F379469
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 274 | 164 | 274 | 119 |
Family's Representative Sequence
| Representative Sequence | 3300005295|Ga0065707_10413841|Ga0065707_104138411 |
| Length | 114 |
| Sequence | MTELTAGDFRYRLVAIERDGQWIAHAVREDTGKPFGIECGGPTRDDAIGRLTTWLTWQAAHIQAAERAYHRTVAGSAFANPSEGPTALELQKESLAAVEAARVRLDDVRARKPE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 58 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 117 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 121 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 122 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 123 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 124 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 125 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 126 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 127 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 128 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 129 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 130 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 131 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 133 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 134 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 135 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 146 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 147 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 150 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 151 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.92 |
| Rhizosphere | 97.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10413841 | 3300005295 | Bacteria | 838 |
| 2 | Ga0065707_10416263 | 3300005295 | Bacteria | 832 |
| 3 | Ga0065707_10821567 | 3300005295 | Unclassified | 592 |
| 4 | Ga0070670_101151054 | 3300005331 | Bacteria | 708 |
| 5 | Ga0068869_100544438 | 3300005334 | Unclassified | 974 |
| 6 | Ga0070680_101153136 | 3300005336 | Bacteria | 670 |
| 7 | Ga0068868_100168603 | 3300005338 | Unclassified | 1812 |
| 8 | Ga0070660_100014636 | 3300005339 | Bacteria | 5659 |
| 9 | Ga0070689_100063367 | 3300005340 | Bacteria | 2877 |
| 10 | Ga0070691_10914536 | 3300005341 | Bacteria | 542 |
| 11 | Ga0070687_100061394 | 3300005343 | Bacteria | 1987 |
| 12 | Ga0070675_100153447 | 3300005354 | Unclassified | 1976 |
| 13 | Ga0070675_101104833 | 3300005354 | Unclassified | 729 |
| 14 | Ga0070675_101820710 | 3300005354 | Bacteria | 562 |
| 15 | Ga0070673_100860653 | 3300005364 | Unclassified | 839 |
| 16 | Ga0070673_101168951 | 3300005364 | Bacteria | 720 |
| 17 | Ga0070659_100102679 | 3300005366 | Bacteria | 2302 |
| 18 | Ga0070709_10193760 | 3300005434 | Bacteria | 1435 |
| 19 | Ga0070709_11222180 | 3300005434 | Unclassified | 604 |
| 20 | Ga0070701_11088015 | 3300005438 | Unclassified | 562 |
| 21 | Ga0070705_101114798 | 3300005440 | Bacteria | 646 |
| 22 | Ga0070694_101280182 | 3300005444 | Bacteria | 616 |
| 23 | Ga0070694_101445888 | 3300005444 | Bacteria | 581 |
| 24 | Ga0070708_101343284 | 3300005445 | Unclassified | 667 |
| 25 | Ga0070681_11493697 | 3300005458 | Unclassified | 600 |
| 26 | Ga0070681_11709962 | 3300005458 | Bacteria | 555 |
| 27 | Ga0068867_101921577 | 3300005459 | Bacteria | 558 |
| 28 | Ga0070685_11014836 | 3300005466 | Unclassified | 623 |
| 29 | Ga0070706_100525384 | 3300005467 | Bacteria | 1101 |
| 30 | Ga0070707_100106381 | 3300005468 | Unclassified | 2721 |
| 31 | Ga0070707_101084587 | 3300005468 | Bacteria | 767 |
| 32 | Ga0070698_100056676 | 3300005471 | Bacteria | 3970 |
| 33 | Ga0070698_100189614 | 3300005471 | Bacteria | 1994 |
| 34 | Ga0070699_100186883 | 3300005518 | Bacteria | 1840 |
| 35 | Ga0070699_100549305 | 3300005518 | Bacteria | 1051 |
| 36 | Ga0070679_100393855 | 3300005530 | Bacteria | 1331 |
| 37 | Ga0070679_100447259 | 3300005530 | Bacteria | 1237 |
| 38 | Ga0070679_101672692 | 3300005530 | Bacteria | 584 |
| 39 | Ga0070697_100275358 | 3300005536 | Bacteria | 1443 |
| 40 | Ga0068853_101157286 | 3300005539 | Unclassified | 746 |
| 41 | Ga0070686_100020103 | 3300005544 | Bacteria | 3948 |
| 42 | Ga0070695_100133176 | 3300005545 | Bacteria | 1715 |
| 43 | Ga0070695_101592250 | 3300005545 | Unclassified | 545 |
| 44 | Ga0070693_100050533 | 3300005547 | Bacteria | 2377 |
| 45 | Ga0070665_100163570 | 3300005548 | Bacteria | 2227 |
| 46 | Ga0070704_100737503 | 3300005549 | Bacteria | 876 |
| 47 | Ga0068855_100022574 | 3300005563 | Bacteria | 7540 |
| 48 | Ga0068855_100285795 | 3300005563 | Bacteria | 1830 |
| 49 | Ga0068854_100014062 | 3300005578 | Bacteria | 5269 |
| 50 | Ga0068854_100045603 | 3300005578 | Bacteria | 3118 |
| 51 | Ga0068856_100041738 | 3300005614 | Bacteria | 4510 |
| 52 | Ga0068852_101139079 | 3300005616 | Unclassified | 801 |
| 53 | Ga0068859_100244228 | 3300005617 | Unclassified | 1885 |
| 54 | Ga0068859_100404996 | 3300005617 | Bacteria | 1460 |
| 55 | Ga0068859_101484130 | 3300005617 | Unclassified | 748 |
| 56 | Ga0068864_100596534 | 3300005618 | Unclassified | 1071 |
| 57 | Ga0068866_10396205 | 3300005718 | Bacteria | 889 |
| 58 | Ga0068861_100036985 | 3300005719 | Bacteria | 3627 |
| 59 | Ga0068863_100007212 | 3300005841 | Bacteria | 10901 |
| 60 | Ga0068858_100049888 | 3300005842 | Unclassified | 3875 |
| 61 | Ga0068858_100461427 | 3300005842 | Bacteria | 1225 |
| 62 | Ga0068858_100502094 | 3300005842 | Unclassified | 1172 |
| 63 | Ga0068860_102678156 | 3300005843 | Unclassified | 517 |
| 64 | Ga0068862_100857809 | 3300005844 | Bacteria | 890 |
| 65 | Ga0068862_102419362 | 3300005844 | Unclassified | 537 |
| 66 | Ga0081539_10012533 | 3300005985 | Bacteria | 6517 |
| 67 | Ga0081539_10042640 | 3300005985 | Bacteria | 2640 |
| 68 | Ga0070717_10915925 | 3300006028 | Bacteria | 798 |
| 69 | Ga0097621_100059334 | 3300006237 | Bacteria | 3132 |
| 70 | Ga0097621_100486785 | 3300006237 | Bacteria | 1116 |
| 71 | Ga0097621_102346369 | 3300006237 | Unclassified | 510 |
| 72 | Ga0068871_100051184 | 3300006358 | Bacteria | 3343 |
| 73 | Ga0075428_100064003 | 3300006844 | Unclassified | 4027 |
| 74 | Ga0075431_100013395 | 3300006847 | Bacteria | 8285 |
| 75 | Ga0075433_10220526 | 3300006852 | Bacteria | 1685 |
| 76 | Ga0075433_10884814 | 3300006852 | Bacteria | 779 |
| 77 | Ga0075434_100008885 | 3300006871 | Bacteria | 9353 |
| 78 | Ga0075434_101637208 | 3300006871 | Bacteria | 652 |
| 79 | Ga0075434_101652448 | 3300006871 | Unclassified | 649 |
| 80 | Ga0075429_100149587 | 3300006880 | Bacteria | 2044 |
| 81 | Ga0075429_100661830 | 3300006880 | Bacteria | 915 |
| 82 | Ga0075429_101652407 | 3300006880 | Unclassified | 557 |
| 83 | Ga0068865_100007288 | 3300006881 | Bacteria | 6797 |
| 84 | Ga0075436_100000233 | 3300006914 | Bacteria | 34841 |
| 85 | Ga0075436_100029792 | 3300006914 | Bacteria | 3753 |
| 86 | Ga0075436_100036392 | 3300006914 | Bacteria | 3397 |
| 87 | Ga0075436_100084827 | 3300006914 | Bacteria | 2198 |
| 88 | Ga0075436_100102752 | 3300006914 | Bacteria | 1991 |
| 89 | Ga0097620_100244220 | 3300006931 | Unclassified | 1885 |
| 90 | Ga0097620_100404979 | 3300006931 | Bacteria | 1460 |
| 91 | Ga0097620_101484597 | 3300006931 | Unclassified | 748 |
| 92 | Ga0075435_100000220 | 3300007076 | Bacteria | 35137 |
| 93 | Ga0075435_100211015 | 3300007076 | Unclassified | 1647 |
| 94 | Ga0075435_100285406 | 3300007076 | Bacteria | 1409 |
| 95 | Ga0075435_100619838 | 3300007076 | Bacteria | 939 |
| 96 | Ga0099795_10528308 | 3300007788 | Bacteria | 553 |
| 97 | Ga0105240_10014014 | 3300009093 | Bacteria | 10966 |
| 98 | Ga0105240_10062935 | 3300009093 | Bacteria | 4618 |
| 99 | Ga0105240_10085699 | 3300009093 | Bacteria | 3859 |
| 100 | Ga0105240_10132406 | 3300009093 | Bacteria | 2990 |
| 101 | Ga0105240_10543064 | 3300009093 | Unclassified | 1287 |
| 102 | Ga0111539_10437848 | 3300009094 | Bacteria | 1522 |
| 103 | Ga0111539_10696568 | 3300009094 | Bacteria | 1182 |
| 104 | Ga0105245_10230764 | 3300009098 | Bacteria | 1790 |
| 105 | Ga0105245_11141824 | 3300009098 | Bacteria | 826 |
| 106 | Ga0105247_10623973 | 3300009101 | Bacteria | 802 |
| 107 | Ga0105247_10997740 | 3300009101 | Unclassified | 654 |
| 108 | Ga0114129_10043922 | 3300009147 | Bacteria | 6287 |
| 109 | Ga0114129_10048650 | 3300009147 | Bacteria | 5958 |
| 110 | Ga0114129_10541827 | 3300009147 | Bacteria | 1514 |
| 111 | Ga0114129_11410730 | 3300009147 | Bacteria | 859 |
| 112 | Ga0114129_11996964 | 3300009147 | Unclassified | 701 |
| 113 | Ga0114129_12368045 | 3300009147 | Unclassified | 636 |
| 114 | Ga0105243_10789584 | 3300009148 | Bacteria | 935 |
| 115 | Ga0105241_10068438 | 3300009174 | Bacteria | 2751 |
| 116 | Ga0105242_10014004 | 3300009176 | Bacteria | 6206 |
| 117 | Ga0105248_10209164 | 3300009177 | Bacteria | 2198 |
| 118 | Ga0105248_10342991 | 3300009177 | Unclassified | 1682 |
| 119 | Ga0105248_10353440 | 3300009177 | Bacteria | 1654 |
| 120 | Ga0105248_10519000 | 3300009177 | Bacteria | 1343 |
| 121 | Ga0105248_10548686 | 3300009177 | Bacteria | 1304 |
| 122 | Ga0105248_10681912 | 3300009177 | Unclassified | 1159 |
| 123 | Ga0105249_10122381 | 3300009553 | Bacteria | 2474 |
| 124 | Ga0105249_10770184 | 3300009553 | Bacteria | 1025 |
| 125 | Ga0105246_10199093 | 3300011119 | Bacteria | 1556 |
| 126 | Ga0157370_10234645 | 3300013104 | Unclassified | 1697 |
| 127 | Ga0157374_12024673 | 3300013296 | Unclassified | 602 |
| 128 | Ga0157375_10889913 | 3300013308 | Unclassified | 1035 |
| 129 | Ga0157375_11273394 | 3300013308 | Unclassified | 864 |
| 130 | Ga0163163_10165285 | 3300014325 | Bacteria | 2259 |
| 131 | Ga0163163_10434627 | 3300014325 | Unclassified | 1372 |
| 132 | Ga0157380_12749724 | 3300014326 | Unclassified | 559 |
| 133 | Ga0157377_10102726 | 3300014745 | Bacteria | 1706 |
| 134 | Ga0157379_11319621 | 3300014968 | Unclassified | 697 |
| 135 | Ga0157379_11540844 | 3300014968 | Bacteria | 647 |
| 136 | Ga0157376_10033464 | 3300014969 | Bacteria | 4139 |
| 137 | Ga0157376_10116360 | 3300014969 | Bacteria | 2362 |
| 138 | Ga0157376_11934027 | 3300014969 | Bacteria | 627 |
| 139 | Ga0207642_10236215 | 3300025899 | Bacteria | 1030 |
| 140 | Ga0207680_10016138 | 3300025903 | Bacteria | 3914 |
| 141 | Ga0207699_10993383 | 3300025906 | Unclassified | 620 |
| 142 | Ga0207645_10214894 | 3300025907 | Unclassified | 1267 |
| 143 | Ga0207705_10485204 | 3300025909 | Bacteria | 959 |
| 144 | Ga0207684_10258378 | 3300025910 | Unclassified | 1503 |
| 145 | Ga0207684_10820567 | 3300025910 | Bacteria | 785 |
| 146 | Ga0207654_10378834 | 3300025911 | Bacteria | 979 |
| 147 | Ga0207707_10270684 | 3300025912 | Bacteria | 1472 |
| 148 | Ga0207707_11255614 | 3300025912 | Unclassified | 597 |
| 149 | Ga0207695_10057917 | 3300025913 | Bacteria | 4024 |
| 150 | Ga0207695_10149476 | 3300025913 | Bacteria | 2276 |
| 151 | Ga0207695_11238483 | 3300025913 | Unclassified | 626 |
| 152 | Ga0207662_10306867 | 3300025918 | Unclassified | 1056 |
| 153 | Ga0207657_10057672 | 3300025919 | Unclassified | 3346 |
| 154 | Ga0207652_10335580 | 3300025921 | Bacteria | 1365 |
| 155 | Ga0207646_10359521 | 3300025922 | Bacteria | 1315 |
| 156 | Ga0207681_11174270 | 3300025923 | Bacteria | 645 |
| 157 | Ga0207659_10000321 | 3300025926 | Bacteria | 28969 |
| 158 | Ga0207659_10820135 | 3300025926 | Unclassified | 799 |
| 159 | Ga0207659_10885642 | 3300025926 | Bacteria | 767 |
| 160 | Ga0207687_10111812 | 3300025927 | Bacteria | 2028 |
| 161 | Ga0207687_10611444 | 3300025927 | Bacteria | 919 |
| 162 | Ga0207644_11717867 | 3300025931 | Viruses | 526 |
| 163 | Ga0207690_10065447 | 3300025932 | Bacteria | 2486 |
| 164 | Ga0207690_10312747 | 3300025932 | Bacteria | 1232 |
| 165 | Ga0207686_10053537 | 3300025934 | Bacteria | 2523 |
| 166 | Ga0207709_11189081 | 3300025935 | Bacteria | 628 |
| 167 | Ga0207669_11266150 | 3300025937 | Bacteria | 626 |
| 168 | Ga0207704_10008471 | 3300025938 | Bacteria | 4922 |
| 169 | Ga0207704_10717918 | 3300025938 | Bacteria | 829 |
| 170 | Ga0207665_10522217 | 3300025939 | Bacteria | 919 |
| 171 | Ga0207711_10227735 | 3300025941 | Unclassified | 1707 |
| 172 | Ga0207711_10345070 | 3300025941 | Unclassified | 1378 |
| 173 | Ga0207711_11001586 | 3300025941 | Unclassified | 775 |
| 174 | Ga0207711_11097513 | 3300025941 | Bacteria | 736 |
| 175 | Ga0207661_10011981 | 3300025944 | Bacteria | 6299 |
| 176 | Ga0207667_10056741 | 3300025949 | Unclassified | 4113 |
| 177 | Ga0207651_10269038 | 3300025960 | Bacteria | 1403 |
| 178 | Ga0207651_10764133 | 3300025960 | Unclassified | 855 |
| 179 | Ga0207712_10514098 | 3300025961 | Bacteria | 1025 |
| 180 | Ga0207640_10004967 | 3300025981 | Bacteria | 7232 |
| 181 | Ga0207677_10063802 | 3300026023 | Bacteria | 2562 |
| 182 | Ga0207677_10106839 | 3300026023 | Unclassified | 2074 |
| 183 | Ga0207703_10079782 | 3300026035 | Unclassified | 2724 |
| 184 | Ga0207703_10135469 | 3300026035 | Bacteria | 2132 |
| 185 | Ga0207703_10542217 | 3300026035 | Bacteria | 1096 |
| 186 | Ga0207639_10453981 | 3300026041 | Bacteria | 1164 |
| 187 | Ga0207702_10199436 | 3300026078 | Unclassified | 1854 |
| 188 | Ga0207702_11076449 | 3300026078 | Bacteria | 798 |
| 189 | Ga0207641_10000409 | 3300026088 | Bacteria | 50240 |
| 190 | Ga0207648_10025386 | 3300026089 | Bacteria | 5279 |
| 191 | Ga0207648_10345280 | 3300026089 | Bacteria | 1341 |
| 192 | Ga0207675_100030835 | 3300026118 | Bacteria | 4993 |
| 193 | Ga0207675_100142783 | 3300026118 | Unclassified | 2275 |
| 194 | Ga0207683_10028853 | 3300026121 | Bacteria | 4801 |
| 195 | Ga0207698_11010203 | 3300026142 | Unclassified | 843 |
| 196 | Ga0207428_10577131 | 3300027907 | Bacteria | 812 |
| 197 | Ga0207428_11148094 | 3300027907 | Unclassified | 542 |
| 198 | Ga0268266_10009380 | 3300028379 | Bacteria | 8622 |
| 199 | Ga0268265_11095281 | 3300028380 | Bacteria | 791 |
| 200 | Ga0268264_10217406 | 3300028381 | Bacteria | 1758 |
| 201 | Ga0268264_10317000 | 3300028381 | Bacteria | 1473 |
| 202 | Ga0307416_103536362 | 3300032002 | Bacteria | 523 |
| 203 | Ga0373928_0081958 | 3300035084 | Unclassified | 815 |
| 204 | Ga0373951_0086538 | 3300035091 | Unclassified | 817 |
| 205 | Ga0373936_0362663 | 3300035113 | Unclassified | 661 |
| 206 | Ga0373936_0407205 | 3300035113 | Bacteria | 625 |
| 207 | Ga0373939_0048585 | 3300035114 | Unclassified | 1308 |
| 208 | Ga0373939_0063008 | 3300035114 | Bacteria | 1186 |
| 209 | Ga0373941_0101037 | 3300035115 | Unclassified | 1004 |
| 210 | Ga0373943_0384132 | 3300035170 | Unclassified | 809 |
| 211 | Ga0373961_0427033 | 3300035241 | Unclassified | 513 |
| 212 | Ga0373931_0611587 | 3300035691 | Unclassified | 713 |
| 213 | Ga0373935_0557054 | 3300035692 | Bacteria | 836 |
| 214 | Ga0373947_0066656 | 3300035725 | Bacteria | 2198 |
| 215 | Ga0373937_0403447 | 3300036401 | Bacteria | 1297 |
| 216 | Ga0373937_1485888 | 3300036401 | Bacteria | 625 |
| 217 | Ga0466963_0013024 | 3300044694 | Bacteria | 5098 |
| 218 | Ga0466958_0896734 | 3300045836 | Unclassified | 578 |
| 219 | Ga0466967_0880411 | 3300045976 | Bacteria | 890 |
| 220 | Ga0495603_0140034 | 3300046455 | Bacteria | 1407 |
| 221 | Ga0495580_0599774 | 3300046472 | Unclassified | 728 |
| 222 | Ga0495586_0842458 | 3300046535 | Bacteria | 529 |
| 223 | Ga0495645_0774759 | 3300046543 | Bacteria | 577 |
| 224 | Ga0495659_0268263 | 3300046664 | Bacteria | 715 |
| 225 | Ga0495659_0379415 | 3300046664 | Unclassified | 608 |
| 226 | Ga0495588_0581499 | 3300046674 | Unclassified | 587 |
| 227 | Ga0495658_0026898 | 3300046683 | Bacteria | 3089 |
| 228 | Ga0495658_0240990 | 3300046683 | Unclassified | 1136 |
| 229 | Ga0495669_0078873 | 3300046684 | Unclassified | 1509 |
| 230 | Ga0495613_0761184 | 3300046689 | Bacteria | 634 |
| 231 | Ga0495613_0816319 | 3300046689 | Bacteria | 608 |
| 232 | Ga0495593_0545018 | 3300047673 | Unclassified | 582 |
| 233 | Ga0496103_0950144 | 3300048906 | Bacteria | 537 |
| 234 | Ga0496107_0451301 | 3300048910 | Unclassified | 955 |
| 235 | Ga0496108_0358276 | 3300048911 | Bacteria | 1273 |
| 236 | Ga0496109_0738204 | 3300048912 | Bacteria | 922 |
| 237 | Ga0496109_1413228 | 3300048912 | Unclassified | 631 |
| 238 | Ga0496110_0756193 | 3300048913 | Bacteria | 875 |
| 239 | Ga0496112_0301624 | 3300048915 | Bacteria | 1547 |
| 240 | Ga0496112_0537063 | 3300048915 | Bacteria | 1104 |
| 241 | Ga0501067_0784660 | 3300049583 | Unclassified | 536 |
| 242 | Ga0501074_0153006 | 3300049590 | Bacteria | 1649 |
| 243 | Ga0501080_1408077 | 3300049742 | Bacteria | 595 |
| 244 | Ga0501081_1520111 | 3300049743 | Unclassified | 508 |
| 245 | nmdc:mga05p37_14016_c1 | 3300050507 | Bacteria | 9615 |
| 246 | nmdc:mga05p37_226164_c1 | 3300050507 | Bacteria | 2256 |
| 247 | nmdc:mga05p37_413403_c1 | 3300050507 | Bacteria | 1572 |
| 248 | nmdc:mga05p37_70327_c1 | 3300050507 | Bacteria | 4304 |
| 249 | nmdc:mga09592_21615_c2 | 3300050508 | Bacteria | 3254 |
| 250 | nmdc:mga09592_516117_c1 | 3300050508 | Bacteria | 1028 |
| 251 | nmdc:mga09592_524137_c1 | 3300050508 | Bacteria | 1019 |
| 252 | nmdc:mga08y16_1726705_c1 | 3300050511 | Unclassified | 581 |
| 253 | nmdc:mga08y16_981507_c1 | 3300050511 | Bacteria | 826 |
| 254 | nmdc:mga0n895_1087780_c1 | 3300050512 | Bacteria | 777 |
| 255 | nmdc:mga0n895_10_c1 | 3300050512 | Bacteria | 115544 |
| 256 | nmdc:mga0n895_1125396_c1 | 3300050512 | Bacteria | 762 |
| 257 | nmdc:mga0n895_1315478_c1 | 3300050512 | Unclassified | 693 |
| 258 | nmdc:mga0n895_434543_c1 | 3300050512 | Bacteria | 1326 |
| 259 | nmdc:mga0rr50_115204_c1 | 3300050513 | Bacteria | 2133 |
| 260 | nmdc:mga0rr50_1245658_c1 | 3300050513 | Unclassified | 631 |
| 261 | nmdc:mga0rr50_20_c1 | 3300050513 | Bacteria | 140799 |
| 262 | nmdc:mga0rr50_240957_c1 | 3300050513 | Bacteria | 1499 |
| 263 | nmdc:mga0rr50_60767_c1 | 3300050513 | Bacteria | 2844 |
| 264 | nmdc:mga08x19_121175_c1 | 3300050514 | Bacteria | 1754 |
| 265 | nmdc:mga08x19_319_c1 | 3300050514 | Bacteria | 34836 |
| 266 | nmdc:mga08x19_38503_c1 | 3300050514 | Unclassified | 3038 |
| 267 | nmdc:mga08x19_53961_c1 | 3300050514 | Bacteria | 2587 |
| 268 | nmdc:mga08x19_933058_c1 | 3300050514 | Bacteria | 617 |
| 269 | nmdc:mga0a205_590016_c1 | 3300050515 | Bacteria | 965 |
| 270 | nmdc:mga0a205_612546_c1 | 3300050515 | Bacteria | 941 |
| 271 | nmdc:mga0a205_87111_c1 | 3300050515 | Bacteria | 3017 |
| 272 | Ga0495619_0626947 | 3300053085 | Bacteria | 735 |
| 273 | Ga0501084_1138387 | 3300054114 | Unclassified | 655 |
| 274 | Ga0530510_0237748 | 3300061734 | Bacteria | 1356 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046472 | Ga0495580_0599774 | Ga0495580_0599774_59_445 | 99 |
| 2 | 3300005841 | Ga0068863_100007212 | Ga0068863_1000072123 | 104 |
| 3 | 3300007788 | Ga0099795_10528308 | Ga0099795_105283082 | 104 |
| 4 | 3300025926 | Ga0207659_10885642 | Ga0207659_108856421 | 104 |
| 5 | 3300026088 | Ga0207641_10000409 | Ga0207641_1000040927 | 104 |
| 6 | 3300005354 | Ga0070675_101820710 | Ga0070675_1018207101 | 105 |
| 7 | 3300007076 | Ga0075435_100211015 | Ga0075435_1002110152 | 105 |
| 8 | 3300009101 | Ga0105247_10623973 | Ga0105247_106239733 | 105 |
| 9 | 3300009147 | Ga0114129_10043922 | Ga0114129_100439224 | 105 |
| 10 | 3300035084 | Ga0373928_0081958 | Ga0373928_0081958_438_776 | 105 |
| 11 | 3300035091 | Ga0373951_0086538 | Ga0373951_0086538_179_517 | 105 |
| 12 | 3300035114 | Ga0373939_0048585 | Ga0373939_0048585_446_784 | 105 |
| 13 | 3300035115 | Ga0373941_0101037 | Ga0373941_0101037_291_629 | 105 |
| 14 | 3300035691 | Ga0373931_0611587 | Ga0373931_0611587_155_493 | 105 |
| 15 | 3300048906 | Ga0496103_0950144 | Ga0496103_0950144_31_369 | 105 |
| 16 | 3300048913 | Ga0496110_0756193 | Ga0496110_0756193_372_710 | 105 |
| 17 | 3300050507 | nmdc:mga05p37_70327_c1 | nmdc:mga05p37_70327_c1_1555_1890 | 105 |
| 18 | 3300050512 | nmdc:mga0n895_1087780_c1 | nmdc:mga0n895_1087780_c1_275_613 | 105 |
| 19 | 3300050513 | nmdc:mga0rr50_240957_c1 | nmdc:mga0rr50_240957_c1_19_357 | 105 |
| 20 | 3300050515 | nmdc:mga0a205_87111_c1 | nmdc:mga0a205_87111_c1_2566_2904 | 105 |
| 21 | 3300005295 | Ga0065707_10416263 | Ga0065707_104162632 | 106 |
| 22 | 3300005331 | Ga0070670_101151054 | Ga0070670_1011510541 | 106 |
| 23 | 3300005340 | Ga0070689_100063367 | Ga0070689_1000633675 | 106 |
| 24 | 3300005354 | Ga0070675_101104833 | Ga0070675_1011048332 | 106 |
| 25 | 3300005434 | Ga0070709_10193760 | Ga0070709_101937602 | 106 |
| 26 | 3300005444 | Ga0070694_101280182 | Ga0070694_1012801822 | 106 |
| 27 | 3300005445 | Ga0070708_101343284 | Ga0070708_1013432842 | 106 |
| 28 | 3300005458 | Ga0070681_11493697 | Ga0070681_114936971 | 106 |
| 29 | 3300005471 | Ga0070698_100056676 | Ga0070698_1000566762 | 106 |
| 30 | 3300005549 | Ga0070704_100737503 | Ga0070704_1007375032 | 106 |
| 31 | 3300005617 | Ga0068859_100244228 | Ga0068859_1002442282 | 106 |
| 32 | 3300005985 | Ga0081539_10012533 | Ga0081539_100125333 | 106 |
| 33 | 3300005985 | Ga0081539_10042640 | Ga0081539_100426405 | 106 |
| 34 | 3300006028 | Ga0070717_10915925 | Ga0070717_109159252 | 106 |
| 35 | 3300006844 | Ga0075428_100064003 | Ga0075428_1000640033 | 106 |
| 36 | 3300006880 | Ga0075429_100661830 | Ga0075429_1006618302 | 106 |
| 37 | 3300006880 | Ga0075429_101652407 | Ga0075429_1016524072 | 106 |
| 38 | 3300006914 | Ga0075436_100102752 | Ga0075436_1001027522 | 106 |
| 39 | 3300006931 | Ga0097620_100244220 | Ga0097620_1002442202 | 106 |
| 40 | 3300009093 | Ga0105240_10014014 | Ga0105240_100140142 | 106 |
| 41 | 3300009093 | Ga0105240_10543064 | Ga0105240_105430642 | 106 |
| 42 | 3300009094 | Ga0111539_10437848 | Ga0111539_104378482 | 106 |
| 43 | 3300009094 | Ga0111539_10696568 | Ga0111539_106965682 | 106 |
| 44 | 3300009147 | Ga0114129_10541827 | Ga0114129_105418274 | 106 |
| 45 | 3300009147 | Ga0114129_11996964 | Ga0114129_119969642 | 106 |
| 46 | 3300014745 | Ga0157377_10102726 | Ga0157377_101027262 | 106 |
| 47 | 3300014968 | Ga0157379_11540844 | Ga0157379_115408441 | 106 |
| 48 | 3300014969 | Ga0157376_11934027 | Ga0157376_119340272 | 106 |
| 49 | 3300025906 | Ga0207699_10993383 | Ga0207699_109933832 | 106 |
| 50 | 3300025912 | Ga0207707_11255614 | Ga0207707_112556142 | 106 |
| 51 | 3300025913 | Ga0207695_10057917 | Ga0207695_100579175 | 106 |
| 52 | 3300025926 | Ga0207659_10000321 | Ga0207659_1000032119 | 106 |
| 53 | 3300025926 | Ga0207659_10820135 | Ga0207659_108201353 | 106 |
| 54 | 3300027907 | Ga0207428_10577131 | Ga0207428_105771311 | 106 |
| 55 | 3300027907 | Ga0207428_11148094 | Ga0207428_111480942 | 106 |
| 56 | 3300035114 | Ga0373939_0063008 | Ga0373939_0063008_728_1066 | 106 |
| 57 | 3300045836 | Ga0466958_0896734 | Ga0466958_0896734_213_551 | 106 |
| 58 | 3300046664 | Ga0495659_0268263 | Ga0495659_0268263_213_554 | 106 |
| 59 | 3300048910 | Ga0496107_0451301 | Ga0496107_0451301_92_430 | 106 |
| 60 | 3300048911 | Ga0496108_0358276 | Ga0496108_0358276_862_1200 | 106 |
| 61 | 3300048912 | Ga0496109_0738204 | Ga0496109_0738204_452_790 | 106 |
| 62 | 3300050507 | nmdc:mga05p37_226164_c1 | nmdc:mga05p37_226164_c1_16_354 | 106 |
| 63 | 3300050508 | nmdc:mga09592_516117_c1 | nmdc:mga09592_516117_c1_675_1013 | 106 |
| 64 | 3300050508 | nmdc:mga09592_524137_c1 | nmdc:mga09592_524137_c1_343_681 | 106 |
| 65 | 3300050511 | nmdc:mga08y16_1726705_c1 | nmdc:mga08y16_1726705_c1_123_461 | 106 |
| 66 | 3300050511 | nmdc:mga08y16_981507_c1 | nmdc:mga08y16_981507_c1_364_702 | 106 |
| 67 | 3300050513 | nmdc:mga0rr50_1245658_c1 | nmdc:mga0rr50_1245658_c1_182_520 | 106 |
| 68 | 3300050514 | nmdc:mga08x19_121175_c1 | nmdc:mga08x19_121175_c1_530_880 | 106 |
| 69 | 3300025910 | Ga0207684_10820567 | Ga0207684_108205671 | 107 |
| 70 | 3300044694 | Ga0466963_0013024 | Ga0466963_0013024_2023_2367 | 108 |
| 71 | 3300005468 | Ga0070707_101084587 | Ga0070707_1010845872 | 111 |
| 72 | 3300005518 | Ga0070699_100186883 | Ga0070699_1001868832 | 111 |
| 73 | 3300005536 | Ga0070697_100275358 | Ga0070697_1002753583 | 111 |
| 74 | 3300025922 | Ga0207646_10359521 | Ga0207646_103595211 | 111 |
| 75 | 3300005364 | Ga0070673_101168951 | Ga0070673_1011689512 | 113 |
| 76 | 3300005548 | Ga0070665_100163570 | Ga0070665_1001635703 | 113 |
| 77 | 3300005563 | Ga0068855_100285795 | Ga0068855_1002857952 | 113 |
| 78 | 3300005614 | Ga0068856_100041738 | Ga0068856_1000417383 | 113 |
| 79 | 3300005842 | Ga0068858_100461427 | Ga0068858_1004614272 | 113 |
| 80 | 3300009093 | Ga0105240_10132406 | Ga0105240_101324063 | 113 |
| 81 | 3300009177 | Ga0105248_10681912 | Ga0105248_106819121 | 113 |
| 82 | 3300013104 | Ga0157370_10234645 | Ga0157370_102346452 | 113 |
| 83 | 3300013308 | Ga0157375_10889913 | Ga0157375_108899133 | 113 |
| 84 | 3300014325 | Ga0163163_10165285 | Ga0163163_101652852 | 113 |
| 85 | 3300025913 | Ga0207695_11238483 | Ga0207695_112384831 | 113 |
| 86 | 3300025941 | Ga0207711_10345070 | Ga0207711_103450701 | 113 |
| 87 | 3300025944 | Ga0207661_10011981 | Ga0207661_100119813 | 113 |
| 88 | 3300026078 | Ga0207702_10199436 | Ga0207702_101994363 | 113 |
| 89 | 3300028379 | Ga0268266_10009380 | Ga0268266_100093808 | 113 |
| 90 | 3300035113 | Ga0373936_0362663 | Ga0373936_0362663_131_493 | 113 |
| 91 | 3300035170 | Ga0373943_0384132 | Ga0373943_0384132_29_391 | 113 |
| 92 | 3300035692 | Ga0373935_0557054 | Ga0373935_0557054_197_559 | 113 |
| 93 | 3300035725 | Ga0373947_0066656 | Ga0373947_0066656_422_784 | 113 |
| 94 | 3300036401 | Ga0373937_0403447 | Ga0373937_0403447_802_1164 | 113 |
| 95 | 3300046455 | Ga0495603_0140034 | Ga0495603_0140034_1034_1396 | 113 |
| 96 | 3300046674 | Ga0495588_0581499 | Ga0495588_0581499_67_429 | 113 |
| 97 | 3300046683 | Ga0495658_0026898 | Ga0495658_0026898_857_1219 | 113 |
| 98 | 3300046689 | Ga0495613_0761184 | Ga0495613_0761184_77_439 | 113 |
| 99 | 3300047673 | Ga0495593_0545018 | Ga0495593_0545018_87_449 | 113 |
| 100 | 3300005295 | Ga0065707_10413841 | Ga0065707_104138411 | 114 |
| 101 | 3300005295 | Ga0065707_10821567 | Ga0065707_108215671 | 114 |
| 102 | 3300005334 | Ga0068869_100544438 | Ga0068869_1005444382 | 114 |
| 103 | 3300005336 | Ga0070680_101153136 | Ga0070680_1011531362 | 114 |
| 104 | 3300005338 | Ga0068868_100168603 | Ga0068868_1001686032 | 114 |
| 105 | 3300005339 | Ga0070660_100014636 | Ga0070660_1000146364 | 114 |
| 106 | 3300005341 | Ga0070691_10914536 | Ga0070691_109145361 | 114 |
| 107 | 3300005343 | Ga0070687_100061394 | Ga0070687_1000613941 | 114 |
| 108 | 3300005354 | Ga0070675_100153447 | Ga0070675_1001534472 | 114 |
| 109 | 3300005364 | Ga0070673_100860653 | Ga0070673_1008606532 | 114 |
| 110 | 3300005366 | Ga0070659_100102679 | Ga0070659_1001026793 | 114 |
| 111 | 3300005434 | Ga0070709_11222180 | Ga0070709_112221801 | 114 |
| 112 | 3300005438 | Ga0070701_11088015 | Ga0070701_110880151 | 114 |
| 113 | 3300005440 | Ga0070705_101114798 | Ga0070705_1011147981 | 114 |
| 114 | 3300005444 | Ga0070694_101445888 | Ga0070694_1014458881 | 114 |
| 115 | 3300005458 | Ga0070681_11709962 | Ga0070681_117099621 | 114 |
| 116 | 3300005459 | Ga0068867_101921577 | Ga0068867_1019215771 | 114 |
| 117 | 3300005466 | Ga0070685_11014836 | Ga0070685_110148361 | 114 |
| 118 | 3300005467 | Ga0070706_100525384 | Ga0070706_1005253842 | 114 |
| 119 | 3300005468 | Ga0070707_100106381 | Ga0070707_1001063813 | 114 |
| 120 | 3300005471 | Ga0070698_100189614 | Ga0070698_1001896142 | 114 |
| 121 | 3300005518 | Ga0070699_100549305 | Ga0070699_1005493052 | 114 |
| 122 | 3300005530 | Ga0070679_100393855 | Ga0070679_1003938552 | 114 |
| 123 | 3300005530 | Ga0070679_100447259 | Ga0070679_1004472592 | 114 |
| 124 | 3300005530 | Ga0070679_101672692 | Ga0070679_1016726921 | 114 |
| 125 | 3300005539 | Ga0068853_101157286 | Ga0068853_1011572862 | 114 |
| 126 | 3300005544 | Ga0070686_100020103 | Ga0070686_1000201032 | 114 |
| 127 | 3300005545 | Ga0070695_100133176 | Ga0070695_1001331762 | 114 |
| 128 | 3300005545 | Ga0070695_101592250 | Ga0070695_1015922502 | 114 |
| 129 | 3300005547 | Ga0070693_100050533 | Ga0070693_1000505332 | 114 |
| 130 | 3300005563 | Ga0068855_100022574 | Ga0068855_1000225743 | 114 |
| 131 | 3300005578 | Ga0068854_100014062 | Ga0068854_1000140623 | 114 |
| 132 | 3300005578 | Ga0068854_100045603 | Ga0068854_1000456035 | 114 |
| 133 | 3300005616 | Ga0068852_101139079 | Ga0068852_1011390792 | 114 |
| 134 | 3300005617 | Ga0068859_100404996 | Ga0068859_1004049962 | 114 |
| 135 | 3300005617 | Ga0068859_101484130 | Ga0068859_1014841301 | 114 |
| 136 | 3300005618 | Ga0068864_100596534 | Ga0068864_1005965342 | 114 |
| 137 | 3300005718 | Ga0068866_10396205 | Ga0068866_103962052 | 114 |
| 138 | 3300005719 | Ga0068861_100036985 | Ga0068861_1000369853 | 114 |
| 139 | 3300005842 | Ga0068858_100049888 | Ga0068858_1000498883 | 114 |
| 140 | 3300005842 | Ga0068858_100502094 | Ga0068858_1005020942 | 114 |
| 141 | 3300005843 | Ga0068860_102678156 | Ga0068860_1026781561 | 114 |
| 142 | 3300005844 | Ga0068862_100857809 | Ga0068862_1008578092 | 114 |
| 143 | 3300005844 | Ga0068862_102419362 | Ga0068862_1024193622 | 114 |
| 144 | 3300006237 | Ga0097621_100059334 | Ga0097621_1000593342 | 114 |
| 145 | 3300006237 | Ga0097621_100486785 | Ga0097621_1004867852 | 114 |
| 146 | 3300006237 | Ga0097621_102346369 | Ga0097621_1023463692 | 114 |
| 147 | 3300006358 | Ga0068871_100051184 | Ga0068871_1000511845 | 114 |
| 148 | 3300006847 | Ga0075431_100013395 | Ga0075431_1000133955 | 114 |
| 149 | 3300006852 | Ga0075433_10220526 | Ga0075433_102205264 | 114 |
| 150 | 3300006852 | Ga0075433_10884814 | Ga0075433_108848142 | 114 |
| 151 | 3300006871 | Ga0075434_100008885 | Ga0075434_1000088858 | 114 |
| 152 | 3300006871 | Ga0075434_101637208 | Ga0075434_1016372081 | 114 |
| 153 | 3300006871 | Ga0075434_101652448 | Ga0075434_1016524482 | 114 |
| 154 | 3300006880 | Ga0075429_100149587 | Ga0075429_1001495874 | 114 |
| 155 | 3300006881 | Ga0068865_100007288 | Ga0068865_1000072886 | 114 |
| 156 | 3300006914 | Ga0075436_100000233 | Ga0075436_10000023320 | 114 |
| 157 | 3300006914 | Ga0075436_100029792 | Ga0075436_1000297924 | 114 |
| 158 | 3300006914 | Ga0075436_100036392 | Ga0075436_1000363922 | 114 |
| 159 | 3300006914 | Ga0075436_100084827 | Ga0075436_1000848273 | 114 |
| 160 | 3300006931 | Ga0097620_100404979 | Ga0097620_1004049792 | 114 |
| 161 | 3300006931 | Ga0097620_101484597 | Ga0097620_1014845971 | 114 |
| 162 | 3300007076 | Ga0075435_100000220 | Ga0075435_10000022020 | 114 |
| 163 | 3300007076 | Ga0075435_100285406 | Ga0075435_1002854061 | 114 |
| 164 | 3300007076 | Ga0075435_100619838 | Ga0075435_1006198382 | 114 |
| 165 | 3300009093 | Ga0105240_10062935 | Ga0105240_100629355 | 114 |
| 166 | 3300009093 | Ga0105240_10085699 | Ga0105240_100856994 | 114 |
| 167 | 3300009098 | Ga0105245_10230764 | Ga0105245_102307641 | 114 |
| 168 | 3300009098 | Ga0105245_11141824 | Ga0105245_111418241 | 114 |
| 169 | 3300009101 | Ga0105247_10997740 | Ga0105247_109977402 | 114 |
| 170 | 3300009147 | Ga0114129_10048650 | Ga0114129_100486502 | 114 |
| 171 | 3300009147 | Ga0114129_11410730 | Ga0114129_114107302 | 114 |
| 172 | 3300009147 | Ga0114129_12368045 | Ga0114129_123680452 | 114 |
| 173 | 3300009148 | Ga0105243_10789584 | Ga0105243_107895842 | 114 |
| 174 | 3300009174 | Ga0105241_10068438 | Ga0105241_100684382 | 114 |
| 175 | 3300009176 | Ga0105242_10014004 | Ga0105242_100140047 | 114 |
| 176 | 3300009177 | Ga0105248_10209164 | Ga0105248_102091643 | 114 |
| 177 | 3300009177 | Ga0105248_10342991 | Ga0105248_103429912 | 114 |
| 178 | 3300009177 | Ga0105248_10353440 | Ga0105248_103534402 | 114 |
| 179 | 3300009177 | Ga0105248_10519000 | Ga0105248_105190002 | 114 |
| 180 | 3300009177 | Ga0105248_10548686 | Ga0105248_105486861 | 114 |
| 181 | 3300009553 | Ga0105249_10122381 | Ga0105249_101223813 | 114 |
| 182 | 3300009553 | Ga0105249_10770184 | Ga0105249_107701841 | 114 |
| 183 | 3300011119 | Ga0105246_10199093 | Ga0105246_101990932 | 114 |
| 184 | 3300013296 | Ga0157374_12024673 | Ga0157374_120246732 | 114 |
| 185 | 3300013308 | Ga0157375_11273394 | Ga0157375_112733942 | 114 |
| 186 | 3300014325 | Ga0163163_10434627 | Ga0163163_104346273 | 114 |
| 187 | 3300014326 | Ga0157380_12749724 | Ga0157380_127497242 | 114 |
| 188 | 3300014968 | Ga0157379_11319621 | Ga0157379_113196212 | 114 |
| 189 | 3300014969 | Ga0157376_10033464 | Ga0157376_100334646 | 114 |
| 190 | 3300014969 | Ga0157376_10116360 | Ga0157376_101163604 | 114 |
| 191 | 3300025899 | Ga0207642_10236215 | Ga0207642_102362152 | 114 |
| 192 | 3300025903 | Ga0207680_10016138 | Ga0207680_100161384 | 114 |
| 193 | 3300025907 | Ga0207645_10214894 | Ga0207645_102148942 | 114 |
| 194 | 3300025909 | Ga0207705_10485204 | Ga0207705_104852042 | 114 |
| 195 | 3300025910 | Ga0207684_10258378 | Ga0207684_102583782 | 114 |
| 196 | 3300025911 | Ga0207654_10378834 | Ga0207654_103788341 | 114 |
| 197 | 3300025912 | Ga0207707_10270684 | Ga0207707_102706842 | 114 |
| 198 | 3300025913 | Ga0207695_10149476 | Ga0207695_101494762 | 114 |
| 199 | 3300025918 | Ga0207662_10306867 | Ga0207662_103068673 | 114 |
| 200 | 3300025919 | Ga0207657_10057672 | Ga0207657_100576721 | 114 |
| 201 | 3300025921 | Ga0207652_10335580 | Ga0207652_103355802 | 114 |
| 202 | 3300025923 | Ga0207681_11174270 | Ga0207681_111742701 | 114 |
| 203 | 3300025927 | Ga0207687_10111812 | Ga0207687_101118125 | 114 |
| 204 | 3300025927 | Ga0207687_10611444 | Ga0207687_106114442 | 114 |
| 205 | 3300025931 | Ga0207644_11717867 | Ga0207644_117178672 | 114 |
| 206 | 3300025932 | Ga0207690_10065447 | Ga0207690_100654474 | 114 |
| 207 | 3300025932 | Ga0207690_10312747 | Ga0207690_103127471 | 114 |
| 208 | 3300025934 | Ga0207686_10053537 | Ga0207686_100535375 | 114 |
| 209 | 3300025935 | Ga0207709_11189081 | Ga0207709_111890811 | 114 |
| 210 | 3300025937 | Ga0207669_11266150 | Ga0207669_112661501 | 114 |
| 211 | 3300025938 | Ga0207704_10008471 | Ga0207704_100084713 | 114 |
| 212 | 3300025938 | Ga0207704_10717918 | Ga0207704_107179182 | 114 |
| 213 | 3300025939 | Ga0207665_10522217 | Ga0207665_105222172 | 114 |
| 214 | 3300025941 | Ga0207711_10227735 | Ga0207711_102277352 | 114 |
| 215 | 3300025941 | Ga0207711_11001586 | Ga0207711_110015861 | 114 |
| 216 | 3300025941 | Ga0207711_11097513 | Ga0207711_110975132 | 114 |
| 217 | 3300025949 | Ga0207667_10056741 | Ga0207667_100567414 | 114 |
| 218 | 3300025960 | Ga0207651_10269038 | Ga0207651_102690383 | 114 |
| 219 | 3300025960 | Ga0207651_10764133 | Ga0207651_107641332 | 114 |
| 220 | 3300025961 | Ga0207712_10514098 | Ga0207712_105140982 | 114 |
| 221 | 3300025981 | Ga0207640_10004967 | Ga0207640_100049676 | 114 |
| 222 | 3300026023 | Ga0207677_10063802 | Ga0207677_100638023 | 114 |
| 223 | 3300026023 | Ga0207677_10106839 | Ga0207677_101068393 | 114 |
| 224 | 3300026035 | Ga0207703_10079782 | Ga0207703_100797822 | 114 |
| 225 | 3300026035 | Ga0207703_10135469 | Ga0207703_101354694 | 114 |
| 226 | 3300026035 | Ga0207703_10542217 | Ga0207703_105422172 | 114 |
| 227 | 3300026041 | Ga0207639_10453981 | Ga0207639_104539812 | 114 |
| 228 | 3300026078 | Ga0207702_11076449 | Ga0207702_110764492 | 114 |
| 229 | 3300026089 | Ga0207648_10025386 | Ga0207648_100253863 | 114 |
| 230 | 3300026089 | Ga0207648_10345280 | Ga0207648_103452802 | 114 |
| 231 | 3300026118 | Ga0207675_100030835 | Ga0207675_1000308353 | 114 |
| 232 | 3300026118 | Ga0207675_100142783 | Ga0207675_1001427832 | 114 |
| 233 | 3300026121 | Ga0207683_10028853 | Ga0207683_100288532 | 114 |
| 234 | 3300026142 | Ga0207698_11010203 | Ga0207698_110102032 | 114 |
| 235 | 3300028380 | Ga0268265_11095281 | Ga0268265_110952812 | 114 |
| 236 | 3300028381 | Ga0268264_10217406 | Ga0268264_102174061 | 114 |
| 237 | 3300028381 | Ga0268264_10317000 | Ga0268264_103170002 | 114 |
| 238 | 3300032002 | Ga0307416_103536362 | Ga0307416_1035363622 | 114 |
| 239 | 3300035113 | Ga0373936_0407205 | Ga0373936_0407205_212_577 | 114 |
| 240 | 3300035241 | Ga0373961_0427033 | Ga0373961_0427033_26_388 | 114 |
| 241 | 3300036401 | Ga0373937_1485888 | Ga0373937_1485888_127_495 | 114 |
| 242 | 3300045976 | Ga0466967_0880411 | Ga0466967_0880411_84_449 | 114 |
| 243 | 3300046535 | Ga0495586_0842458 | Ga0495586_0842458_54_419 | 114 |
| 244 | 3300046543 | Ga0495645_0774759 | Ga0495645_0774759_103_468 | 114 |
| 245 | 3300046664 | Ga0495659_0379415 | Ga0495659_0379415_159_527 | 114 |
| 246 | 3300046683 | Ga0495658_0240990 | Ga0495658_0240990_39_404 | 114 |
| 247 | 3300046684 | Ga0495669_0078873 | Ga0495669_0078873_901_1263 | 114 |
| 248 | 3300046689 | Ga0495613_0816319 | Ga0495613_0816319_136_501 | 114 |
| 249 | 3300048912 | Ga0496109_1413228 | Ga0496109_1413228_151_516 | 114 |
| 250 | 3300048915 | Ga0496112_0301624 | Ga0496112_0301624_704_1069 | 114 |
| 251 | 3300048915 | Ga0496112_0537063 | Ga0496112_0537063_165_530 | 114 |
| 252 | 3300049583 | Ga0501067_0784660 | Ga0501067_0784660_159_521 | 114 |
| 253 | 3300049590 | Ga0501074_0153006 | Ga0501074_0153006_734_1096 | 114 |
| 254 | 3300049742 | Ga0501080_1408077 | Ga0501080_1408077_64_426 | 114 |
| 255 | 3300049743 | Ga0501081_1520111 | Ga0501081_1520111_60_422 | 114 |
| 256 | 3300050507 | nmdc:mga05p37_14016_c1 | nmdc:mga05p37_14016_c1_7003_7365 | 114 |
| 257 | 3300050507 | nmdc:mga05p37_413403_c1 | nmdc:mga05p37_413403_c1_991_1356 | 114 |
| 258 | 3300050508 | nmdc:mga09592_21615_c2 | nmdc:mga09592_21615_c2_2409_2771 | 114 |
| 259 | 3300050512 | nmdc:mga0n895_10_c1 | nmdc:mga0n895_10_c1_57405_57776 | 114 |
| 260 | 3300050512 | nmdc:mga0n895_1125396_c1 | nmdc:mga0n895_1125396_c1_244_606 | 114 |
| 261 | 3300050512 | nmdc:mga0n895_1315478_c1 | nmdc:mga0n895_1315478_c1_187_552 | 114 |
| 262 | 3300050512 | nmdc:mga0n895_434543_c1 | nmdc:mga0n895_434543_c1_806_1168 | 114 |
| 263 | 3300050513 | nmdc:mga0rr50_115204_c1 | nmdc:mga0rr50_115204_c1_1511_1873 | 114 |
| 264 | 3300050513 | nmdc:mga0rr50_20_c1 | nmdc:mga0rr50_20_c1_108836_109207 | 114 |
| 265 | 3300050513 | nmdc:mga0rr50_60767_c1 | nmdc:mga0rr50_60767_c1_1209_1574 | 114 |
| 266 | 3300050514 | nmdc:mga08x19_319_c1 | nmdc:mga08x19_319_c1_13999_14370 | 114 |
| 267 | 3300050514 | nmdc:mga08x19_38503_c1 | nmdc:mga08x19_38503_c1_1602_1964 | 114 |
| 268 | 3300050514 | nmdc:mga08x19_53961_c1 | nmdc:mga08x19_53961_c1_1924_2289 | 114 |
| 269 | 3300050514 | nmdc:mga08x19_933058_c1 | nmdc:mga08x19_933058_c1_235_597 | 114 |
| 270 | 3300050515 | nmdc:mga0a205_590016_c1 | nmdc:mga0a205_590016_c1_375_737 | 114 |
| 271 | 3300050515 | nmdc:mga0a205_612546_c1 | nmdc:mga0a205_612546_c1_333_698 | 114 |
| 272 | 3300053085 | Ga0495619_0626947 | Ga0495619_0626947_98_463 | 114 |
| 273 | 3300054114 | Ga0501084_1138387 | Ga0501084_1138387_182_544 | 114 |
| 274 | 3300061734 | Ga0530510_0237748 | Ga0530510_0237748_360_722 | 114 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4exr-assembly1.cif.gz_A-2 | crystal structure of a putative lipoprotein (cd1622) from clostridium difficile 630 at 1.85 a resolution | 0.8443 | 3 | 41 |
| 4cie-assembly1.cif.gz_B | interrogating hiv integrase for compounds that bind- a sampl challenge | 0.7828 | 11 | 43 |
| 4hei-assembly1.cif.gz_A | 2a x-ray structure of hpf from vibrio cholerae | 0.7777 | 11 | 64 |
| 4y1c-assembly1.cif.gz_A | cyclic hexapeptide cyc[ndpoppkid] in complex with hiv-1 integrase core domain | 0.7666 | 11 | 43 |
| 7rq0-assembly1.cif.gz_A | hiv integrase core domain in complex with 2-{2-[2-(3-{[4-(2-{[(3-{2-[3-(carboxymethyl)-5-methyl-1-benzofuran-2-yl]ethynyl}phenyl)methyl]amino}ethyl)piperazin-1-yl]methyl}phenyl)ethynyl]-5-methyl-1-benzofuran-3-yl}acetic acid | 0.7622 | 11 | 42 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4exrA02 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8463 | 2 | 41 | 3.10.450.40 |
| af_Q2R1C4_54_370_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8424 | 8 | 40 | 2.130.10.10 |
| af_A0A1D6F7L1_9_383_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8182 | 8 | 44 | 2.130.10.10 |
| af_Q6NZ00_121_481_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8119 | 10 | 41 | 2.130.10.10 |
| af_Q8IKJ1_766_1052_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8021 | 11 | 40 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q5R0V5-F1-model_v4 | PepSY domain-containing protein | 0.8573 | 2 | 40 |
|
| AF-A0A0G1VUM0-F1-model_v4 | Uncharacterized protein | 0.8263 | 2 | 41 |
|
| AF-A0A2V8GVU1-F1-model_v4 | Uncharacterized protein | 0.8239 | 2 | 73 |
|
| AF-A0A2E6I2V6-F1-model_v4 | Ribosomal subunit interface protein | 0.8212 | 11 | 67 |
GO:0006417
|
| AF-A0A2H0VN56-F1-model_v4 | Ribosomal subunit interface protein | 0.8201 | 11 | 70 |
GO:0022627
GO:0043024 GO:0045900 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar