545 Bacteria 6138
34 Ga0070696_100166324 3300005546 Bacteria 1628
35 Ga0070665_100003536 3300005548 Bacteria 16613
36 Ga0070704_100005348 3300005549 Bacteria 7478
37 Ga0068854_100009562 3300005578 Bacteria 6257
38 Ga0068854_100103645 3300005578 Bacteria 2136
39 Ga0068866_10051398 3300005718 Bacteria 2098
40 Ga0068861_100002477 3300005719 Bacteria 12031
41 Ga0068851_10124389 3300005834 Bacteria 1389
42 Ga0068863_100056556 3300005841 Bacteria 3714
43 Ga0068858_100010207 3300005842 Bacteria 8911
44 Ga0068860_100677603 3300005843 Bacteria 1040
45 Ga0068860_100760682 3300005843 Unclassified 981
46 Ga0081538_10014326 3300005981 Bacteria 6214
47 Ga0081538_10075944 3300005981 Bacteria 1820
48 Ga0081538_10082658 3300005981 Bacteria 1701
49 Ga0081539_10022352 3300005985 Bacteria 4189
50 Ga0081539_10052938 3300005985 Bacteria 2276
51 Ga0070717_10005695 3300006028 Bacteria 9110
52 Ga0097621_100015549 3300006237 Bacteria 5729
53 Ga0068871_100172839 3300006358 Bacteria 1853
54 Ga0068871_100403953 3300006358 Bacteria 1217
55 Ga0068871_100542476 3300006358 Bacteria 1052
56 Ga0075428_100006015 3300006844 Bacteria 13480
57 Ga0075428_100024910 3300006844 Bacteria 6618
58 Ga0075428_100160752 3300006844 Bacteria 2438
59 Ga0075430_100030597 3300006846 Bacteria 4572
60 Ga0075430_100037509 3300006846 Bacteria 4107
61 Ga0075431_100017923 3300006847 Bacteria 7202
62 Ga0075431_100032055 3300006847 Bacteria 5416
63 Ga0075433_10030132 3300006852 Bacteria 4628
64 Ga0075433_10292923 3300006852 Bacteria 1441
65 Ga0075434_100005226 3300006871 Bacteria 11793
66 Ga0075434_100008797 3300006871 Bacteria 9399
67 Ga0075434_100034262 3300006871 Bacteria 5014
68 Ga0075434_100178579 3300006871 Bacteria 2143
69 Ga0075434_100199672 3300006871 Bacteria 2019
70 Ga0075429_100284841 3300006880 Unclassified 1447
71 Ga0068865_100073200 3300006881 Bacteria 2436
72 Ga0075436_100003408 3300006914 Bacteria 10902
73 Ga0075435_100000436 3300007076 Bacteria 25536
74 Ga0075435_100000498 3300007076 Bacteria 23940
75 Ga0075435_100002844 3300007076 Bacteria 11585
76 Ga0075435_100006217 3300007076 Bacteria 8427
77 Ga0075435_100112364 3300007076 Bacteria 2267
78 Ga0075435_100246343 3300007076 Bacteria 1521
79 Ga0105240_10259330 3300009093 Unclassified 2006
80 Ga0111539_10160993 3300009094 Bacteria 2625
81 Ga0111539_10691879 3300009094 Unclassified 1187
82 Ga0105245_10043473 3300009098 Bacteria 4007
83 Ga0114129_10000632 3300009147 Bacteria 43859
84 Ga0114129_10002823 3300009147 Bacteria 24241
85 Ga0114129_10030750 3300009147 Bacteria 7594
86 Ga0114129_10042598 3300009147 Bacteria 6391
87 Ga0114129_10068701 3300009147 Bacteria 4940
88 Ga0114129_10104291 3300009147 Bacteria 3918
89 Ga0105243_10042048 3300009148 Bacteria 3576
90 Ga0105243_10051726 3300009148 Bacteria 3250
91 Ga0105241_10297225 3300009174 Bacteria 1384
92 Ga0105242_10004725 3300009176 Bacteria 10547
93 Ga0105242_10119102 3300009176 Bacteria 2263
94 Ga0105242_10143544 3300009176 Bacteria 2074
95 Ga0105242_10291421 3300009176 Bacteria 1486
96 Ga0105248_10054577 3300009177 Bacteria 4481
97 Ga0105248_10238966 3300009177 Bacteria 2045
98 Ga0105238_10194101 3300009551 Bacteria 2006
99 Ga0105249_10101532 3300009553 Bacteria 2705
100 Ga0105249_10353443 3300009553 Bacteria 1489
101 Ga0157369_10364398 3300013105 Bacteria 1500
102 Ga0163162_10588615 3300013306 Bacteria 1239
103 Ga0157375_10150427 3300013308 Unclassified 2463
104 Ga0157380_10121820 3300014326 Bacteria 2211
105 Ga0157379_10009155 3300014968 Bacteria 8624
106 Ga0157379_10330033 3300014968 Bacteria 1394
107 Ga0157376_10013555 3300014969 Bacteria 6089
108 Ga0157376_10150794 3300014969 Bacteria 2096
109 Ga0207642_10045157 3300025899 Bacteria 1954
110 Ga0207645_10006602 3300025907 Bacteria 8294
111 Ga0207684_10001259 3300025910 Bacteria 27986
112 Ga0207654_10235872 3300025911 Bacteria 1220
113 Ga0207707_10041276 3300025912 Bacteria 4030
114 Ga0207662_10112838 3300025918 Bacteria 1696
115 Ga0207646_10010580 3300025922 Bacteria 8995
116 Ga0207681_10168190 3300025923 Bacteria 1659
117 Ga0207681_10405514 3300025923 Bacteria 1102
118 Ga0207681_10458444 3300025923 Unclassified 1038
119 Ga0207694_10130602 3300025924 Bacteria 2013
120 Ga0207664_10000022 3300025929 Bacteria 215712
121 Ga0207644_10116023 3300025931 Bacteria 2031
122 Ga0207706_10055865 3300025933 Bacteria 3481
123 Ga0207686_10225671 3300025934 Bacteria 1355
124 Ga0207686_10249671 3300025934 Bacteria 1295
125 Ga0207709_10050161 3300025935 Bacteria 2551
126 Ga0207709_10063904 3300025935 Bacteria 2309
127 Ga0207670_10124958 3300025936 Bacteria 1876
128 Ga0207704_10044235 3300025938 Bacteria 2636
129 Ga0207711_10124083 3300025941 Bacteria 2308
130 Ga0207711_10139777 3300025941 Bacteria 2178
131 Ga0207667_10216853 3300025949 Bacteria 1961
132 Ga0207640_10115919 3300025981 Bacteria 1909
133 Ga0207703_10009929 3300026035 Bacteria 7468
134 Ga0207639_10400753 3300026041 Bacteria 1236
135 Ga0207708_10017850 3300026075 Bacteria 5340
136 Ga0207648_10143100 3300026089 Bacteria 2108
137 Ga0207648_10151191 3300026089 Unclassified 2048
138 Ga0207675_100001895 3300026118 Bacteria 20915
139 Ga0207675_100003256 3300026118 Bacteria 15906
140 Ga0207675_100072975 3300026118 Bacteria 3210
141 Ga0207675_100234582 3300026118 Bacteria 1771
142 Ga0209971_1006931 3300027682 Unclassified 2687
143 Ga0207428_10378513 3300027907 Unclassified 1039
144 Ga0307408_100113651 3300031548 Bacteria 2084
145 Ga0307405_10029655 3300031731 Bacteria 3199
146 Ga0307413_10106931 3300031824 Bacteria 1863
147 Ga0307410_10026222 3300031852 Bacteria 3666
148 Ga0307410_10428142 3300031852 Bacteria 1075
149 Ga0307406_10039242 3300031901 Bacteria 2936
150 Ga0307407_10045395 3300031903 Bacteria 2482
151 Ga0307407_10144321 3300031903 Bacteria 1539
152 Ga0307409_100014157 3300031995 Bacteria 5172
153 Ga0307409_100092744 3300031995 Bacteria 2479
154 Ga0307409_100282608 3300031995 Bacteria 1535
155 Ga0307416_100002626 3300032002 Bacteria 10392
156 Ga0307416_100009102 3300032002 Bacteria 6470
157 Ga0307416_100122248 3300032002 Bacteria 2323
158 Ga0307414_10012803 3300032004 Bacteria 4976
159 Ga0307414_10066397 3300032004 Bacteria 2579
160 Ga0307411_10138623 3300032005 Bacteria 1790
161 Ga0307415_100032088 3300032126 Bacteria 3392
162 Ga0307415_100047446 3300032126 Bacteria 2891
163 Ga0307415_100235272 3300032126 Bacteria 1478
164 Ga0373930_0017947 3300034816 Bacteria 1355
165 Ga0373948_0004417 3300034817 Unclassified 2223
166 Ga0373958_0000501 3300034819 Bacteria 4851
167 Ga0373959_0001933 3300034820 Unclassified 3305
168 Ga0373938_0020210 3300034957 Bacteria 1339
169 Ga0373928_0002205 3300035084 Bacteria 3792
170 Ga0373940_0017784 3300035088 Bacteria 1775
171 Ga0373949_0003243 3300035090 Bacteria 3929
172 Ga0373951_0027307 3300035091 Bacteria 1332
173 Ga0373952_0006583 3300035092 Bacteria 2152
174 Ga0373932_0003258 3300035112 Bacteria 3929
175 Ga0373939_0000450 3300035114 Bacteria 10389
176 Ga0373941_0000193 3300035115 Bacteria 11618
177 Ga0373955_0134984 3300035172 Bacteria 1443
178 Ga0373942_0005566 3300035207 Unclassified 2918
179 Ga0373961_0000257 3300035241 Bacteria 24679
180 Ga0373962_0001191 3300035242 Bacteria 6086
181 Ga0373937_0039300 3300036401 Bacteria 4312
182 Ga0373937_0300216 3300036401 Unclassified 1518
183 Ga0373925_0559364 3300037068 Unclassified 941
184 Ga0439450_012539 3300042008 Bacteria 1684
185 Ga0439435_0015662 3300042436 Bacteria 1890
186 Ga0439460_0012871 3300042461 Bacteria 2179
187 Ga0439460_0019820 3300042461 Bacteria 1825
188 Ga0495653_0094429 3300046463 Bacteria 2179
189 Ga0495662_0130618 3300046476 Bacteria 1235
190 Ga0495608_0047825 3300046511 Bacteria 2843
191 Ga0495630_0086343 3300046517 Bacteria 2370
192 Ga0495631_0031533 3300046518 Bacteria 2396
193 Ga0495586_0088618 3300046535 Bacteria 1707
194 Ga0495645_0038762 3300046543 Bacteria 3475
195 Ga0495599_0075412 3300046678 Bacteria 2106
196 Ga0495674_0035786 3300047319 Bacteria 4476
197 Ga0495680_0089390 3300047322 Bacteria 2312
198 Ga0496104_0005281 3300048907 Bacteria 11291
199 Ga0496105_0080037 3300048908 Bacteria 2698
200 Ga0496106_0256262 3300048909 Unclassified 1399
201 Ga0496107_0164990 3300048910 Bacteria 1642
202 Ga0496114_0003224 3300048917 Bacteria 12511
203 Ga0496114_0015463 3300048917 Bacteria 6136
204 Ga0496114_0037751 3300048917 Bacteria 3996
205 Ga0496115_0028188 3300048918 Bacteria 4400
206 Ga0501031_0005031 3300049568 Bacteria 8594
207 Ga0501031_0028795 3300049568 Bacteria 3620
208 Ga0501031_0149106 3300049568 Unclassified 1528
209 Ga0501033_0059178 3300049570 Bacteria 2829
210 Ga0501036_0000879 3300049572 Bacteria 22418
211 Ga0501036_0005311 3300049572 Bacteria 10425
212 Ga0501037_0017794 3300049573 Bacteria 5231
213 Ga0501037_0150571 3300049573 Bacteria 1663
214 Ga0501038_0006087 3300049574 Bacteria 11164
215 Ga0501039_0001366 3300049575 Bacteria 17904
216 Ga0501039_0001932 3300049575 Bacteria 15359
217 Ga0501041_0000036 3300049577 Bacteria 44442
218 Ga0501042_0000460 3300049578 Bacteria 20994
219 Ga0501042_0000857 3300049578 Bacteria 16960
220 Ga0501043_0008092 3300049579 Bacteria 8297
221 Ga0501046_0000353 3300049580 Bacteria 46190
222 Ga0501048_0000036 3300049582 Bacteria 64488
223 Ga0501069_0042241 3300049585 Bacteria 2522
224 Ga0501071_0002729 3300049587 Bacteria 10822
225 Ga0501071_0004979 3300049587 Bacteria 8487
226 Ga0501074_0009386 3300049590 Bacteria 7109
227 Ga0501074_0011924 3300049590 Bacteria 6320
228 Ga0501075_0000081 3300049591 Bacteria 43290
229 Ga0501075_0000649 3300049591 Bacteria 21308
230 Ga0501075_0095134 3300049591 Bacteria 2261
231 Ga0501076_0001473 3300049592 Bacteria 15777
232 Ga0501076_0008135 3300049592 Bacteria 7670
233 Ga0501077_0004406 3300049593 Bacteria 8542
234 Ga0501077_0005055 3300049593 Bacteria 8000
235 Ga0501079_0000052 3300049741 Bacteria 51253
236 Ga0501079_0001117 3300049741 Bacteria 18679
237 Ga0501081_0000200 3300049743 Bacteria 29149
238 Ga0501081_0004161 3300049743 Bacteria 9279
239 Ga0501083_0049236 3300049744 Bacteria 2841
240 Ga0501044_0100369 3300049823 Bacteria 2913
241 Ga0501045_0000065 3300049824 Bacteria 48521
242 Ga0501045_0001029 3300049824 Bacteria 18327
243 nmdc:mga05p37_320519_c1 3300050507 Bacteria 1835
244 nmdc:mga05p37_3611_c1 3300050507 Bacteria 18074
245 nmdc:mga05p37_452704_c1 3300050507 Bacteria 1485
246 nmdc:mga05p37_9359_c1 3300050507 Bacteria 11594
247 nmdc:mga09592_185873_c1 3300050508 Unclassified 1798
248 nmdc:mga09592_260481_c1 3300050508 Unclassified 1504
249 nmdc:mga0qj67_28570_c1 3300050509 Bacteria 4330
250 nmdc:mga0qj67_29288_c1 3300050509 Bacteria 4277
251 nmdc:mga06r32_40703_c1 3300050510 Bacteria 4412
252 nmdc:mga08y16_21048_c1 3300050511 Bacteria 6886
253 nmdc:mga0n895_150249_c1 3300050512 Bacteria 2359
254 nmdc:mga0n895_214039_c1 3300050512 Unclassified 1957
255 nmdc:mga0n895_33031_c1 3300050512 Bacteria 4971
256 nmdc:mga0n895_34223_c1 3300050512 Bacteria 4889
257 nmdc:mga0n895_57_c1 3300050512 Bacteria 65730
258 nmdc:mga0rr50_1527_c1 3300050513 Bacteria 12765
259 nmdc:mga0rr50_220157_c1 3300050513 Bacteria 1567
260 nmdc:mga0rr50_35074_c1 3300050513 Bacteria 3600
261 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
262 nmdc:mga08x19_104635_c1 3300050514 Bacteria 1881
263 nmdc:mga08x19_1420_c1 3300050514 Bacteria 14793
264 nmdc:mga0a205_32203_c1 3300050515 Bacteria 5027
265 nmdc:mga0a205_38056_c1 3300050515 Bacteria 4627
266 Ga0495601_0081739 3300053077 Bacteria 2074
267 Ga0495595_0023748 3300053084 Unclassified 2703
268 Ga0495619_0074504 3300053085 Bacteria 2277
269 Ga0495619_0092793 3300053085 Bacteria 2046
270 Ga0501084_0000641 3300054114 Bacteria 26596
271 Ga0590077_000028 3300059426 Bacteria 33664
272 Ga0501082_0001519 3300060353 Bacteria 20438
273 Ga0501082_0123010 3300060353 Unclassified 2250
274 Ga0530510_0004655 3300061734 Bacteria 9490
275 Ga0081538_10001955
276 JGI25406J46586_10028108
277 Ga0070658_10032200
278 Ga0070676_10003438
279 Ga0070690_100095838
280 Ga0070691_10092391
281 Ga0070687_100094561
282 Ga0070661_100110637
283 Ga0070669_100157157
284 Ga0070671_100001351
285 Ga0070659_100120574
286 Ga0070659_100461123
287 Ga0070714_100000015
288 Ga0070701_10040263
289 Ga0070705_100044559
290 Ga0070700_100006919
291 Ga0070700_100057904
292 Ga0070662_100044024
293 Ga0070662_100084071
294 Ga0070681_10055607
295 Ga0070706_100041575
296 Ga0070707_100003931
297 Ga0070698_100005724
298 Ga0070698_100322460
299 Ga0070699_100035110
300 Ga0070699_100067933
301 Ga0070699_100171533
302 Ga0070699_100280570
303 Ga0070679_100348158
304 Ga0070697_100008177
305 Ga0070697_100019595
306 Ga0070686_100002392
307 Ga0070695_100008365
308 Ga0070696_100166324
309 Ga0070665_100003536
310 Ga0070704_100005348
311 Ga0068854_100009562
312 Ga0068854_100103645
313 Ga0068866_10051398
314 Ga0068861_100002477
315 Ga0068851_10124389
316 Ga0068863_100056556
317 Ga0068858_100010207
318 Ga0068860_100677603
319 Ga0068860_100760682
320 Ga0081538_10014326
321 Ga0081538_10075944
322 Ga0081538_10082658
323 Ga0081539_10022352
324 Ga0081539_10052938
325 Ga0070717_10005695
326 Ga0097621_100015549
327 Ga0068871_100172839
328 Ga0068871_100403953
329 Ga0068871_100542476
330 Ga0075428_100006015
331 Ga0075428_100024910
332 Ga0075428_100160752
333 Ga0075430_100030597
334 Ga0075430_100037509
335 Ga0075431_100017923
336 Ga0075431_100032055
337 Ga0075433_10030132
338 Ga0075433_10292923
339 Ga0075434_100005226
340 Ga0075434_100008797
341 Ga0075434_100034262
342 Ga0075434_100178579
343 Ga0075434_100199672
344 Ga0075429_100284841
345 Ga0068865_100073200
346 Ga0075436_100003408
347 Ga0075435_100000436
348 Ga0075435_100000498
349 Ga0075435_100002844
350 Ga0075435_100006217
351 Ga0075435_100112364
352 Ga0075435_100246343
353 Ga0105240_10259330
354 Ga0111539_10160993
355 Ga0111539_10691879
356 Ga0105245_10043473
357 Ga0114129_10000632
358 Ga0114129_10002823
359 Ga0114129_10030750
360 Ga0114129_10042598
361 Ga0114129_10068701
362 Ga0114129_10104291
363 Ga0105243_10042048
364 Ga0105243_10051726
365 Ga0105241_10297225
366 Ga0105242_10004725
367 Ga0105242_10119102
368 Ga0105242_10143544
369 Ga0105242_10291421
370 Ga0105248_10054577
371 Ga0105248_10238966
372 Ga0105238_10194101
373 Ga0105249_10101532
374 Ga0105249_10353443
375 Ga0157369_10364398
376 Ga0163162_10588615
377 Ga0157375_10150427
378 Ga0157380_10121820
379 Ga0157379_10009155
380 Ga0157379_10330033
381 Ga0157376_10013555
382 Ga0157376_10150794
383 Ga0207642_10045157
384 Ga0207645_10006602
385 Ga0207684_10001259
386 Ga0207654_10235872
387 Ga0207707_10041276
388 Ga0207662_10112838
389 Ga0207646_10010580
390 Ga0207681_10168190
391 Ga0207681_10405514
392 Ga0207681_10458444
393 Ga0207694_10130602
394 Ga0207664_10000022
395 Ga0207644_10116023
396 Ga0207706_10055865
397 Ga0207686_10225671
398 Ga0207686_10249671
399 Ga0207709_10050161
400 Ga0207709_10063904
401 Ga0207670_10124958
402 Ga0207704_10044235
403 Ga0207711_10124083
404 Ga0207711_10139777
405 Ga0207667_10216853
406 Ga0207640_10115919
407 Ga0207703_10009929
408 Ga0207639_10400753
409 Ga0207708_10017850
410 Ga0207648_10143100
411 Ga0207648_10151191
412 Ga0207675_100001895
413 Ga0207675_100003256
414 Ga0207675_100072975
415 Ga0207675_100234582
416 Ga0209971_1006931
417 Ga0207428_10378513
418 Ga0307408_100113651
419 Ga0307405_10029655
420 Ga0307413_10106931
421 Ga0307410_10026222
422 Ga0307410_10428142
423 Ga0307406_10039242
424 Ga0307407_10045395
425 Ga0307407_10144321
426 Ga0307409_100014157
427 Ga0307409_100092744
428 Ga0307409_100282608
429 Ga0307416_100002626
430 Ga0307416_100009102
431 Ga0307416_100122248
432 Ga0307414_10012803
433 Ga0307414_10066397
434 Ga0307411_10138623
435 Ga0307415_100032088
436 Ga0307415_100047446
437 Ga0307415_100235272
438 Ga0373930_0017947
439 Ga0373948_0004417
440 Ga0373958_0000501
441 Ga0373959_0001933
442 Ga0373938_0020210
443 Ga0373928_0002205
444 Ga0373940_0017784
445 Ga0373949_0003243
446 Ga0373951_0027307
447 Ga0373952_0006583
448 Ga0373932_0003258
449 Ga0373939_0000450
450 Ga0373941_0000193
451 Ga0373955_0134984
452 Ga0373942_0005566
453 Ga0373961_0000257
454 Ga0373962_0001191
455 Ga0373937_0039300
456 Ga0373937_0300216
457 Ga0373925_0559364
458 Ga0439450_012539
459 Ga0439435_0015662
460 Ga0439460_0012871
461 Ga0439460_0019820
462 Ga0495653_0094429
463 Ga0495662_0130618
464 Ga0495608_0047825
465 Ga0495630_0086343
466 Ga0495631_0031533
467 Ga0495586_0088618
468 Ga0495645_0038762
469 Ga0495599_0075412
470 Ga0495674_0035786
471 Ga0495680_0089390
472 Ga0496104_0005281
473 Ga0496105_0080037
474 Ga0496106_0256262
475 Ga0496107_0164990
476 Ga0496114_0003224
477 Ga0496114_0015463
478 Ga0496114_0037751
479 Ga0496115_0028188
480 Ga0501031_0005031
481 Ga0501031_0028795
482 Ga0501031_0149106
483 Ga0501033_0059178
484 Ga0501036_0000879
485 Ga0501036_0005311
486 Ga0501037_0017794
487 Ga0501037_0150571
488 Ga0501038_0006087
489 Ga0501039_0001366
490 Ga0501039_0001932
491 Ga0501041_0000036
492 Ga0501042_0000460
493 Ga0501042_0000857
494 Ga0501043_0008092
495 Ga0501046_0000353
496 Ga0501048_0000036
497 Ga0501069_0042241
498 Ga0501071_0002729
499 Ga0501071_0004979
500 Ga0501074_0009386
501 Ga0501074_0011924
502 Ga0501075_0000081
503 Ga0501075_0000649
504 Ga0501075_0095134
505 Ga0501076_0001473
506 Ga0501076_0008135
507 Ga0501077_0004406
508 Ga0501077_0005055
509 Ga0501079_0000052
510 Ga0501079_0001117
511 Ga0501081_0000200
512 Ga0501081_0004161
513 Ga0501083_0049236
514 Ga0501044_0100369
515 Ga0501045_0000065
516 Ga0501045_0001029
517 nmdc:mga05p37_320519_c1
518 nmdc:mga05p37_3611_c1
519 nmdc:mga05p37_452704_c1
520 nmdc:mga05p37_9359_c1
521 nmdc:mga09592_185873_c1
522 nmdc:mga09592_260481_c1
523 nmdc:mga0qj67_28570_c1
524 nmdc:mga0qj67_29288_c1
525 nmdc:mga06r32_40703_c1
526 nmdc:mga08y16_21048_c1
527 nmdc:mga0n895_150249_c1
528 nmdc:mga0n895_214039_c1
529 nmdc:mga0n895_33031_c1
530 nmdc:mga0n895_34223_c1
531 nmdc:mga0n895_57_c1
532 nmdc:mga0rr50_1527_c1
533 nmdc:mga0rr50_220157_c1
534 nmdc:mga0rr50_35074_c1
535 nmdc:mga0rr50_5_c1
536 nmdc:mga08x19_104635_c1
537 nmdc:mga08x19_1420_c1
538 nmdc:mga0a205_32203_c1
539 nmdc:mga0a205_38056_c1
540 Ga0495601_0081739
541 Ga0495595_0023748
542 Ga0495619_0074504
543 Ga0495619_0092793
544 Ga0501084_0000641
545 Ga0590077_000028
546 Ga0501082_0001519
547 Ga0501082_0123010
548 Ga0530510_0004655

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07837

FTCD_N

Formiminotransferase domain, N-terminal subdomain

9

200

0.92

PF02971

FTCD

Formiminotransferase domain

202

312

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ssq-assembly1.cif.gz_A-2 ccmk2 - form 1 dodecamer 0.8643 9 78
1qd1-assembly1.cif.gz_A the crystal structure of the formiminotransferase domain of formiminotransferase-cyclodeaminase. 0.8585 9 319
1qd1-assembly1.cif.gz_B the crystal structure of the formiminotransferase domain of formiminotransferase-cyclodeaminase. 0.837 9 319
4rbv-assembly3.cif.gz_F pdua k26a s40gsg mutant, from salmonella enterica serovar typhimurium lt2 0.827 11 71
1qd1-assembly1.cif.gz_A the crystal structure of the formiminotransferase domain of formiminotransferase-cyclodeaminase. 0.8042 9 319
ID Description Score Start End Superfamily
2pfdC01 Alpha Beta;2-Layer Sandwich;Formiminotransferase-cyclodeaminase; Chain B, domain 1;Formiminotransferase, N-terminal subdomain 0.9201 8 198 3.30.990.10
2pfdC01 Alpha Beta;2-Layer Sandwich;Formiminotransferase-cyclodeaminase; Chain B, domain 1;Formiminotransferase, N-terminal subdomain 0.9101 8 198 3.30.990.10
af_Q75ID3_219_317_3.30.70.670 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Formiminotransferase, C-terminal subdomain 0.8934 201 277 3.30.70.670
6fdbB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;BMC (bacterial microcompartment) domain 0.8839 9 71 3.30.70.1710
5dihA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;BMC (bacterial microcompartment) domain 0.8785 10 75 3.30.70.1710
ID Description Score Start End GO Terms
AF-A0A354Z9W6-F1-model_v4 Glutamate formimidoyltransferase 0.9865 9 95 GO:0005542
GO:0016740
AF-A0A497TCR5-F1-model_v4 Glutamate formiminotransferase 0.9852 9 99 GO:0005542
GO:0016740
AF-A0A1W9REV8-F1-model_v4 Formiminotransferase N-terminal subdomain domain-containing protein 0.9834 9 86 GO:0005542
GO:0016740
AF-A0A7C2E9D7-F1-model_v4 Glutamate formiminotransferase 0.9826 9 103 GO:0005542
GO:0016740
AF-A0A2V8DW37-F1-model_v4 Glutamate formiminotransferase 0.9804 9 104 GO:0005542
GO:0016740

Map