F379461
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 274 | 150 | 549 | 307 |
Family's Representative Sequence
| Representative Sequence | 3300005288|Ga0065714_10156273|Ga0065714_101562731 |
| Length | 315 |
| Sequence | MDFGKVAADELQAIDFSLPADGQQTAQTLSGKPAVKAPAFYVGCAKWGRKEWLNMIYPAKTKEANFLDEYVKHFNAIELNAVFYSLPKPEQIRKWKEKAALNSKNGFLFCPKFSQSISHLKRLKGAEAATDIFLSGISEFGEYLGPCFLQMGDNFGPKNKEILQAYLESLPADLSMFVELRNPEWFSLESNRRPLFEMLAGLNKGAAITDASGRRDVIHMELTIPEVFIRFVGNGADFKASDEARIDEWVKRLKVWLGNGLEKVYFFLHQHDEKDTPILANYTIRAFNKHLGSDLAEINFLGGKNGEITKDPQLF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 30 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 31 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 32 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 34 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 35 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 54 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 55 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 59 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 86 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 87 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 88 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 89 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 90 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 91 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 92 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 93 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 94 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 95 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 96 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 97 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 98 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 99 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 100 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 122 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 123 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 126 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 127 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 128 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 129 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 130 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 131 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 132 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 133 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 134 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 135 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 136 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 137 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 138 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 139 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 140 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 141 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 142 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 143 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 144 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 145 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 146 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 147 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 148 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 149 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 150 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.8 |
| Metatranscriptomes | 0 |
| Isolates | 6.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.03 |
| Nodule | 0 |
| Rhizoplane | 0.36 |
| Rhizosphere | 82.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065714_10156273 | 3300005288 | Bacteria | 1076 |
| 2 | JGI24740J21852_10027893 | 3300001979 | Bacteria | 1872 |
| 3 | JGI24737J22298_10005142 | 3300001990 | Bacteria | 4530 |
| 4 | JGI24735J21928_10000010 | 3300002067 | Bacteria | 237152 |
| 5 | JGI24744J21845_10011948 | 3300002077 | Bacteria | 1767 |
| 6 | JGI25162J39368_1002344 | 3300002737 | Bacteria | 7528 |
| 7 | JGI25164J39214_1001190 | 3300002772 | Bacteria | 7096 |
| 8 | JGI25165J46597_1002156 | 3300003214 | Bacteria | 7041 |
| 9 | rootH2_10001801 | 3300003320 | Bacteria | 92828 |
| 10 | rootH1_10052820 | 3300003323 | Bacteria | 1408 |
| 11 | rootH1_10063144 | 3300003323 | Bacteria | 5622 |
| 12 | rootH1_10079737 | 3300003316 | Bacteria | 2545 |
| 13 | rootH1_10079737 | 3300003323 | Bacteria | 9309 |
| 14 | rootH1_10129368 | 3300003323 | Bacteria | 3701 |
| 15 | rootH1_10187950 | 3300003323 | Bacteria | 1481 |
| 16 | Ga0065714_10002962 | 3300005288 | Bacteria | 12102 |
| 17 | Ga0065714_10015604 | 3300005288 | Bacteria | 2689 |
| 18 | Ga0065714_10073549 | 3300005288 | Bacteria | 3165 |
| 19 | Ga0065704_10070382 | 3300005289 | Bacteria | 27921 |
| 20 | Ga0065704_10075467 | 3300005289 | Bacteria | 5578 |
| 21 | Ga0070658_10000098 | 3300005327 | Bacteria | 76892 |
| 22 | Ga0070658_10120057 | 3300005327 | Bacteria | 2184 |
| 23 | Ga0070658_10153163 | 3300005327 | Bacteria | 1931 |
| 24 | Ga0070676_10117858 | 3300005328 | Bacteria | 1662 |
| 25 | Ga0070660_100023899 | 3300005339 | Bacteria | 4532 |
| 26 | Ga0070673_100032881 | 3300005364 | Bacteria | 3910 |
| 27 | Ga0070659_100002023 | 3300005366 | Bacteria | 14496 |
| 28 | Ga0070659_100009213 | 3300005366 | Bacteria | 7245 |
| 29 | Ga0070659_100095397 | 3300005366 | Bacteria | 2389 |
| 30 | Ga0070662_100000055 | 3300005457 | Bacteria | 60567 |
| 31 | Ga0070681_10005874 | 3300005458 | Bacteria | 11884 |
| 32 | Ga0068867_100060417 | 3300005459 | Bacteria | 2811 |
| 33 | Ga0070679_100010095 | 3300005530 | Bacteria | 8949 |
| 34 | Ga0070679_100068565 | 3300005530 | Bacteria | 3538 |
| 35 | Ga0070684_100123404 | 3300005535 | Bacteria | 2331 |
| 36 | Ga0068853_100107145 | 3300005539 | Bacteria | 2478 |
| 37 | Ga0070665_100000034 | 3300005548 | Bacteria | 324289 |
| 38 | Ga0070665_100283964 | 3300005548 | Bacteria | 1657 |
| 39 | Ga0068855_100000014 | 3300005563 | Bacteria | 232720 |
| 40 | Ga0068855_100001684 | 3300005563 | Bacteria | 27684 |
| 41 | Ga0068855_100002892 | 3300005563 | Bacteria | 21009 |
| 42 | Ga0068855_100022061 | 3300005563 | Bacteria | 7633 |
| 43 | Ga0068857_100064315 | 3300005577 | Bacteria | 3262 |
| 44 | Ga0068854_100013040 | 3300005578 | Bacteria | 5448 |
| 45 | Ga0068856_100001438 | 3300005614 | Bacteria | 24989 |
| 46 | Ga0068856_100025448 | 3300005614 | Bacteria | 5772 |
| 47 | Ga0068856_100269790 | 3300005614 | Bacteria | 1717 |
| 48 | Ga0068852_100005288 | 3300005616 | Bacteria | 9216 |
| 49 | Ga0068866_10005898 | 3300005718 | Bacteria | 5090 |
| 50 | Ga0068866_10083479 | 3300005718 | Bacteria | 1721 |
| 51 | Ga0068858_100093634 | 3300005842 | Bacteria | 2797 |
| 52 | Ga0075366_10002020 | 3300006195 | Bacteria | 10299 |
| 53 | Ga0075366_10007934 | 3300006195 | Bacteria | 5874 |
| 54 | Ga0075366_10040015 | 3300006195 | Bacteria | 2772 |
| 55 | Ga0097621_100001881 | 3300006237 | Bacteria | 14366 |
| 56 | Ga0068871_100000099 | 3300006358 | Bacteria | 51278 |
| 57 | Ga0068865_100000187 | 3300006881 | Bacteria | 34573 |
| 58 | Ga0105240_10000010 | 3300009093 | Bacteria | 537830 |
| 59 | Ga0105240_10015631 | 3300009093 | Bacteria | 10307 |
| 60 | Ga0105240_10034424 | 3300009093 | Bacteria | 6533 |
| 61 | Ga0105240_10040647 | 3300009093 | Bacteria | 5944 |
| 62 | Ga0105240_10046447 | 3300009093 | Bacteria | 5502 |
| 63 | Ga0105240_10068095 | 3300009093 | Bacteria | 4410 |
| 64 | Ga0105240_10348078 | 3300009093 | Bacteria | 1682 |
| 65 | Ga0105243_10460811 | 3300009148 | Bacteria | 1195 |
| 66 | Ga0105241_10000727 | 3300009174 | Bacteria | 24962 |
| 67 | Ga0105241_10102221 | 3300009174 | Bacteria | 2280 |
| 68 | Ga0105241_10109596 | 3300009174 | Bacteria | 2208 |
| 69 | Ga0105242_10254705 | 3300009176 | Bacteria | 1583 |
| 70 | Ga0105237_10001016 | 3300009545 | Bacteria | 37771 |
| 71 | Ga0105237_10002361 | 3300009545 | Bacteria | 23426 |
| 72 | Ga0105237_10004656 | 3300009545 | Bacteria | 15799 |
| 73 | Ga0105237_10023513 | 3300009545 | Bacteria | 6313 |
| 74 | Ga0105237_10025546 | 3300009545 | Bacteria | 6039 |
| 75 | Ga0105237_10068729 | 3300009545 | Bacteria | 3537 |
| 76 | Ga0105237_10080221 | 3300009545 | Bacteria | 3253 |
| 77 | Ga0105237_10331099 | 3300009545 | Bacteria | 1527 |
| 78 | Ga0105238_10021353 | 3300009551 | Bacteria | 6596 |
| 79 | Ga0105238_10064870 | 3300009551 | Bacteria | 3652 |
| 80 | Ga0105238_10338042 | 3300009551 | Bacteria | 1493 |
| 81 | Ga0105249_10250137 | 3300009553 | Bacteria | 1757 |
| 82 | Ga0105239_10000001 | 3300010375 | Bacteria | 617353 |
| 83 | Ga0105239_10000298 | 3300010375 | Bacteria | 73328 |
| 84 | Ga0105239_10001594 | 3300010375 | Bacteria | 29975 |
| 85 | Ga0105239_10004573 | 3300010375 | Bacteria | 16492 |
| 86 | Ga0105239_10005167 | 3300010375 | Bacteria | 15395 |
| 87 | Ga0105239_10020659 | 3300010375 | Bacteria | 7265 |
| 88 | Ga0105239_10035825 | 3300010375 | Bacteria | 5449 |
| 89 | Ga0105239_10038826 | 3300010375 | Bacteria | 5216 |
| 90 | Ga0105239_10157166 | 3300010375 | Bacteria | 2540 |
| 91 | Ga0105246_10083529 | 3300011119 | Bacteria | 2282 |
| 92 | Ga0157373_10000075 | 3300013100 | Bacteria | 85818 |
| 93 | Ga0157373_10002917 | 3300013100 | Bacteria | 12953 |
| 94 | Ga0157373_10042754 | 3300013100 | Bacteria | 3238 |
| 95 | Ga0157373_10129933 | 3300013100 | Bacteria | 1771 |
| 96 | Ga0157371_10000355 | 3300013102 | Bacteria | 58322 |
| 97 | Ga0157371_10004223 | 3300013102 | Bacteria | 12636 |
| 98 | Ga0157371_10020490 | 3300013102 | Bacteria | 4866 |
| 99 | Ga0157371_10207486 | 3300013102 | Bacteria | 1405 |
| 100 | Ga0157370_10000207 | 3300013104 | Bacteria | 74451 |
| 101 | Ga0157370_10019356 | 3300013104 | Bacteria | 6831 |
| 102 | Ga0157370_10125668 | 3300013104 | Unclassified | 2393 |
| 103 | Ga0157369_10005034 | 3300013105 | Bacteria | 15467 |
| 104 | Ga0157369_10031426 | 3300013105 | Bacteria | 5846 |
| 105 | Ga0157369_10060525 | 3300013105 | Bacteria | 4083 |
| 106 | Ga0157374_10000217 | 3300013296 | Bacteria | 52933 |
| 107 | Ga0157374_10001183 | 3300013296 | Bacteria | 22283 |
| 108 | Ga0157374_10001211 | 3300013296 | Bacteria | 22059 |
| 109 | Ga0157378_10223392 | 3300013297 | Bacteria | 1791 |
| 110 | Ga0163162_10000018 | 3300013306 | Bacteria | 226257 |
| 111 | Ga0163162_10002608 | 3300013306 | Bacteria | 17087 |
| 112 | Ga0163162_10061962 | 3300013306 | Bacteria | 3779 |
| 113 | Ga0163162_10353830 | 3300013306 | Bacteria | 1601 |
| 114 | Ga0157372_10000070 | 3300013307 | Bacteria | 109649 |
| 115 | Ga0157372_10000325 | 3300013307 | Bacteria | 52408 |
| 116 | Ga0157372_10042984 | 3300013307 | Bacteria | 5002 |
| 117 | Ga0157372_10044897 | 3300013307 | Bacteria | 4898 |
| 118 | Ga0157375_10006966 | 3300013308 | Bacteria | 9871 |
| 119 | Ga0157375_10114389 | 3300013308 | Bacteria | 2800 |
| 120 | Ga0182008_10000009 | 3300014497 | Bacteria | 331416 |
| 121 | Ga0182008_10001007 | 3300014497 | Bacteria | 19580 |
| 122 | Ga0182006_1000332 | 3300015261 | Bacteria | 40804 |
| 123 | Ga0209563_104982 | 3300025230 | Bacteria | 2468 |
| 124 | Ga0207427_101278 | 3300025231 | Bacteria | 9575 |
| 125 | Ga0209437_100024 | 3300025233 | Bacteria | 592878 |
| 126 | Ga0209437_100093 | 3300025233 | Bacteria | 239733 |
| 127 | Ga0209026_1000416 | 3300025250 | Bacteria | 36810 |
| 128 | Ga0209026_1003396 | 3300025250 | Bacteria | 5252 |
| 129 | Ga0209026_1007019 | 3300025250 | Bacteria | 2625 |
| 130 | Ga0209233_1000089 | 3300025261 | Bacteria | 316381 |
| 131 | Ga0209233_1001629 | 3300025261 | Bacteria | 8736 |
| 132 | Ga0207642_10020748 | 3300025899 | Bacteria | 2572 |
| 133 | Ga0207647_10000067 | 3300025904 | Bacteria | 81496 |
| 134 | Ga0207647_10000755 | 3300025904 | Bacteria | 25308 |
| 135 | Ga0207645_10000046 | 3300025907 | Bacteria | 85043 |
| 136 | Ga0207705_10000118 | 3300025909 | Bacteria | 88199 |
| 137 | Ga0207705_10407463 | 3300025909 | Bacteria | 1052 |
| 138 | Ga0207707_10003579 | 3300025912 | Bacteria | 13773 |
| 139 | Ga0207695_10000019 | 3300025913 | Bacteria | 732137 |
| 140 | Ga0207695_10012061 | 3300025913 | Bacteria | 10392 |
| 141 | Ga0207695_10030628 | 3300025913 | Bacteria | 5920 |
| 142 | Ga0207695_10032996 | 3300025913 | Bacteria | 5656 |
| 143 | Ga0207695_10066447 | 3300025913 | Bacteria | 3703 |
| 144 | Ga0207695_10068312 | 3300025913 | Bacteria | 3641 |
| 145 | Ga0207671_10001003 | 3300025914 | Bacteria | 34695 |
| 146 | Ga0207671_10002246 | 3300025914 | Bacteria | 20914 |
| 147 | Ga0207671_10004633 | 3300025914 | Bacteria | 13032 |
| 148 | Ga0207671_10011830 | 3300025914 | Bacteria | 7061 |
| 149 | Ga0207671_10017278 | 3300025914 | Bacteria | 5568 |
| 150 | Ga0207671_10033387 | 3300025914 | Bacteria | 3828 |
| 151 | Ga0207671_10033520 | 3300025914 | Bacteria | 3819 |
| 152 | Ga0207671_10074940 | 3300025914 | Bacteria | 2530 |
| 153 | Ga0207671_10174475 | 3300025914 | Bacteria | 1670 |
| 154 | Ga0207671_10352500 | 3300025914 | Bacteria | 1167 |
| 155 | Ga0207660_10022403 | 3300025917 | Bacteria | 4256 |
| 156 | Ga0207657_10039922 | 3300025919 | Bacteria | 4164 |
| 157 | Ga0207652_10011141 | 3300025921 | Bacteria | 7247 |
| 158 | Ga0207652_10233754 | 3300025921 | Bacteria | 1657 |
| 159 | Ga0207694_10049358 | 3300025924 | Bacteria | 3258 |
| 160 | Ga0207694_10094834 | 3300025924 | Bacteria | 2358 |
| 161 | Ga0207644_10051860 | 3300025931 | Bacteria | 2946 |
| 162 | Ga0207690_10001524 | 3300025932 | Bacteria | 14496 |
| 163 | Ga0207690_10005770 | 3300025932 | Bacteria | 7321 |
| 164 | Ga0207690_10020565 | 3300025932 | Bacteria | 4081 |
| 165 | Ga0207706_10000123 | 3300025933 | Bacteria | 83810 |
| 166 | Ga0207686_10055457 | 3300025934 | Bacteria | 2487 |
| 167 | Ga0207704_10000058 | 3300025938 | Bacteria | 77010 |
| 168 | Ga0207667_10000049 | 3300025949 | Bacteria | 235027 |
| 169 | Ga0207667_10002331 | 3300025949 | Bacteria | 23775 |
| 170 | Ga0207667_10002437 | 3300025949 | Bacteria | 23292 |
| 171 | Ga0207667_10137519 | 3300025949 | Bacteria | 2516 |
| 172 | Ga0207667_10274033 | 3300025949 | Bacteria | 1725 |
| 173 | Ga0207651_10018002 | 3300025960 | Bacteria | 4191 |
| 174 | Ga0207640_10053912 | 3300025981 | Bacteria | 2627 |
| 175 | Ga0207677_10164523 | 3300026023 | Bacteria | 1728 |
| 176 | Ga0207639_10042117 | 3300026041 | Bacteria | 3421 |
| 177 | Ga0207702_10006339 | 3300026078 | Bacteria | 10221 |
| 178 | Ga0207648_10047425 | 3300026089 | Bacteria | 3766 |
| 179 | Ga0207698_10041760 | 3300026142 | Bacteria | 3421 |
| 180 | Ga0268266_10000111 | 3300028379 | Bacteria | 169743 |
| 181 | Ga0268266_10260772 | 3300028379 | Bacteria | 1606 |
| 182 | Ga0307517_10015866 | 3300028786 | Bacteria | 9960 |
| 183 | Ga0307515_10001207 | 3300028794 | Bacteria | 59017 |
| 184 | Ga0307515_10001331 | 3300028794 | Bacteria | 55969 |
| 185 | Ga0307515_10011788 | 3300028794 | Bacteria | 16544 |
| 186 | Ga0307408_100000631 | 3300031548 | Bacteria | 29818 |
| 187 | Ga0307408_100006557 | 3300031548 | Bacteria | 7714 |
| 188 | Ga0307408_100030401 | 3300031548 | Bacteria | 3750 |
| 189 | Ga0307405_10002409 | 3300031731 | Bacteria | 8233 |
| 190 | Ga0307412_10000084 | 3300031911 | Bacteria | 90908 |
| 191 | Ga0307412_10002425 | 3300031911 | Bacteria | 10364 |
| 192 | Ga0307412_10026399 | 3300031911 | Bacteria | 3610 |
| 193 | Ga0307414_10008568 | 3300032004 | Bacteria | 5811 |
| 194 | Ga0307414_10122551 | 3300032004 | Bacteria | 2002 |
| 195 | Ga0307507_10000034 | 3300033179 | Bacteria | 188697 |
| 196 | Ga0307510_10015806 | 3300033180 | Bacteria | 8921 |
| 197 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 198 | Ga0395899_0000087 | 3300037312 | Bacteria | 157502 |
| 199 | Ga0395899_0007220 | 3300037312 | Bacteria | 8599 |
| 200 | Ga0395900_0000141 | 3300037418 | Bacteria | 121159 |
| 201 | Ga0395900_0000155 | 3300037418 | Bacteria | 113606 |
| 202 | Ga0395898_0026547 | 3300037466 | Bacteria | 5825 |
| 203 | Ga0395905_0000124 | 3300037471 | Bacteria | 126707 |
| 204 | Ga0395905_0000266 | 3300037471 | Bacteria | 78131 |
| 205 | Ga0395901_0000138 | 3300038443 | Bacteria | 94944 |
| 206 | Ga0395901_0018250 | 3300038443 | Bacteria | 7163 |
| 207 | Ga0436361_1090084 | 3300039447 | Bacteria | 7515 |
| 208 | Ga0466963_0260016 | 3300044694 | Bacteria | 1219 |
| 209 | Ga0495650_0000127 | 3300046471 | Bacteria | 177276 |
| 210 | Ga0495585_0000088 | 3300046492 | Bacteria | 96490 |
| 211 | Ga0495585_0176069 | 3300046492 | Bacteria | 1102 |
| 212 | Ga0495596_0042180 | 3300046500 | Bacteria | 1798 |
| 213 | Ga0495583_0061464 | 3300046506 | Bacteria | 1676 |
| 214 | Ga0495606_0000033 | 3300046507 | Bacteria | 247739 |
| 215 | Ga0495606_0020130 | 3300046507 | Bacteria | 4933 |
| 216 | Ga0495606_0024496 | 3300046507 | Bacteria | 4347 |
| 217 | Ga0495606_0056676 | 3300046507 | Bacteria | 2528 |
| 218 | Ga0495610_0005698 | 3300046512 | Bacteria | 8779 |
| 219 | Ga0495616_0008296 | 3300046513 | Bacteria | 6166 |
| 220 | Ga0495616_0022904 | 3300046513 | Bacteria | 3367 |
| 221 | Ga0495631_0025914 | 3300046518 | Bacteria | 2696 |
| 222 | Ga0495632_0134523 | 3300046519 | Bacteria | 1149 |
| 223 | Ga0495637_0099317 | 3300046520 | Bacteria | 1139 |
| 224 | Ga0495648_0003282 | 3300046524 | Bacteria | 14297 |
| 225 | Ga0495609_0003980 | 3300046538 | Bacteria | 8254 |
| 226 | Ga0495633_0000177 | 3300046558 | Bacteria | 82953 |
| 227 | Ga0495633_0006763 | 3300046558 | Bacteria | 6739 |
| 228 | Ga0495668_0000009 | 3300046616 | Bacteria | 492623 |
| 229 | Ga0495625_0000048 | 3300046660 | Bacteria | 198976 |
| 230 | Ga0495625_0000375 | 3300046660 | Bacteria | 68361 |
| 231 | Ga0495625_0000791 | 3300046660 | Bacteria | 43870 |
| 232 | Ga0495625_0009028 | 3300046660 | Bacteria | 8418 |
| 233 | Ga0495625_0072089 | 3300046660 | Bacteria | 2423 |
| 234 | Ga0495661_0000636 | 3300046665 | Bacteria | 35605 |
| 235 | Ga0495649_0000146 | 3300046694 | Bacteria | 61862 |
| 236 | Ga0495660_0004999 | 3300046810 | Bacteria | 7977 |
| 237 | Ga0495687_003961 | 3300047443 | Bacteria | 10343 |
| 238 | Ga0495687_014650 | 3300047443 | Bacteria | 4022 |
| 239 | Ga0495687_053267 | 3300047443 | Bacteria | 1705 |
| 240 | Ga0495686_0002752 | 3300047472 | Bacteria | 16069 |
| 241 | Ga0495686_0127893 | 3300047472 | Bacteria | 1509 |
| 242 | Ga0495686_0133790 | 3300047472 | Bacteria | 1468 |
| 243 | Ga0495614_0043006 | 3300048089 | Bacteria | 1937 |
| 244 | Ga0496122_0001846 | 3300048925 | Bacteria | 32295 |
| 245 | Ga0496123_0002062 | 3300048926 | Bacteria | 25924 |
| 246 | Ga0495678_049334 | 3300049459 | Bacteria | 1636 |
| 247 | Ga0495682_0044058 | 3300049460 | Bacteria | 1633 |
| 248 | Ga0501241_005494 | 3300049758 | Bacteria | 2361 |
| 249 | nmdc:mga0k408_18054_c1 | 3300050493 | Bacteria | 3933 |
| 250 | nmdc:mga0k408_4142_c1 | 3300050493 | Bacteria | 7701 |
| 251 | nmdc:mga0k408_884_c1 | 3300050493 | Bacteria | 16424 |
| 252 | Ga0500635_0000774 | 3300053080 | Bacteria | 7971 |
| 253 | Ga0500651_0007451 | 3300053093 | Bacteria | 6392 |
| 254 | Ga0500608_004762 | 3300053122 | Bacteria | 5294 |
| 255 | Ga0500618_000124 | 3300053125 | Bacteria | 63455 |
| 256 | Ga0500622_0003198 | 3300053156 | Bacteria | 11153 |
| 257 | Ga0500624_000551 | 3300053157 | Bacteria | 10494 |
| 258 | Ga0500634_0065673 | 3300053161 | Bacteria | 1914 |
| 259 | 2599478860 | 2599185184 | Bacteria | 6430550 |
| 260 | 2738757184 | 2738541283 | Bacteria | 7222293 |
| 261 | 2738762800 | 2738541284 | Bacteria | 5199923 |
| 262 | 2739300480 | 2738543023 | Bacteria | 6767879 |
| 263 | 2776614363 | 2775506987 | Bacteria | 5373360 |
| 264 | 2852624684 | 2852623160 | Bacteria | 4376875 |
| 265 | 2852630258 | 2852627209 | Bacteria | 5896285 |
| 266 | 2881956487 | 2881955468 | Bacteria | 3545609 |
| 267 | 2884936429 | 2884933994 | Bacteria | 4535041 |
| 268 | 2902048979 | 2902048731 | Bacteria | 4976191 |
| 269 | 2919190025 | 2919186247 | Bacteria | 6244071 |
| 270 | 2919438904 | 2919437846 | Bacteria | 6199444 |
| 271 | 2928082916 | 2928078545 | Bacteria | 6534839 |
| 272 | 2928149936 | 2928147474 | Bacteria | 6512076 |
| 273 | 2932086238 | 2932082852 | Bacteria | 6563563 |
| 274 | 2939668306 | 2939664404 | Bacteria | 6364494 |
| 275 | 2977233698 | 2977232053 | Bacteria | 5485925 |
| 276 | Ga0065714_10156273 | |||
| 277 | JGI24740J21852_10027893 | |||
| 278 | JGI24737J22298_10005142 | |||
| 279 | JGI24735J21928_10000010 | |||
| 280 | JGI24744J21845_10011948 | |||
| 281 | JGI25162J39368_1002344 | |||
| 282 | JGI25164J39214_1001190 | |||
| 283 | JGI25165J46597_1002156 | |||
| 284 | rootH2_10001801 | |||
| 285 | rootH1_10052820 | |||
| 286 | rootH1_10063144 | |||
| 287 | rootH1_10079737 | |||
| 288 | rootH1_10129368 | |||
| 289 | rootH1_10187950 | |||
| 290 | Ga0065714_10002962 | |||
| 291 | Ga0065714_10015604 | |||
| 292 | Ga0065714_10073549 | |||
| 293 | Ga0065704_10070382 | |||
| 294 | Ga0065704_10075467 | |||
| 295 | Ga0070658_10000098 | |||
| 296 | Ga0070658_10120057 | |||
| 297 | Ga0070658_10153163 | |||
| 298 | Ga0070676_10117858 | |||
| 299 | Ga0070660_100023899 | |||
| 300 | Ga0070673_100032881 | |||
| 301 | Ga0070659_100002023 | |||
| 302 | Ga0070659_100009213 | |||
| 303 | Ga0070659_100095397 | |||
| 304 | Ga0070662_100000055 | |||
| 305 | Ga0070681_10005874 | |||
| 306 | Ga0068867_100060417 | |||
| 307 | Ga0070679_100010095 | |||
| 308 | Ga0070679_100068565 | |||
| 309 | Ga0070684_100123404 | |||
| 310 | Ga0068853_100107145 | |||
| 311 | Ga0070665_100000034 | |||
| 312 | Ga0070665_100283964 | |||
| 313 | Ga0068855_100000014 | |||
| 314 | Ga0068855_100001684 | |||
| 315 | Ga0068855_100002892 | |||
| 316 | Ga0068855_100022061 | |||
| 317 | Ga0068857_100064315 | |||
| 318 | Ga0068854_100013040 | |||
| 319 | Ga0068856_100001438 | |||
| 320 | Ga0068856_100025448 | |||
| 321 | Ga0068856_100269790 | |||
| 322 | Ga0068852_100005288 | |||
| 323 | Ga0068866_10005898 | |||
| 324 | Ga0068866_10083479 | |||
| 325 | Ga0068858_100093634 | |||
| 326 | Ga0075366_10002020 | |||
| 327 | Ga0075366_10007934 | |||
| 328 | Ga0075366_10040015 | |||
| 329 | Ga0097621_100001881 | |||
| 330 | Ga0068871_100000099 | |||
| 331 | Ga0068865_100000187 | |||
| 332 | Ga0105240_10000010 | |||
| 333 | Ga0105240_10015631 | |||
| 334 | Ga0105240_10034424 | |||
| 335 | Ga0105240_10040647 | |||
| 336 | Ga0105240_10046447 | |||
| 337 | Ga0105240_10068095 | |||
| 338 | Ga0105240_10348078 | |||
| 339 | Ga0105243_10460811 | |||
| 340 | Ga0105241_10000727 | |||
| 341 | Ga0105241_10102221 | |||
| 342 | Ga0105241_10109596 | |||
| 343 | Ga0105242_10254705 | |||
| 344 | Ga0105237_10001016 | |||
| 345 | Ga0105237_10002361 | |||
| 346 | Ga0105237_10004656 | |||
| 347 | Ga0105237_10023513 | |||
| 348 | Ga0105237_10025546 | |||
| 349 | Ga0105237_10068729 | |||
| 350 | Ga0105237_10080221 | |||
| 351 | Ga0105237_10331099 | |||
| 352 | Ga0105238_10021353 | |||
| 353 | Ga0105238_10064870 | |||
| 354 | Ga0105238_10338042 | |||
| 355 | Ga0105249_10250137 | |||
| 356 | Ga0105239_10000001 | |||
| 357 | Ga0105239_10000298 | |||
| 358 | Ga0105239_10001594 | |||
| 359 | Ga0105239_10004573 | |||
| 360 | Ga0105239_10005167 | |||
| 361 | Ga0105239_10020659 | |||
| 362 | Ga0105239_10035825 | |||
| 363 | Ga0105239_10038826 | |||
| 364 | Ga0105239_10157166 | |||
| 365 | Ga0105246_10083529 | |||
| 366 | Ga0157373_10000075 | |||
| 367 | Ga0157373_10002917 | |||
| 368 | Ga0157373_10042754 | |||
| 369 | Ga0157373_10129933 | |||
| 370 | Ga0157371_10000355 | |||
| 371 | Ga0157371_10004223 | |||
| 372 | Ga0157371_10020490 | |||
| 373 | Ga0157371_10207486 | |||
| 374 | Ga0157370_10000207 | |||
| 375 | Ga0157370_10019356 | |||
| 376 | Ga0157370_10125668 | |||
| 377 | Ga0157369_10005034 | |||
| 378 | Ga0157369_10031426 | |||
| 379 | Ga0157369_10060525 | |||
| 380 | Ga0157374_10000217 | |||
| 381 | Ga0157374_10001183 | |||
| 382 | Ga0157374_10001211 | |||
| 383 | Ga0157378_10223392 | |||
| 384 | Ga0163162_10000018 | |||
| 385 | Ga0163162_10002608 | |||
| 386 | Ga0163162_10061962 | |||
| 387 | Ga0163162_10353830 | |||
| 388 | Ga0157372_10000070 | |||
| 389 | Ga0157372_10000325 | |||
| 390 | Ga0157372_10042984 | |||
| 391 | Ga0157372_10044897 | |||
| 392 | Ga0157375_10006966 | |||
| 393 | Ga0157375_10114389 | |||
| 394 | Ga0182008_10000009 | |||
| 395 | Ga0182008_10001007 | |||
| 396 | Ga0182006_1000332 | |||
| 397 | Ga0209563_104982 | |||
| 398 | Ga0207427_101278 | |||
| 399 | Ga0209437_100024 | |||
| 400 | Ga0209437_100093 | |||
| 401 | Ga0209026_1000416 | |||
| 402 | Ga0209026_1003396 | |||
| 403 | Ga0209026_1007019 | |||
| 404 | Ga0209233_1000089 | |||
| 405 | Ga0209233_1001629 | |||
| 406 | Ga0207642_10020748 | |||
| 407 | Ga0207647_10000067 | |||
| 408 | Ga0207647_10000755 | |||
| 409 | Ga0207645_10000046 | |||
| 410 | Ga0207705_10000118 | |||
| 411 | Ga0207705_10407463 | |||
| 412 | Ga0207707_10003579 | |||
| 413 | Ga0207695_10000019 | |||
| 414 | Ga0207695_10012061 | |||
| 415 | Ga0207695_10030628 | |||
| 416 | Ga0207695_10032996 | |||
| 417 | Ga0207695_10066447 | |||
| 418 | Ga0207695_10068312 | |||
| 419 | Ga0207671_10001003 | |||
| 420 | Ga0207671_10002246 | |||
| 421 | Ga0207671_10004633 | |||
| 422 | Ga0207671_10011830 | |||
| 423 | Ga0207671_10017278 | |||
| 424 | Ga0207671_10033387 | |||
| 425 | Ga0207671_10033520 | |||
| 426 | Ga0207671_10074940 | |||
| 427 | Ga0207671_10174475 | |||
| 428 | Ga0207671_10352500 | |||
| 429 | Ga0207660_10022403 | |||
| 430 | Ga0207657_10039922 | |||
| 431 | Ga0207652_10011141 | |||
| 432 | Ga0207652_10233754 | |||
| 433 | Ga0207694_10049358 | |||
| 434 | Ga0207694_10094834 | |||
| 435 | Ga0207644_10051860 | |||
| 436 | Ga0207690_10001524 | |||
| 437 | Ga0207690_10005770 | |||
| 438 | Ga0207690_10020565 | |||
| 439 | Ga0207706_10000123 | |||
| 440 | Ga0207686_10055457 | |||
| 441 | Ga0207704_10000058 | |||
| 442 | Ga0207667_10000049 | |||
| 443 | Ga0207667_10002331 | |||
| 444 | Ga0207667_10002437 | |||
| 445 | Ga0207667_10137519 | |||
| 446 | Ga0207667_10274033 | |||
| 447 | Ga0207651_10018002 | |||
| 448 | Ga0207640_10053912 | |||
| 449 | Ga0207677_10164523 | |||
| 450 | Ga0207639_10042117 | |||
| 451 | Ga0207702_10006339 | |||
| 452 | Ga0207648_10047425 | |||
| 453 | Ga0207698_10041760 | |||
| 454 | Ga0268266_10000111 | |||
| 455 | Ga0268266_10260772 | |||
| 456 | Ga0307517_10015866 | |||
| 457 | Ga0307515_10001207 | |||
| 458 | Ga0307515_10001331 | |||
| 459 | Ga0307515_10011788 | |||
| 460 | Ga0307408_100000631 | |||
| 461 | Ga0307408_100006557 | |||
| 462 | Ga0307408_100030401 | |||
| 463 | Ga0307405_10002409 | |||
| 464 | Ga0307412_10000084 | |||
| 465 | Ga0307412_10002425 | |||
| 466 | Ga0307412_10026399 | |||
| 467 | Ga0307414_10008568 | |||
| 468 | Ga0307414_10122551 | |||
| 469 | Ga0307507_10000034 | |||
| 470 | Ga0307510_10015806 | |||
| 471 | Ga0395899_0000002 | |||
| 472 | Ga0395899_0000087 | |||
| 473 | Ga0395899_0007220 | |||
| 474 | Ga0395900_0000141 | |||
| 475 | Ga0395900_0000155 | |||
| 476 | Ga0395898_0026547 | |||
| 477 | Ga0395905_0000124 | |||
| 478 | Ga0395905_0000266 | |||
| 479 | Ga0395901_0000138 | |||
| 480 | Ga0395901_0018250 | |||
| 481 | Ga0436361_1090084 | |||
| 482 | Ga0466963_0260016 | |||
| 483 | Ga0495650_0000127 | |||
| 484 | Ga0495585_0000088 | |||
| 485 | Ga0495585_0176069 | |||
| 486 | Ga0495596_0042180 | |||
| 487 | Ga0495583_0061464 | |||
| 488 | Ga0495606_0000033 | |||
| 489 | Ga0495606_0020130 | |||
| 490 | Ga0495606_0024496 | |||
| 491 | Ga0495606_0056676 | |||
| 492 | Ga0495610_0005698 | |||
| 493 | Ga0495616_0008296 | |||
| 494 | Ga0495616_0022904 | |||
| 495 | Ga0495631_0025914 | |||
| 496 | Ga0495632_0134523 | |||
| 497 | Ga0495637_0099317 | |||
| 498 | Ga0495648_0003282 | |||
| 499 | Ga0495609_0003980 | |||
| 500 | Ga0495633_0000177 | |||
| 501 | Ga0495633_0006763 | |||
| 502 | Ga0495668_0000009 | |||
| 503 | Ga0495625_0000048 | |||
| 504 | Ga0495625_0000375 | |||
| 505 | Ga0495625_0000791 | |||
| 506 | Ga0495625_0009028 | |||
| 507 | Ga0495625_0072089 | |||
| 508 | Ga0495661_0000636 | |||
| 509 | Ga0495649_0000146 | |||
| 510 | Ga0495660_0004999 | |||
| 511 | Ga0495687_003961 | |||
| 512 | Ga0495687_014650 | |||
| 513 | Ga0495687_053267 | |||
| 514 | Ga0495686_0002752 | |||
| 515 | Ga0495686_0127893 | |||
| 516 | Ga0495686_0133790 | |||
| 517 | Ga0495614_0043006 | |||
| 518 | Ga0496122_0001846 | |||
| 519 | Ga0496123_0002062 | |||
| 520 | Ga0495678_049334 | |||
| 521 | Ga0495682_0044058 | |||
| 522 | Ga0501241_005494 | |||
| 523 | nmdc:mga0k408_18054_c1 | |||
| 524 | nmdc:mga0k408_4142_c1 | |||
| 525 | nmdc:mga0k408_884_c1 | |||
| 526 | Ga0500635_0000774 | |||
| 527 | Ga0500651_0007451 | |||
| 528 | Ga0500608_004762 | |||
| 529 | Ga0500618_000124 | |||
| 530 | Ga0500622_0003198 | |||
| 531 | Ga0500624_000551 | |||
| 532 | Ga0500634_0065673 | |||
| 533 | 2599478860 | |||
| 534 | 2738757184 | |||
| 535 | 2738762800 | |||
| 536 | 2739300480 | |||
| 537 | 2776614363 | |||
| 538 | 2852624684 | |||
| 539 | 2852630258 | |||
| 540 | 2881956487 | |||
| 541 | 2884936429 | |||
| 542 | 2902048979 | |||
| 543 | 2919190025 | |||
| 544 | 2919438904 | |||
| 545 | 2928082916 | |||
| 546 | 2928149936 | |||
| 547 | 2932086238 | |||
| 548 | 2939668306 | |||
| 549 | 2977233698 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vpy-assembly1.cif.gz_A | crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution | 0.7743 | 37 | 290 |
| 1vpy-assembly1.cif.gz_A | crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution | 0.7657 | 37 | 290 |
| 1ztv-assembly1.cif.gz_B | crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution | 0.7309 | 39 | 300 |
| 1ztv-assembly1.cif.gz_B | crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution | 0.6975 | 39 | 300 |
| 4rnf-assembly1.cif.gz_A | pamora tandem diguanylate cyclase - mutant phosphodiesterase, apo form | 0.6395 | 144 | 282 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37348_1_259_3.20.20.410 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 | 0.8529 | 39 | 290 | 3.20.20.410 |
| af_P37348_1_259_3.20.20.410 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 | 0.828 | 39 | 290 | 3.20.20.410 |
| af_Q4E4B4_140_369_3.20.20.410 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 | 0.8189 | 105 | 288 | 3.20.20.410 |
| af_Q2FZX7_1_282_3.20.20.410 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 | 0.7872 | 39 | 295 | 3.20.20.410 |
| 1vpyA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 | 0.7429 | 39 | 290 | 3.20.20.410 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A318VS80-F1-model_v4 | deleted | 0.9898 | 1 | 298 |
|
| AF-A0A1H8LUM7-F1-model_v4 | Uncharacterized conserved protein YecE, DUF72 family | 0.9871 | 1 | 297 |
|
| AF-A0A318VS80-F1-model_v4 | deleted | 0.9866 | 1 | 298 |
|
| AF-A0A7K1SU90-F1-model_v4 | DUF72 domain-containing protein | 0.9854 | 1 | 299 |
|
| AF-A0A7Y4XSG5-F1-model_v4 | DUF72 domain-containing protein | 0.982 | 1 | 298 |
|