F379469

General Info

Members Datasets Scaffolds Average Seq Length
274 164 274 119

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10413841|Ga0065707_104138411
Length 114
Sequence MTELTAGDFRYRLVAIERDGQWIAHAVREDTGKPFGIECGGPTRDDAIGRLTTWLTWQAAHIQAAERAYHRTVAGSAFANPSEGPTALELQKESLAAVEAARVRLDDVRARKPE

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
122 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
125 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
126 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
127 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.92
Rhizosphere 97.08
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10413841 3300005295 Bacteria 838
2 Ga0065707_10416263 3300005295 Bacteria 832
3 Ga0065707_10821567 3300005295 Unclassified 592
4 Ga0070670_101151054 3300005331 Bacteria 708
5 Ga0068869_100544438 3300005334 Unclassified 974
6 Ga0070680_101153136 3300005336 Bacteria 670
7 Ga0068868_100168603 3300005338 Unclassified 1812
8 Ga0070660_100014636 3300005339 Bacteria 5659
9 Ga0070689_100063367 3300005340 Bacteria 2877
10 Ga0070691_10914536 3300005341 Bacteria 542
11 Ga0070687_100061394 3300005343 Bacteria 1987
12 Ga0070675_100153447 3300005354 Unclassified 1976
13 Ga0070675_101104833 3300005354 Unclassified 729
14 Ga0070675_101820710 3300005354 Bacteria 562
15 Ga0070673_100860653 3300005364 Unclassified 839
16 Ga0070673_101168951 3300005364 Bacteria 720
17 Ga0070659_100102679 3300005366 Bacteria 2302
18 Ga0070709_10193760 3300005434 Bacteria 1435
19 Ga0070709_11222180 3300005434 Unclassified 604
20 Ga0070701_11088015 3300005438 Unclassified 562
21 Ga0070705_101114798 3300005440 Bacteria 646
22 Ga0070694_101280182 3300005444 Bacteria 616
23 Ga0070694_101445888 3300005444 Bacteria 581
24 Ga0070708_101343284 3300005445 Unclassified 667
25 Ga0070681_11493697 3300005458 Unclassified 600
26 Ga0070681_11709962 3300005458 Bacteria 555
27 Ga0068867_101921577 3300005459 Bacteria 558
28 Ga0070685_11014836 3300005466 Unclassified 623
29 Ga0070706_100525384 3300005467 Bacteria 1101
30 Ga0070707_100106381 3300005468 Unclassified 2721
31 Ga0070707_101084587 3300005468 Bacteria 767
32 Ga0070698_100056676 3300005471 Bacteria 3970
33 Ga0070698_100189614 3300005471 Bacteria 1994
34 Ga0070699_100186883 3300005518 Bacteria 1840
35 Ga0070699_100549305 3300005518 Bacteria 1051
36 Ga0070679_100393855 3300005530 Bacteria 1331
37 Ga0070679_100447259 3300005530 Bacteria 1237
38 Ga0070679_101672692 3300005530 Bacteria 584
39 Ga0070697_100275358 3300005536 Bacteria 1443
40 Ga0068853_101157286 3300005539 Unclassified 746
41 Ga0070686_100020103 3300005544 Bacteria 3948
42 Ga0070695_100133176 3300005545 Bacteria 1715
43 Ga0070695_101592250 3300005545 Unclassified 545
44 Ga0070693_100050533 3300005547 Bacteria 2377
45 Ga0070665_100163570 3300005548 Bacteria 2227
46 Ga0070704_100737503 3300005549 Bacteria 876
47 Ga0068855_100022574 3300005563 Bacteria 7540
48 Ga0068855_100285795 3300005563 Bacteria 1830
49 Ga0068854_100014062 3300005578 Bacteria 5269
50 Ga0068854_100045603 3300005578 Bacteria 3118
51 Ga0068856_100041738 3300005614 Bacteria 4510
52 Ga0068852_101139079 3300005616 Unclassified 801
53 Ga0068859_100244228 3300005617 Unclassified 1885
54 Ga0068859_100404996 3300005617 Bacteria 1460
55 Ga0068859_101484130 3300005617 Unclassified 748
56 Ga0068864_100596534 3300005618 Unclassified 1071
57 Ga0068866_10396205 3300005718 Bacteria 889
58 Ga0068861_100036985 3300005719 Bacteria 3627
59 Ga0068863_100007212 3300005841 Bacteria 10901
60 Ga0068858_100049888 3300005842 Unclassified 3875
61 Ga0068858_100461427 3300005842 Bacteria 1225
62 Ga0068858_100502094 3300005842 Unclassified 1172
63 Ga0068860_102678156 3300005843 Unclassified 517
64 Ga0068862_100857809 3300005844 Bacteria 890
65 Ga0068862_102419362 3300005844 Unclassified 537
66 Ga0081539_10012533 3300005985 Bacteria 6517
67 Ga0081539_10042640 3300005985 Bacteria 2640
68 Ga0070717_10915925 3300006028 Bacteria 798
69 Ga0097621_100059334 3300006237 Bacteria 3132
70 Ga0097621_100486785 3300006237 Bacteria 1116
71 Ga0097621_102346369 3300006237 Unclassified 510
72 Ga0068871_100051184 3300006358 Bacteria 3343
73 Ga0075428_100064003 3300006844 Unclassified 4027
74 Ga0075431_100013395 3300006847 Bacteria 8285
75 Ga0075433_10220526 3300006852 Bacteria 1685
76 Ga0075433_10884814 3300006852 Bacteria 779
77 Ga0075434_100008885 3300006871 Bacteria 9353
78 Ga0075434_101637208 3300006871 Bacteria 652
79 Ga0075434_101652448 3300006871 Unclassified 649
80 Ga0075429_100149587 3300006880 Bacteria 2044
81 Ga0075429_100661830 3300006880 Bacteria 915
82 Ga0075429_101652407 3300006880 Unclassified 557
83 Ga0068865_100007288 3300006881 Bacteria 6797
84 Ga0075436_100000233 3300006914 Bacteria 34841
85 Ga0075436_100029792 3300006914 Bacteria 3753
86 Ga0075436_100036392 3300006914 Bacteria 3397
87 Ga0075436_100084827 3300006914 Bacteria 2198
88 Ga0075436_100102752 3300006914 Bacteria 1991
89 Ga0097620_100244220 3300006931 Unclassified 1885
90 Ga0097620_100404979 3300006931 Bacteria 1460
91 Ga0097620_101484597 3300006931 Unclassified 748
92 Ga0075435_100000220 3300007076 Bacteria 35137
93 Ga0075435_100211015 3300007076 Unclassified 1647
94 Ga0075435_100285406 3300007076 Bacteria 1409
95 Ga0075435_100619838 3300007076 Bacteria 939
96 Ga0099795_10528308 3300007788 Bacteria 553
97 Ga0105240_10014014 3300009093 Bacteria 10966
98 Ga0105240_10062935 3300009093 Bacteria 4618
99 Ga0105240_10085699 3300009093 Bacteria 3859
100 Ga0105240_10132406 3300009093 Bacteria 2990
101 Ga0105240_10543064 3300009093 Unclassified 1287
102 Ga0111539_10437848 3300009094 Bacteria 1522
103 Ga0111539_10696568 3300009094 Bacteria 1182
104 Ga0105245_10230764 3300009098 Bacteria 1790
105 Ga0105245_11141824 3300009098 Bacteria 826
106 Ga0105247_10623973 3300009101 Bacteria 802
107 Ga0105247_10997740 3300009101 Unclassified 654
108 Ga0114129_10043922 3300009147 Bacteria 6287
109 Ga0114129_10048650 3300009147 Bacteria 5958
110 Ga0114129_10541827 3300009147 Bacteria 1514
111 Ga0114129_11410730 3300009147 Bacteria 859
112 Ga0114129_11996964 3300009147 Unclassified 701
113 Ga0114129_12368045 3300009147 Unclassified 636
114 Ga0105243_10789584 3300009148 Bacteria 935
115 Ga0105241_10068438 3300009174 Bacteria 2751
116 Ga0105242_10014004 3300009176 Bacteria 6206
117 Ga0105248_10209164 3300009177 Bacteria 2198
118 Ga0105248_10342991 3300009177 Unclassified 1682
119 Ga0105248_10353440 3300009177 Bacteria 1654
120 Ga0105248_10519000 3300009177 Bacteria 1343
121 Ga0105248_10548686 3300009177 Bacteria 1304
122 Ga0105248_10681912 3300009177 Unclassified 1159
123 Ga0105249_10122381 3300009553 Bacteria 2474
124 Ga0105249_10770184 3300009553 Bacteria 1025
125 Ga0105246_10199093 3300011119 Bacteria 1556
126 Ga0157370_10234645 3300013104 Unclassified 1697
127 Ga0157374_12024673 3300013296 Unclassified 602
128 Ga0157375_10889913 3300013308 Unclassified 1035
129 Ga0157375_11273394 3300013308 Unclassified 864
130 Ga0163163_10165285 3300014325 Bacteria 2259
131 Ga0163163_10434627 3300014325 Unclassified 1372
132 Ga0157380_12749724 3300014326 Unclassified 559
133 Ga0157377_10102726 3300014745 Bacteria 1706
134 Ga0157379_11319621 3300014968 Unclassified 697
135 Ga0157379_11540844 3300014968 Bacteria 647
136 Ga0157376_10033464 3300014969 Bacteria 4139
137 Ga0157376_10116360 3300014969 Bacteria 2362
138 Ga0157376_11934027 3300014969 Bacteria 627
139 Ga0207642_10236215 3300025899 Bacteria 1030
140 Ga0207680_10016138 3300025903 Bacteria 3914
141 Ga0207699_10993383 3300025906 Unclassified 620
142 Ga0207645_10214894 3300025907 Unclassified 1267
143 Ga0207705_10485204 3300025909 Bacteria 959
144 Ga0207684_10258378 3300025910 Unclassified 1503
145 Ga0207684_10820567 3300025910 Bacteria 785
146 Ga0207654_10378834 3300025911 Bacteria 979
147 Ga0207707_10270684 3300025912 Bacteria 1472
148 Ga0207707_11255614 3300025912 Unclassified 597
149 Ga0207695_10057917 3300025913 Bacteria 4024
150 Ga0207695_10149476 3300025913 Bacteria 2276
151 Ga0207695_11238483 3300025913 Unclassified 626
152 Ga0207662_10306867 3300025918 Unclassified 1056
153 Ga0207657_10057672 3300025919 Unclassified 3346
154 Ga0207652_10335580 3300025921 Bacteria 1365
155 Ga0207646_10359521 3300025922 Bacteria 1315
156 Ga0207681_11174270 3300025923 Bacteria 645
157 Ga0207659_10000321 3300025926 Bacteria 28969
158 Ga0207659_10820135 3300025926 Unclassified 799
159 Ga0207659_10885642 3300025926 Bacteria 767
160 Ga0207687_10111812 3300025927 Bacteria 2028
161 Ga0207687_10611444 3300025927 Bacteria 919
162 Ga0207644_11717867 3300025931 Viruses 526
163 Ga0207690_10065447 3300025932 Bacteria 2486
164 Ga0207690_10312747 3300025932 Bacteria 1232
165 Ga0207686_10053537 3300025934 Bacteria 2523
166 Ga0207709_11189081 3300025935 Bacteria 628
167 Ga0207669_11266150 3300025937 Bacteria 626
168 Ga0207704_10008471 3300025938 Bacteria 4922
169 Ga0207704_10717918 3300025938 Bacteria 829
170 Ga0207665_10522217 3300025939 Bacteria 919
171 Ga0207711_10227735 3300025941 Unclassified 1707
172 Ga0207711_10345070 3300025941 Unclassified 1378
173 Ga0207711_11001586 3300025941 Unclassified 775
174 Ga0207711_11097513 3300025941 Bacteria 736
175 Ga0207661_10011981 3300025944 Bacteria 6299
176 Ga0207667_10056741 3300025949 Unclassified 4113
177 Ga0207651_10269038 3300025960 Bacteria 1403
178 Ga0207651_10764133 3300025960 Unclassified 855
179 Ga0207712_10514098 3300025961 Bacteria 1025
180 Ga0207640_10004967 3300025981 Bacteria 7232
181 Ga0207677_10063802 3300026023 Bacteria 2562
182 Ga0207677_10106839 3300026023 Unclassified 2074
183 Ga0207703_10079782 3300026035 Unclassified 2724
184 Ga0207703_10135469 3300026035 Bacteria 2132
185 Ga0207703_10542217 3300026035 Bacteria 1096
186 Ga0207639_10453981 3300026041 Bacteria 1164
187 Ga0207702_10199436 3300026078 Unclassified 1854
188 Ga0207702_11076449 3300026078 Bacteria 798
189 Ga0207641_10000409 3300026088 Bacteria 50240
190 Ga0207648_10025386 3300026089 Bacteria 5279
191 Ga0207648_10345280 3300026089 Bacteria 1341
192 Ga0207675_100030835 3300026118 Bacteria 4993
193 Ga0207675_100142783 3300026118 Unclassified 2275
194 Ga0207683_10028853 3300026121 Bacteria 4801
195 Ga0207698_11010203 3300026142 Unclassified 843
196 Ga0207428_10577131 3300027907 Bacteria 812
197 Ga0207428_11148094 3300027907 Unclassified 542
198 Ga0268266_10009380 3300028379 Bacteria 8622
199 Ga0268265_11095281 3300028380 Bacteria 791
200 Ga0268264_10217406 3300028381 Bacteria 1758
201 Ga0268264_10317000 3300028381 Bacteria 1473
202 Ga0307416_103536362 3300032002 Bacteria 523
203 Ga0373928_0081958 3300035084 Unclassified 815
204 Ga0373951_0086538 3300035091 Unclassified 817
205 Ga0373936_0362663 3300035113 Unclassified 661
206 Ga0373936_0407205 3300035113 Bacteria 625
207 Ga0373939_0048585 3300035114 Unclassified 1308
208 Ga0373939_0063008 3300035114 Bacteria 1186
209 Ga0373941_0101037 3300035115 Unclassified 1004
210 Ga0373943_0384132 3300035170 Unclassified 809
211 Ga0373961_0427033 3300035241 Unclassified 513
212 Ga0373931_0611587 3300035691 Unclassified 713
213 Ga0373935_0557054 3300035692 Bacteria 836
214 Ga0373947_0066656 3300035725 Bacteria 2198
215 Ga0373937_0403447 3300036401 Bacteria 1297
216 Ga0373937_1485888 3300036401 Bacteria 625
217 Ga0466963_0013024 3300044694 Bacteria 5098
218 Ga0466958_0896734 3300045836 Unclassified 578
219 Ga0466967_0880411 3300045976 Bacteria 890
220 Ga0495603_0140034 3300046455 Bacteria 1407
221 Ga0495580_0599774 3300046472 Unclassified 728
222 Ga0495586_0842458 3300046535 Bacteria 529
223 Ga0495645_0774759 3300046543 Bacteria 577
224 Ga0495659_0268263 3300046664 Bacteria 715
225 Ga0495659_0379415 3300046664 Unclassified 608
226 Ga0495588_0581499 3300046674 Unclassified 587
227 Ga0495658_0026898 3300046683 Bacteria 3089
228 Ga0495658_0240990 3300046683 Unclassified 1136
229 Ga0495669_0078873 3300046684 Unclassified 1509
230 Ga0495613_0761184 3300046689 Bacteria 634
231 Ga0495613_0816319 3300046689 Bacteria 608
232 Ga0495593_0545018 3300047673 Unclassified 582
233 Ga0496103_0950144 3300048906 Bacteria 537
234 Ga0496107_0451301 3300048910 Unclassified 955
235 Ga0496108_0358276 3300048911 Bacteria 1273
236 Ga0496109_0738204 3300048912 Bacteria 922
237 Ga0496109_1413228 3300048912 Unclassified 631
238 Ga0496110_0756193 3300048913 Bacteria 875
239 Ga0496112_0301624 3300048915 Bacteria 1547
240 Ga0496112_0537063 3300048915 Bacteria 1104
241 Ga0501067_0784660 3300049583 Unclassified 536
242 Ga0501074_0153006 3300049590 Bacteria 1649
243 Ga0501080_1408077 3300049742 Bacteria 595
244 Ga0501081_1520111 3300049743 Unclassified 508
245 nmdc:mga05p37_14016_c1 3300050507 Bacteria 9615
246 nmdc:mga05p37_226164_c1 3300050507 Bacteria 2256
247 nmdc:mga05p37_413403_c1 3300050507 Bacteria 1572
248 nmdc:mga05p37_70327_c1 3300050507 Bacteria 4304
249 nmdc:mga09592_21615_c2 3300050508 Bacteria 3254
250 nmdc:mga09592_516117_c1 3300050508 Bacteria 1028
251 nmdc:mga09592_524137_c1 3300050508 Bacteria 1019
252 nmdc:mga08y16_1726705_c1 3300050511 Unclassified 581
253 nmdc:mga08y16_981507_c1 3300050511 Bacteria 826
254 nmdc:mga0n895_1087780_c1 3300050512 Bacteria 777
255 nmdc:mga0n895_10_c1 3300050512 Bacteria 115544
256 nmdc:mga0n895_1125396_c1 3300050512 Bacteria 762
257 nmdc:mga0n895_1315478_c1 3300050512 Unclassified 693
258 nmdc:mga0n895_434543_c1 3300050512 Bacteria 1326
259 nmdc:mga0rr50_115204_c1 3300050513 Bacteria 2133
260 nmdc:mga0rr50_1245658_c1 3300050513 Unclassified 631
261 nmdc:mga0rr50_20_c1 3300050513 Bacteria 140799
262 nmdc:mga0rr50_240957_c1 3300050513 Bacteria 1499
263 nmdc:mga0rr50_60767_c1 3300050513 Bacteria 2844
264 nmdc:mga08x19_121175_c1 3300050514 Bacteria 1754
265 nmdc:mga08x19_319_c1 3300050514 Bacteria 34836
266 nmdc:mga08x19_38503_c1 3300050514 Unclassified 3038
267 nmdc:mga08x19_53961_c1 3300050514 Bacteria 2587
268 nmdc:mga08x19_933058_c1 3300050514 Bacteria 617
269 nmdc:mga0a205_590016_c1 3300050515 Bacteria 965
270 nmdc:mga0a205_612546_c1 3300050515 Bacteria 941
271 nmdc:mga0a205_87111_c1 3300050515 Bacteria 3017
272 Ga0495619_0626947 3300053085 Bacteria 735
273 Ga0501084_1138387 3300054114 Unclassified 655
274 Ga0530510_0237748 3300061734 Bacteria 1356

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046472 Ga0495580_0599774 Ga0495580_0599774_59_445 99
2 3300005841 Ga0068863_100007212 Ga0068863_1000072123 104
3 3300007788 Ga0099795_10528308 Ga0099795_105283082 104
4 3300025926 Ga0207659_10885642 Ga0207659_108856421 104
5 3300026088 Ga0207641_10000409 Ga0207641_1000040927 104
6 3300005354 Ga0070675_101820710 Ga0070675_1018207101 105
7 3300007076 Ga0075435_100211015 Ga0075435_1002110152 105
8 3300009101 Ga0105247_10623973 Ga0105247_106239733 105
9 3300009147 Ga0114129_10043922 Ga0114129_100439224 105
10 3300035084 Ga0373928_0081958 Ga0373928_0081958_438_776 105
11 3300035091 Ga0373951_0086538 Ga0373951_0086538_179_517 105
12 3300035114 Ga0373939_0048585 Ga0373939_0048585_446_784 105
13 3300035115 Ga0373941_0101037 Ga0373941_0101037_291_629 105
14 3300035691 Ga0373931_0611587 Ga0373931_0611587_155_493 105
15 3300048906 Ga0496103_0950144 Ga0496103_0950144_31_369 105
16 3300048913 Ga0496110_0756193 Ga0496110_0756193_372_710 105
17 3300050507 nmdc:mga05p37_70327_c1 nmdc:mga05p37_70327_c1_1555_1890 105
18 3300050512 nmdc:mga0n895_1087780_c1 nmdc:mga0n895_1087780_c1_275_613 105
19 3300050513 nmdc:mga0rr50_240957_c1 nmdc:mga0rr50_240957_c1_19_357 105
20 3300050515 nmdc:mga0a205_87111_c1 nmdc:mga0a205_87111_c1_2566_2904 105
21 3300005295 Ga0065707_10416263 Ga0065707_104162632 106
22 3300005331 Ga0070670_101151054 Ga0070670_1011510541 106
23 3300005340 Ga0070689_100063367 Ga0070689_1000633675 106
24 3300005354 Ga0070675_101104833 Ga0070675_1011048332 106
25 3300005434 Ga0070709_10193760 Ga0070709_101937602 106
26 3300005444 Ga0070694_101280182 Ga0070694_1012801822 106
27 3300005445 Ga0070708_101343284 Ga0070708_1013432842 106
28 3300005458 Ga0070681_11493697 Ga0070681_114936971 106
29 3300005471 Ga0070698_100056676 Ga0070698_1000566762 106
30 3300005549 Ga0070704_100737503 Ga0070704_1007375032 106
31 3300005617 Ga0068859_100244228 Ga0068859_1002442282 106
32 3300005985 Ga0081539_10012533 Ga0081539_100125333 106
33 3300005985 Ga0081539_10042640 Ga0081539_100426405 106
34 3300006028 Ga0070717_10915925 Ga0070717_109159252 106
35 3300006844 Ga0075428_100064003 Ga0075428_1000640033 106
36 3300006880 Ga0075429_100661830 Ga0075429_1006618302 106
37 3300006880 Ga0075429_101652407 Ga0075429_1016524072 106
38 3300006914 Ga0075436_100102752 Ga0075436_1001027522 106
39 3300006931 Ga0097620_100244220 Ga0097620_1002442202 106
40 3300009093 Ga0105240_10014014 Ga0105240_100140142 106
41 3300009093 Ga0105240_10543064 Ga0105240_105430642 106
42 3300009094 Ga0111539_10437848 Ga0111539_104378482 106
43 3300009094 Ga0111539_10696568 Ga0111539_106965682 106
44 3300009147 Ga0114129_10541827 Ga0114129_105418274 106
45 3300009147 Ga0114129_11996964 Ga0114129_119969642 106
46 3300014745 Ga0157377_10102726 Ga0157377_101027262 106
47 3300014968 Ga0157379_11540844 Ga0157379_115408441 106
48 3300014969 Ga0157376_11934027 Ga0157376_119340272 106
49 3300025906 Ga0207699_10993383 Ga0207699_109933832 106
50 3300025912 Ga0207707_11255614 Ga0207707_112556142 106
51 3300025913 Ga0207695_10057917 Ga0207695_100579175 106
52 3300025926 Ga0207659_10000321 Ga0207659_1000032119 106
53 3300025926 Ga0207659_10820135 Ga0207659_108201353 106
54 3300027907 Ga0207428_10577131 Ga0207428_105771311 106
55 3300027907 Ga0207428_11148094 Ga0207428_111480942 106
56 3300035114 Ga0373939_0063008 Ga0373939_0063008_728_1066 106
57 3300045836 Ga0466958_0896734 Ga0466958_0896734_213_551 106
58 3300046664 Ga0495659_0268263 Ga0495659_0268263_213_554 106
59 3300048910 Ga0496107_0451301 Ga0496107_0451301_92_430 106
60 3300048911 Ga0496108_0358276 Ga0496108_0358276_862_1200 106
61 3300048912 Ga0496109_0738204 Ga0496109_0738204_452_790 106
62 3300050507 nmdc:mga05p37_226164_c1 nmdc:mga05p37_226164_c1_16_354 106
63 3300050508 nmdc:mga09592_516117_c1 nmdc:mga09592_516117_c1_675_1013 106
64 3300050508 nmdc:mga09592_524137_c1 nmdc:mga09592_524137_c1_343_681 106
65 3300050511 nmdc:mga08y16_1726705_c1 nmdc:mga08y16_1726705_c1_123_461 106
66 3300050511 nmdc:mga08y16_981507_c1 nmdc:mga08y16_981507_c1_364_702 106
67 3300050513 nmdc:mga0rr50_1245658_c1 nmdc:mga0rr50_1245658_c1_182_520 106
68 3300050514 nmdc:mga08x19_121175_c1 nmdc:mga08x19_121175_c1_530_880 106
69 3300025910 Ga0207684_10820567 Ga0207684_108205671 107
70 3300044694 Ga0466963_0013024 Ga0466963_0013024_2023_2367 108
71 3300005468 Ga0070707_101084587 Ga0070707_1010845872 111
72 3300005518 Ga0070699_100186883 Ga0070699_1001868832 111
73 3300005536 Ga0070697_100275358 Ga0070697_1002753583 111
74 3300025922 Ga0207646_10359521 Ga0207646_103595211 111
75 3300005364 Ga0070673_101168951 Ga0070673_1011689512 113
76 3300005548 Ga0070665_100163570 Ga0070665_1001635703 113
77 3300005563 Ga0068855_100285795 Ga0068855_1002857952 113
78 3300005614 Ga0068856_100041738 Ga0068856_1000417383 113
79 3300005842 Ga0068858_100461427 Ga0068858_1004614272 113
80 3300009093 Ga0105240_10132406 Ga0105240_101324063 113
81 3300009177 Ga0105248_10681912 Ga0105248_106819121 113
82 3300013104 Ga0157370_10234645 Ga0157370_102346452 113
83 3300013308 Ga0157375_10889913 Ga0157375_108899133 113
84 3300014325 Ga0163163_10165285 Ga0163163_101652852 113
85 3300025913 Ga0207695_11238483 Ga0207695_112384831 113
86 3300025941 Ga0207711_10345070 Ga0207711_103450701 113
87 3300025944 Ga0207661_10011981 Ga0207661_100119813 113
88 3300026078 Ga0207702_10199436 Ga0207702_101994363 113
89 3300028379 Ga0268266_10009380 Ga0268266_100093808 113
90 3300035113 Ga0373936_0362663 Ga0373936_0362663_131_493 113
91 3300035170 Ga0373943_0384132 Ga0373943_0384132_29_391 113
92 3300035692 Ga0373935_0557054 Ga0373935_0557054_197_559 113
93 3300035725 Ga0373947_0066656 Ga0373947_0066656_422_784 113
94 3300036401 Ga0373937_0403447 Ga0373937_0403447_802_1164 113
95 3300046455 Ga0495603_0140034 Ga0495603_0140034_1034_1396 113
96 3300046674 Ga0495588_0581499 Ga0495588_0581499_67_429 113
97 3300046683 Ga0495658_0026898 Ga0495658_0026898_857_1219 113
98 3300046689 Ga0495613_0761184 Ga0495613_0761184_77_439 113
99 3300047673 Ga0495593_0545018 Ga0495593_0545018_87_449 113
100 3300005295 Ga0065707_10413841 Ga0065707_104138411 114
101 3300005295 Ga0065707_10821567 Ga0065707_108215671 114
102 3300005334 Ga0068869_100544438 Ga0068869_1005444382 114
103 3300005336 Ga0070680_101153136 Ga0070680_1011531362 114
104 3300005338 Ga0068868_100168603 Ga0068868_1001686032 114
105 3300005339 Ga0070660_100014636 Ga0070660_1000146364 114
106 3300005341 Ga0070691_10914536 Ga0070691_109145361 114
107 3300005343 Ga0070687_100061394 Ga0070687_1000613941 114
108 3300005354 Ga0070675_100153447 Ga0070675_1001534472 114
109 3300005364 Ga0070673_100860653 Ga0070673_1008606532 114
110 3300005366 Ga0070659_100102679 Ga0070659_1001026793 114
111 3300005434 Ga0070709_11222180 Ga0070709_112221801 114
112 3300005438 Ga0070701_11088015 Ga0070701_110880151 114
113 3300005440 Ga0070705_101114798 Ga0070705_1011147981 114
114 3300005444 Ga0070694_101445888 Ga0070694_1014458881 114
115 3300005458 Ga0070681_11709962 Ga0070681_117099621 114
116 3300005459 Ga0068867_101921577 Ga0068867_1019215771 114
117 3300005466 Ga0070685_11014836 Ga0070685_110148361 114
118 3300005467 Ga0070706_100525384 Ga0070706_1005253842 114
119 3300005468 Ga0070707_100106381 Ga0070707_1001063813 114
120 3300005471 Ga0070698_100189614 Ga0070698_1001896142 114
121 3300005518 Ga0070699_100549305 Ga0070699_1005493052 114
122 3300005530 Ga0070679_100393855 Ga0070679_1003938552 114
123 3300005530 Ga0070679_100447259 Ga0070679_1004472592 114
124 3300005530 Ga0070679_101672692 Ga0070679_1016726921 114
125 3300005539 Ga0068853_101157286 Ga0068853_1011572862 114
126 3300005544 Ga0070686_100020103 Ga0070686_1000201032 114
127 3300005545 Ga0070695_100133176 Ga0070695_1001331762 114
128 3300005545 Ga0070695_101592250 Ga0070695_1015922502 114
129 3300005547 Ga0070693_100050533 Ga0070693_1000505332 114
130 3300005563 Ga0068855_100022574 Ga0068855_1000225743 114
131 3300005578 Ga0068854_100014062 Ga0068854_1000140623 114
132 3300005578 Ga0068854_100045603 Ga0068854_1000456035 114
133 3300005616 Ga0068852_101139079 Ga0068852_1011390792 114
134 3300005617 Ga0068859_100404996 Ga0068859_1004049962 114
135 3300005617 Ga0068859_101484130 Ga0068859_1014841301 114
136 3300005618 Ga0068864_100596534 Ga0068864_1005965342 114
137 3300005718 Ga0068866_10396205 Ga0068866_103962052 114
138 3300005719 Ga0068861_100036985 Ga0068861_1000369853 114
139 3300005842 Ga0068858_100049888 Ga0068858_1000498883 114
140 3300005842 Ga0068858_100502094 Ga0068858_1005020942 114
141 3300005843 Ga0068860_102678156 Ga0068860_1026781561 114
142 3300005844 Ga0068862_100857809 Ga0068862_1008578092 114
143 3300005844 Ga0068862_102419362 Ga0068862_1024193622 114
144 3300006237 Ga0097621_100059334 Ga0097621_1000593342 114
145 3300006237 Ga0097621_100486785 Ga0097621_1004867852 114
146 3300006237 Ga0097621_102346369 Ga0097621_1023463692 114
147 3300006358 Ga0068871_100051184 Ga0068871_1000511845 114
148 3300006847 Ga0075431_100013395 Ga0075431_1000133955 114
149 3300006852 Ga0075433_10220526 Ga0075433_102205264 114
150 3300006852 Ga0075433_10884814 Ga0075433_108848142 114
151 3300006871 Ga0075434_100008885 Ga0075434_1000088858 114
152 3300006871 Ga0075434_101637208 Ga0075434_1016372081 114
153 3300006871 Ga0075434_101652448 Ga0075434_1016524482 114
154 3300006880 Ga0075429_100149587 Ga0075429_1001495874 114
155 3300006881 Ga0068865_100007288 Ga0068865_1000072886 114
156 3300006914 Ga0075436_100000233 Ga0075436_10000023320 114
157 3300006914 Ga0075436_100029792 Ga0075436_1000297924 114
158 3300006914 Ga0075436_100036392 Ga0075436_1000363922 114
159 3300006914 Ga0075436_100084827 Ga0075436_1000848273 114
160 3300006931 Ga0097620_100404979 Ga0097620_1004049792 114
161 3300006931 Ga0097620_101484597 Ga0097620_1014845971 114
162 3300007076 Ga0075435_100000220 Ga0075435_10000022020 114
163 3300007076 Ga0075435_100285406 Ga0075435_1002854061 114
164 3300007076 Ga0075435_100619838 Ga0075435_1006198382 114
165 3300009093 Ga0105240_10062935 Ga0105240_100629355 114
166 3300009093 Ga0105240_10085699 Ga0105240_100856994 114
167 3300009098 Ga0105245_10230764 Ga0105245_102307641 114
168 3300009098 Ga0105245_11141824 Ga0105245_111418241 114
169 3300009101 Ga0105247_10997740 Ga0105247_109977402 114
170 3300009147 Ga0114129_10048650 Ga0114129_100486502 114
171 3300009147 Ga0114129_11410730 Ga0114129_114107302 114
172 3300009147 Ga0114129_12368045 Ga0114129_123680452 114
173 3300009148 Ga0105243_10789584 Ga0105243_107895842 114
174 3300009174 Ga0105241_10068438 Ga0105241_100684382 114
175 3300009176 Ga0105242_10014004 Ga0105242_100140047 114
176 3300009177 Ga0105248_10209164 Ga0105248_102091643 114
177 3300009177 Ga0105248_10342991 Ga0105248_103429912 114
178 3300009177 Ga0105248_10353440 Ga0105248_103534402 114
179 3300009177 Ga0105248_10519000 Ga0105248_105190002 114
180 3300009177 Ga0105248_10548686 Ga0105248_105486861 114
181 3300009553 Ga0105249_10122381 Ga0105249_101223813 114
182 3300009553 Ga0105249_10770184 Ga0105249_107701841 114
183 3300011119 Ga0105246_10199093 Ga0105246_101990932 114
184 3300013296 Ga0157374_12024673 Ga0157374_120246732 114
185 3300013308 Ga0157375_11273394 Ga0157375_112733942 114
186 3300014325 Ga0163163_10434627 Ga0163163_104346273 114
187 3300014326 Ga0157380_12749724 Ga0157380_127497242 114
188 3300014968 Ga0157379_11319621 Ga0157379_113196212 114
189 3300014969 Ga0157376_10033464 Ga0157376_100334646 114
190 3300014969 Ga0157376_10116360 Ga0157376_101163604 114
191 3300025899 Ga0207642_10236215 Ga0207642_102362152 114
192 3300025903 Ga0207680_10016138 Ga0207680_100161384 114
193 3300025907 Ga0207645_10214894 Ga0207645_102148942 114
194 3300025909 Ga0207705_10485204 Ga0207705_104852042 114
195 3300025910 Ga0207684_10258378 Ga0207684_102583782 114
196 3300025911 Ga0207654_10378834 Ga0207654_103788341 114
197 3300025912 Ga0207707_10270684 Ga0207707_102706842 114
198 3300025913 Ga0207695_10149476 Ga0207695_101494762 114
199 3300025918 Ga0207662_10306867 Ga0207662_103068673 114
200 3300025919 Ga0207657_10057672 Ga0207657_100576721 114
201 3300025921 Ga0207652_10335580 Ga0207652_103355802 114
202 3300025923 Ga0207681_11174270 Ga0207681_111742701 114
203 3300025927 Ga0207687_10111812 Ga0207687_101118125 114
204 3300025927 Ga0207687_10611444 Ga0207687_106114442 114
205 3300025931 Ga0207644_11717867 Ga0207644_117178672 114
206 3300025932 Ga0207690_10065447 Ga0207690_100654474 114
207 3300025932 Ga0207690_10312747 Ga0207690_103127471 114
208 3300025934 Ga0207686_10053537 Ga0207686_100535375 114
209 3300025935 Ga0207709_11189081 Ga0207709_111890811 114
210 3300025937 Ga0207669_11266150 Ga0207669_112661501 114
211 3300025938 Ga0207704_10008471 Ga0207704_100084713 114
212 3300025938 Ga0207704_10717918 Ga0207704_107179182 114
213 3300025939 Ga0207665_10522217 Ga0207665_105222172 114
214 3300025941 Ga0207711_10227735 Ga0207711_102277352 114
215 3300025941 Ga0207711_11001586 Ga0207711_110015861 114
216 3300025941 Ga0207711_11097513 Ga0207711_110975132 114
217 3300025949 Ga0207667_10056741 Ga0207667_100567414 114
218 3300025960 Ga0207651_10269038 Ga0207651_102690383 114
219 3300025960 Ga0207651_10764133 Ga0207651_107641332 114
220 3300025961 Ga0207712_10514098 Ga0207712_105140982 114
221 3300025981 Ga0207640_10004967 Ga0207640_100049676 114
222 3300026023 Ga0207677_10063802 Ga0207677_100638023 114
223 3300026023 Ga0207677_10106839 Ga0207677_101068393 114
224 3300026035 Ga0207703_10079782 Ga0207703_100797822 114
225 3300026035 Ga0207703_10135469 Ga0207703_101354694 114
226 3300026035 Ga0207703_10542217 Ga0207703_105422172 114
227 3300026041 Ga0207639_10453981 Ga0207639_104539812 114
228 3300026078 Ga0207702_11076449 Ga0207702_110764492 114
229 3300026089 Ga0207648_10025386 Ga0207648_100253863 114
230 3300026089 Ga0207648_10345280 Ga0207648_103452802 114
231 3300026118 Ga0207675_100030835 Ga0207675_1000308353 114
232 3300026118 Ga0207675_100142783 Ga0207675_1001427832 114
233 3300026121 Ga0207683_10028853 Ga0207683_100288532 114
234 3300026142 Ga0207698_11010203 Ga0207698_110102032 114
235 3300028380 Ga0268265_11095281 Ga0268265_110952812 114
236 3300028381 Ga0268264_10217406 Ga0268264_102174061 114
237 3300028381 Ga0268264_10317000 Ga0268264_103170002 114
238 3300032002 Ga0307416_103536362 Ga0307416_1035363622 114
239 3300035113 Ga0373936_0407205 Ga0373936_0407205_212_577 114
240 3300035241 Ga0373961_0427033 Ga0373961_0427033_26_388 114
241 3300036401 Ga0373937_1485888 Ga0373937_1485888_127_495 114
242 3300045976 Ga0466967_0880411 Ga0466967_0880411_84_449 114
243 3300046535 Ga0495586_0842458 Ga0495586_0842458_54_419 114
244 3300046543 Ga0495645_0774759 Ga0495645_0774759_103_468 114
245 3300046664 Ga0495659_0379415 Ga0495659_0379415_159_527 114
246 3300046683 Ga0495658_0240990 Ga0495658_0240990_39_404 114
247 3300046684 Ga0495669_0078873 Ga0495669_0078873_901_1263 114
248 3300046689 Ga0495613_0816319 Ga0495613_0816319_136_501 114
249 3300048912 Ga0496109_1413228 Ga0496109_1413228_151_516 114
250 3300048915 Ga0496112_0301624 Ga0496112_0301624_704_1069 114
251 3300048915 Ga0496112_0537063 Ga0496112_0537063_165_530 114
252 3300049583 Ga0501067_0784660 Ga0501067_0784660_159_521 114
253 3300049590 Ga0501074_0153006 Ga0501074_0153006_734_1096 114
254 3300049742 Ga0501080_1408077 Ga0501080_1408077_64_426 114
255 3300049743 Ga0501081_1520111 Ga0501081_1520111_60_422 114
256 3300050507 nmdc:mga05p37_14016_c1 nmdc:mga05p37_14016_c1_7003_7365 114
257 3300050507 nmdc:mga05p37_413403_c1 nmdc:mga05p37_413403_c1_991_1356 114
258 3300050508 nmdc:mga09592_21615_c2 nmdc:mga09592_21615_c2_2409_2771 114
259 3300050512 nmdc:mga0n895_10_c1 nmdc:mga0n895_10_c1_57405_57776 114
260 3300050512 nmdc:mga0n895_1125396_c1 nmdc:mga0n895_1125396_c1_244_606 114
261 3300050512 nmdc:mga0n895_1315478_c1 nmdc:mga0n895_1315478_c1_187_552 114
262 3300050512 nmdc:mga0n895_434543_c1 nmdc:mga0n895_434543_c1_806_1168 114
263 3300050513 nmdc:mga0rr50_115204_c1 nmdc:mga0rr50_115204_c1_1511_1873 114
264 3300050513 nmdc:mga0rr50_20_c1 nmdc:mga0rr50_20_c1_108836_109207 114
265 3300050513 nmdc:mga0rr50_60767_c1 nmdc:mga0rr50_60767_c1_1209_1574 114
266 3300050514 nmdc:mga08x19_319_c1 nmdc:mga08x19_319_c1_13999_14370 114
267 3300050514 nmdc:mga08x19_38503_c1 nmdc:mga08x19_38503_c1_1602_1964 114
268 3300050514 nmdc:mga08x19_53961_c1 nmdc:mga08x19_53961_c1_1924_2289 114
269 3300050514 nmdc:mga08x19_933058_c1 nmdc:mga08x19_933058_c1_235_597 114
270 3300050515 nmdc:mga0a205_590016_c1 nmdc:mga0a205_590016_c1_375_737 114
271 3300050515 nmdc:mga0a205_612546_c1 nmdc:mga0a205_612546_c1_333_698 114
272 3300053085 Ga0495619_0626947 Ga0495619_0626947_98_463 114
273 3300054114 Ga0501084_1138387 Ga0501084_1138387_182_544 114
274 3300061734 Ga0530510_0237748 Ga0530510_0237748_360_722 114

Structural Annotation

Top 5 Hits

ID Description Score Start End
4exr-assembly1.cif.gz_A-2 crystal structure of a putative lipoprotein (cd1622) from clostridium difficile 630 at 1.85 a resolution 0.8443 3 41
4cie-assembly1.cif.gz_B interrogating hiv integrase for compounds that bind- a sampl challenge 0.7828 11 43
4hei-assembly1.cif.gz_A 2a x-ray structure of hpf from vibrio cholerae 0.7777 11 64
4y1c-assembly1.cif.gz_A cyclic hexapeptide cyc[ndpoppkid] in complex with hiv-1 integrase core domain 0.7666 11 43
7rq0-assembly1.cif.gz_A hiv integrase core domain in complex with 2-{2-[2-(3-{[4-(2-{[(3-{2-[3-(carboxymethyl)-5-methyl-1-benzofuran-2-yl]ethynyl}phenyl)methyl]amino}ethyl)piperazin-1-yl]methyl}phenyl)ethynyl]-5-methyl-1-benzofuran-3-yl}acetic acid 0.7622 11 42
ID Description Score Start End Superfamily
4exrA02 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8463 2 41 3.10.450.40
af_Q2R1C4_54_370_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8424 8 40 2.130.10.10
af_A0A1D6F7L1_9_383_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8182 8 44 2.130.10.10
af_Q6NZ00_121_481_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8119 10 41 2.130.10.10
af_Q8IKJ1_766_1052_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8021 11 40 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A1Q5R0V5-F1-model_v4 PepSY domain-containing protein 0.8573 2 40
AF-A0A0G1VUM0-F1-model_v4 Uncharacterized protein 0.8263 2 41
AF-A0A2V8GVU1-F1-model_v4 Uncharacterized protein 0.8239 2 73
AF-A0A2E6I2V6-F1-model_v4 Ribosomal subunit interface protein 0.8212 11 67 GO:0006417
AF-A0A2H0VN56-F1-model_v4 Ribosomal subunit interface protein 0.8201 11 70 GO:0022627
GO:0043024
GO:0045900

Feature Viewer

pLDDT pTM Quality
76.33 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map