F379461

General Info

Members Datasets Scaffolds Average Seq Length
274 150 549 307

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10156273|Ga0065714_101562731
Length 315
Sequence MDFGKVAADELQAIDFSLPADGQQTAQTLSGKPAVKAPAFYVGCAKWGRKEWLNMIYPAKTKEANFLDEYVKHFNAIELNAVFYSLPKPEQIRKWKEKAALNSKNGFLFCPKFSQSISHLKRLKGAEAATDIFLSGISEFGEYLGPCFLQMGDNFGPKNKEILQAYLESLPADLSMFVELRNPEWFSLESNRRPLFEMLAGLNKGAAITDASGRRDVIHMELTIPEVFIRFVGNGADFKASDEARIDEWVKRLKVWLGNGLEKVYFFLHQHDEKDTPILANYTIRAFNKHLGSDLAEINFLGGKNGEITKDPQLF

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
86 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
92 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
101 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
102 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
103 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
104 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
105 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
106 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
107 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
108 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
109 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
112 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
116 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
117 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
118 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
119 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
120 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
121 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
122 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
123 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
124 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
125 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
126 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
127 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
128 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
129 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
130 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
131 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
132 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
133 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
134 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
135 2738541283 Pedobacter sp. OK701 Isolate Unclassified
136 2738541284 Pedobacter sp. YR016 Isolate Unclassified
137 2738543023 Pedobacter sp. OK628 Isolate Unclassified
138 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
139 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
140 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
141 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
142 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
143 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
144 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
145 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
146 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
147 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
148 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
149 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
150 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.8
Metatranscriptomes 0
Isolates 6.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.03
Nodule 0
Rhizoplane 0.36
Rhizosphere 82.85
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10156273 3300005288 Bacteria 1076
2 JGI24740J21852_10027893 3300001979 Bacteria 1872
3 JGI24737J22298_10005142 3300001990 Bacteria 4530
4 JGI24735J21928_10000010 3300002067 Bacteria 237152
5 JGI24744J21845_10011948 3300002077 Bacteria 1767
6 JGI25162J39368_1002344 3300002737 Bacteria 7528
7 JGI25164J39214_1001190 3300002772 Bacteria 7096
8 JGI25165J46597_1002156 3300003214 Bacteria 7041
9 rootH2_10001801 3300003320 Bacteria 92828
10 rootH1_10052820 3300003323 Bacteria 1408
11 rootH1_10063144 3300003323 Bacteria 5622
12 rootH1_10079737 3300003316 Bacteria 2545
13 rootH1_10079737 3300003323 Bacteria 9309
14 rootH1_10129368 3300003323 Bacteria 3701
15 rootH1_10187950 3300003323 Bacteria 1481
16 Ga0065714_10002962 3300005288 Bacteria 12102
17 Ga0065714_10015604 3300005288 Bacteria 2689
18 Ga0065714_10073549 3300005288 Bacteria 3165
19 Ga0065704_10070382 3300005289 Bacteria 27921
20 Ga0065704_10075467 3300005289 Bacteria 5578
21 Ga0070658_10000098 3300005327 Bacteria 76892
22 Ga0070658_10120057 3300005327 Bacteria 2184
23 Ga0070658_10153163 3300005327 Bacteria 1931
24 Ga0070676_10117858 3300005328 Bacteria 1662
25 Ga0070660_100023899 3300005339 Bacteria 4532
26 Ga0070673_100032881 3300005364 Bacteria 3910
27 Ga0070659_100002023 3300005366 Bacteria 14496
28 Ga0070659_100009213 3300005366 Bacteria 7245
29 Ga0070659_100095397 3300005366 Bacteria 2389
30 Ga0070662_100000055 3300005457 Bacteria 60567
31 Ga0070681_10005874 3300005458 Bacteria 11884
32 Ga0068867_100060417 3300005459 Bacteria 2811
33 Ga0070679_100010095 3300005530 Bacteria 8949
34 Ga0070679_100068565 3300005530 Bacteria 3538
35 Ga0070684_100123404 3300005535 Bacteria 2331
36 Ga0068853_100107145 3300005539 Bacteria 2478
37 Ga0070665_100000034 3300005548 Bacteria 324289
38 Ga0070665_100283964 3300005548 Bacteria 1657
39 Ga0068855_100000014 3300005563 Bacteria 232720
40 Ga0068855_100001684 3300005563 Bacteria 27684
41 Ga0068855_100002892 3300005563 Bacteria 21009
42 Ga0068855_100022061 3300005563 Bacteria 7633
43 Ga0068857_100064315 3300005577 Bacteria 3262
44 Ga0068854_100013040 3300005578 Bacteria 5448
45 Ga0068856_100001438 3300005614 Bacteria 24989
46 Ga0068856_100025448 3300005614 Bacteria 5772
47 Ga0068856_100269790 3300005614 Bacteria 1717
48 Ga0068852_100005288 3300005616 Bacteria 9216
49 Ga0068866_10005898 3300005718 Bacteria 5090
50 Ga0068866_10083479 3300005718 Bacteria 1721
51 Ga0068858_100093634 3300005842 Bacteria 2797
52 Ga0075366_10002020 3300006195 Bacteria 10299
53 Ga0075366_10007934 3300006195 Bacteria 5874
54 Ga0075366_10040015 3300006195 Bacteria 2772
55 Ga0097621_100001881 3300006237 Bacteria 14366
56 Ga0068871_100000099 3300006358 Bacteria 51278
57 Ga0068865_100000187 3300006881 Bacteria 34573
58 Ga0105240_10000010 3300009093 Bacteria 537830
59 Ga0105240_10015631 3300009093 Bacteria 10307
60 Ga0105240_10034424 3300009093 Bacteria 6533
61 Ga0105240_10040647 3300009093 Bacteria 5944
62 Ga0105240_10046447 3300009093 Bacteria 5502
63 Ga0105240_10068095 3300009093 Bacteria 4410
64 Ga0105240_10348078 3300009093 Bacteria 1682
65 Ga0105243_10460811 3300009148 Bacteria 1195
66 Ga0105241_10000727 3300009174 Bacteria 24962
67 Ga0105241_10102221 3300009174 Bacteria 2280
68 Ga0105241_10109596 3300009174 Bacteria 2208
69 Ga0105242_10254705 3300009176 Bacteria 1583
70 Ga0105237_10001016 3300009545 Bacteria 37771
71 Ga0105237_10002361 3300009545 Bacteria 23426
72 Ga0105237_10004656 3300009545 Bacteria 15799
73 Ga0105237_10023513 3300009545 Bacteria 6313
74 Ga0105237_10025546 3300009545 Bacteria 6039
75 Ga0105237_10068729 3300009545 Bacteria 3537
76 Ga0105237_10080221 3300009545 Bacteria 3253
77 Ga0105237_10331099 3300009545 Bacteria 1527
78 Ga0105238_10021353 3300009551 Bacteria 6596
79 Ga0105238_10064870 3300009551 Bacteria 3652
80 Ga0105238_10338042 3300009551 Bacteria 1493
81 Ga0105249_10250137 3300009553 Bacteria 1757
82 Ga0105239_10000001 3300010375 Bacteria 617353
83 Ga0105239_10000298 3300010375 Bacteria 73328
84 Ga0105239_10001594 3300010375 Bacteria 29975
85 Ga0105239_10004573 3300010375 Bacteria 16492
86 Ga0105239_10005167 3300010375 Bacteria 15395
87 Ga0105239_10020659 3300010375 Bacteria 7265
88 Ga0105239_10035825 3300010375 Bacteria 5449
89 Ga0105239_10038826 3300010375 Bacteria 5216
90 Ga0105239_10157166 3300010375 Bacteria 2540
91 Ga0105246_10083529 3300011119 Bacteria 2282
92 Ga0157373_10000075 3300013100 Bacteria 85818
93 Ga0157373_10002917 3300013100 Bacteria 12953
94 Ga0157373_10042754 3300013100 Bacteria 3238
95 Ga0157373_10129933 3300013100 Bacteria 1771
96 Ga0157371_10000355 3300013102 Bacteria 58322
97 Ga0157371_10004223 3300013102 Bacteria 12636
98 Ga0157371_10020490 3300013102 Bacteria 4866
99 Ga0157371_10207486 3300013102 Bacteria 1405
100 Ga0157370_10000207 3300013104 Bacteria 74451
101 Ga0157370_10019356 3300013104 Bacteria 6831
102 Ga0157370_10125668 3300013104 Unclassified 2393
103 Ga0157369_10005034 3300013105 Bacteria 15467
104 Ga0157369_10031426 3300013105 Bacteria 5846
105 Ga0157369_10060525 3300013105 Bacteria 4083
106 Ga0157374_10000217 3300013296 Bacteria 52933
107 Ga0157374_10001183 3300013296 Bacteria 22283
108 Ga0157374_10001211 3300013296 Bacteria 22059
109 Ga0157378_10223392 3300013297 Bacteria 1791
110 Ga0163162_10000018 3300013306 Bacteria 226257
111 Ga0163162_10002608 3300013306 Bacteria 17087
112 Ga0163162_10061962 3300013306 Bacteria 3779
113 Ga0163162_10353830 3300013306 Bacteria 1601
114 Ga0157372_10000070 3300013307 Bacteria 109649
115 Ga0157372_10000325 3300013307 Bacteria 52408
116 Ga0157372_10042984 3300013307 Bacteria 5002
117 Ga0157372_10044897 3300013307 Bacteria 4898
118 Ga0157375_10006966 3300013308 Bacteria 9871
119 Ga0157375_10114389 3300013308 Bacteria 2800
120 Ga0182008_10000009 3300014497 Bacteria 331416
121 Ga0182008_10001007 3300014497 Bacteria 19580
122 Ga0182006_1000332 3300015261 Bacteria 40804
123 Ga0209563_104982 3300025230 Bacteria 2468
124 Ga0207427_101278 3300025231 Bacteria 9575
125 Ga0209437_100024 3300025233 Bacteria 592878
126 Ga0209437_100093 3300025233 Bacteria 239733
127 Ga0209026_1000416 3300025250 Bacteria 36810
128 Ga0209026_1003396 3300025250 Bacteria 5252
129 Ga0209026_1007019 3300025250 Bacteria 2625
130 Ga0209233_1000089 3300025261 Bacteria 316381
131 Ga0209233_1001629 3300025261 Bacteria 8736
132 Ga0207642_10020748 3300025899 Bacteria 2572
133 Ga0207647_10000067 3300025904 Bacteria 81496
134 Ga0207647_10000755 3300025904 Bacteria 25308
135 Ga0207645_10000046 3300025907 Bacteria 85043
136 Ga0207705_10000118 3300025909 Bacteria 88199
137 Ga0207705_10407463 3300025909 Bacteria 1052
138 Ga0207707_10003579 3300025912 Bacteria 13773
139 Ga0207695_10000019 3300025913 Bacteria 732137
140 Ga0207695_10012061 3300025913 Bacteria 10392
141 Ga0207695_10030628 3300025913 Bacteria 5920
142 Ga0207695_10032996 3300025913 Bacteria 5656
143 Ga0207695_10066447 3300025913 Bacteria 3703
144 Ga0207695_10068312 3300025913 Bacteria 3641
145 Ga0207671_10001003 3300025914 Bacteria 34695
146 Ga0207671_10002246 3300025914 Bacteria 20914
147 Ga0207671_10004633 3300025914 Bacteria 13032
148 Ga0207671_10011830 3300025914 Bacteria 7061
149 Ga0207671_10017278 3300025914 Bacteria 5568
150 Ga0207671_10033387 3300025914 Bacteria 3828
151 Ga0207671_10033520 3300025914 Bacteria 3819
152 Ga0207671_10074940 3300025914 Bacteria 2530
153 Ga0207671_10174475 3300025914 Bacteria 1670
154 Ga0207671_10352500 3300025914 Bacteria 1167
155 Ga0207660_10022403 3300025917 Bacteria 4256
156 Ga0207657_10039922 3300025919 Bacteria 4164
157 Ga0207652_10011141 3300025921 Bacteria 7247
158 Ga0207652_10233754 3300025921 Bacteria 1657
159 Ga0207694_10049358 3300025924 Bacteria 3258
160 Ga0207694_10094834 3300025924 Bacteria 2358
161 Ga0207644_10051860 3300025931 Bacteria 2946
162 Ga0207690_10001524 3300025932 Bacteria 14496
163 Ga0207690_10005770 3300025932 Bacteria 7321
164 Ga0207690_10020565 3300025932 Bacteria 4081
165 Ga0207706_10000123 3300025933 Bacteria 83810
166 Ga0207686_10055457 3300025934 Bacteria 2487
167 Ga0207704_10000058 3300025938 Bacteria 77010
168 Ga0207667_10000049 3300025949 Bacteria 235027
169 Ga0207667_10002331 3300025949 Bacteria 23775
170 Ga0207667_10002437 3300025949 Bacteria 23292
171 Ga0207667_10137519 3300025949 Bacteria 2516
172 Ga0207667_10274033 3300025949 Bacteria 1725
173 Ga0207651_10018002 3300025960 Bacteria 4191
174 Ga0207640_10053912 3300025981 Bacteria 2627
175 Ga0207677_10164523 3300026023 Bacteria 1728
176 Ga0207639_10042117 3300026041 Bacteria 3421
177 Ga0207702_10006339 3300026078 Bacteria 10221
178 Ga0207648_10047425 3300026089 Bacteria 3766
179 Ga0207698_10041760 3300026142 Bacteria 3421
180 Ga0268266_10000111 3300028379 Bacteria 169743
181 Ga0268266_10260772 3300028379 Bacteria 1606
182 Ga0307517_10015866 3300028786 Bacteria 9960
183 Ga0307515_10001207 3300028794 Bacteria 59017
184 Ga0307515_10001331 3300028794 Bacteria 55969
185 Ga0307515_10011788 3300028794 Bacteria 16544
186 Ga0307408_100000631 3300031548 Bacteria 29818
187 Ga0307408_100006557 3300031548 Bacteria 7714
188 Ga0307408_100030401 3300031548 Bacteria 3750
189 Ga0307405_10002409 3300031731 Bacteria 8233
190 Ga0307412_10000084 3300031911 Bacteria 90908
191 Ga0307412_10002425 3300031911 Bacteria 10364
192 Ga0307412_10026399 3300031911 Bacteria 3610
193 Ga0307414_10008568 3300032004 Bacteria 5811
194 Ga0307414_10122551 3300032004 Bacteria 2002
195 Ga0307507_10000034 3300033179 Bacteria 188697
196 Ga0307510_10015806 3300033180 Bacteria 8921
197 Ga0395899_0000002 3300037312 Bacteria 1324310
198 Ga0395899_0000087 3300037312 Bacteria 157502
199 Ga0395899_0007220 3300037312 Bacteria 8599
200 Ga0395900_0000141 3300037418 Bacteria 121159
201 Ga0395900_0000155 3300037418 Bacteria 113606
202 Ga0395898_0026547 3300037466 Bacteria 5825
203 Ga0395905_0000124 3300037471 Bacteria 126707
204 Ga0395905_0000266 3300037471 Bacteria 78131
205 Ga0395901_0000138 3300038443 Bacteria 94944
206 Ga0395901_0018250 3300038443 Bacteria 7163
207 Ga0436361_1090084 3300039447 Bacteria 7515
208 Ga0466963_0260016 3300044694 Bacteria 1219
209 Ga0495650_0000127 3300046471 Bacteria 177276
210 Ga0495585_0000088 3300046492 Bacteria 96490
211 Ga0495585_0176069 3300046492 Bacteria 1102
212 Ga0495596_0042180 3300046500 Bacteria 1798
213 Ga0495583_0061464 3300046506 Bacteria 1676
214 Ga0495606_0000033 3300046507 Bacteria 247739
215 Ga0495606_0020130 3300046507 Bacteria 4933
216 Ga0495606_0024496 3300046507 Bacteria 4347
217 Ga0495606_0056676 3300046507 Bacteria 2528
218 Ga0495610_0005698 3300046512 Bacteria 8779
219 Ga0495616_0008296 3300046513 Bacteria 6166
220 Ga0495616_0022904 3300046513 Bacteria 3367
221 Ga0495631_0025914 3300046518 Bacteria 2696
222 Ga0495632_0134523 3300046519 Bacteria 1149
223 Ga0495637_0099317 3300046520 Bacteria 1139
224 Ga0495648_0003282 3300046524 Bacteria 14297
225 Ga0495609_0003980 3300046538 Bacteria 8254
226 Ga0495633_0000177 3300046558 Bacteria 82953
227 Ga0495633_0006763 3300046558 Bacteria 6739
228 Ga0495668_0000009 3300046616 Bacteria 492623
229 Ga0495625_0000048 3300046660 Bacteria 198976
230 Ga0495625_0000375 3300046660 Bacteria 68361
231 Ga0495625_0000791 3300046660 Bacteria 43870
232 Ga0495625_0009028 3300046660 Bacteria 8418
233 Ga0495625_0072089 3300046660 Bacteria 2423
234 Ga0495661_0000636 3300046665 Bacteria 35605
235 Ga0495649_0000146 3300046694 Bacteria 61862
236 Ga0495660_0004999 3300046810 Bacteria 7977
237 Ga0495687_003961 3300047443 Bacteria 10343
238 Ga0495687_014650 3300047443 Bacteria 4022
239 Ga0495687_053267 3300047443 Bacteria 1705
240 Ga0495686_0002752 3300047472 Bacteria 16069
241 Ga0495686_0127893 3300047472 Bacteria 1509
242 Ga0495686_0133790 3300047472 Bacteria 1468
243 Ga0495614_0043006 3300048089 Bacteria 1937
244 Ga0496122_0001846 3300048925 Bacteria 32295
245 Ga0496123_0002062 3300048926 Bacteria 25924
246 Ga0495678_049334 3300049459 Bacteria 1636
247 Ga0495682_0044058 3300049460 Bacteria 1633
248 Ga0501241_005494 3300049758 Bacteria 2361
249 nmdc:mga0k408_18054_c1 3300050493 Bacteria 3933
250 nmdc:mga0k408_4142_c1 3300050493 Bacteria 7701
251 nmdc:mga0k408_884_c1 3300050493 Bacteria 16424
252 Ga0500635_0000774 3300053080 Bacteria 7971
253 Ga0500651_0007451 3300053093 Bacteria 6392
254 Ga0500608_004762 3300053122 Bacteria 5294
255 Ga0500618_000124 3300053125 Bacteria 63455
256 Ga0500622_0003198 3300053156 Bacteria 11153
257 Ga0500624_000551 3300053157 Bacteria 10494
258 Ga0500634_0065673 3300053161 Bacteria 1914
259 2599478860 2599185184 Bacteria 6430550
260 2738757184 2738541283 Bacteria 7222293
261 2738762800 2738541284 Bacteria 5199923
262 2739300480 2738543023 Bacteria 6767879
263 2776614363 2775506987 Bacteria 5373360
264 2852624684 2852623160 Bacteria 4376875
265 2852630258 2852627209 Bacteria 5896285
266 2881956487 2881955468 Bacteria 3545609
267 2884936429 2884933994 Bacteria 4535041
268 2902048979 2902048731 Bacteria 4976191
269 2919190025 2919186247 Bacteria 6244071
270 2919438904 2919437846 Bacteria 6199444
271 2928082916 2928078545 Bacteria 6534839
272 2928149936 2928147474 Bacteria 6512076
273 2932086238 2932082852 Bacteria 6563563
274 2939668306 2939664404 Bacteria 6364494
275 2977233698 2977232053 Bacteria 5485925
276 Ga0065714_10156273
277 JGI24740J21852_10027893
278 JGI24737J22298_10005142
279 JGI24735J21928_10000010
280 JGI24744J21845_10011948
281 JGI25162J39368_1002344
282 JGI25164J39214_1001190
283 JGI25165J46597_1002156
284 rootH2_10001801
285 rootH1_10052820
286 rootH1_10063144
287 rootH1_10079737
288 rootH1_10129368
289 rootH1_10187950
290 Ga0065714_10002962
291 Ga0065714_10015604
292 Ga0065714_10073549
293 Ga0065704_10070382
294 Ga0065704_10075467
295 Ga0070658_10000098
296 Ga0070658_10120057
297 Ga0070658_10153163
298 Ga0070676_10117858
299 Ga0070660_100023899
300 Ga0070673_100032881
301 Ga0070659_100002023
302 Ga0070659_100009213
303 Ga0070659_100095397
304 Ga0070662_100000055
305 Ga0070681_10005874
306 Ga0068867_100060417
307 Ga0070679_100010095
308 Ga0070679_100068565
309 Ga0070684_100123404
310 Ga0068853_100107145
311 Ga0070665_100000034
312 Ga0070665_100283964
313 Ga0068855_100000014
314 Ga0068855_100001684
315 Ga0068855_100002892
316 Ga0068855_100022061
317 Ga0068857_100064315
318 Ga0068854_100013040
319 Ga0068856_100001438
320 Ga0068856_100025448
321 Ga0068856_100269790
322 Ga0068852_100005288
323 Ga0068866_10005898
324 Ga0068866_10083479
325 Ga0068858_100093634
326 Ga0075366_10002020
327 Ga0075366_10007934
328 Ga0075366_10040015
329 Ga0097621_100001881
330 Ga0068871_100000099
331 Ga0068865_100000187
332 Ga0105240_10000010
333 Ga0105240_10015631
334 Ga0105240_10034424
335 Ga0105240_10040647
336 Ga0105240_10046447
337 Ga0105240_10068095
338 Ga0105240_10348078
339 Ga0105243_10460811
340 Ga0105241_10000727
341 Ga0105241_10102221
342 Ga0105241_10109596
343 Ga0105242_10254705
344 Ga0105237_10001016
345 Ga0105237_10002361
346 Ga0105237_10004656
347 Ga0105237_10023513
348 Ga0105237_10025546
349 Ga0105237_10068729
350 Ga0105237_10080221
351 Ga0105237_10331099
352 Ga0105238_10021353
353 Ga0105238_10064870
354 Ga0105238_10338042
355 Ga0105249_10250137
356 Ga0105239_10000001
357 Ga0105239_10000298
358 Ga0105239_10001594
359 Ga0105239_10004573
360 Ga0105239_10005167
361 Ga0105239_10020659
362 Ga0105239_10035825
363 Ga0105239_10038826
364 Ga0105239_10157166
365 Ga0105246_10083529
366 Ga0157373_10000075
367 Ga0157373_10002917
368 Ga0157373_10042754
369 Ga0157373_10129933
370 Ga0157371_10000355
371 Ga0157371_10004223
372 Ga0157371_10020490
373 Ga0157371_10207486
374 Ga0157370_10000207
375 Ga0157370_10019356
376 Ga0157370_10125668
377 Ga0157369_10005034
378 Ga0157369_10031426
379 Ga0157369_10060525
380 Ga0157374_10000217
381 Ga0157374_10001183
382 Ga0157374_10001211
383 Ga0157378_10223392
384 Ga0163162_10000018
385 Ga0163162_10002608
386 Ga0163162_10061962
387 Ga0163162_10353830
388 Ga0157372_10000070
389 Ga0157372_10000325
390 Ga0157372_10042984
391 Ga0157372_10044897
392 Ga0157375_10006966
393 Ga0157375_10114389
394 Ga0182008_10000009
395 Ga0182008_10001007
396 Ga0182006_1000332
397 Ga0209563_104982
398 Ga0207427_101278
399 Ga0209437_100024
400 Ga0209437_100093
401 Ga0209026_1000416
402 Ga0209026_1003396
403 Ga0209026_1007019
404 Ga0209233_1000089
405 Ga0209233_1001629
406 Ga0207642_10020748
407 Ga0207647_10000067
408 Ga0207647_10000755
409 Ga0207645_10000046
410 Ga0207705_10000118
411 Ga0207705_10407463
412 Ga0207707_10003579
413 Ga0207695_10000019
414 Ga0207695_10012061
415 Ga0207695_10030628
416 Ga0207695_10032996
417 Ga0207695_10066447
418 Ga0207695_10068312
419 Ga0207671_10001003
420 Ga0207671_10002246
421 Ga0207671_10004633
422 Ga0207671_10011830
423 Ga0207671_10017278
424 Ga0207671_10033387
425 Ga0207671_10033520
426 Ga0207671_10074940
427 Ga0207671_10174475
428 Ga0207671_10352500
429 Ga0207660_10022403
430 Ga0207657_10039922
431 Ga0207652_10011141
432 Ga0207652_10233754
433 Ga0207694_10049358
434 Ga0207694_10094834
435 Ga0207644_10051860
436 Ga0207690_10001524
437 Ga0207690_10005770
438 Ga0207690_10020565
439 Ga0207706_10000123
440 Ga0207686_10055457
441 Ga0207704_10000058
442 Ga0207667_10000049
443 Ga0207667_10002331
444 Ga0207667_10002437
445 Ga0207667_10137519
446 Ga0207667_10274033
447 Ga0207651_10018002
448 Ga0207640_10053912
449 Ga0207677_10164523
450 Ga0207639_10042117
451 Ga0207702_10006339
452 Ga0207648_10047425
453 Ga0207698_10041760
454 Ga0268266_10000111
455 Ga0268266_10260772
456 Ga0307517_10015866
457 Ga0307515_10001207
458 Ga0307515_10001331
459 Ga0307515_10011788
460 Ga0307408_100000631
461 Ga0307408_100006557
462 Ga0307408_100030401
463 Ga0307405_10002409
464 Ga0307412_10000084
465 Ga0307412_10002425
466 Ga0307412_10026399
467 Ga0307414_10008568
468 Ga0307414_10122551
469 Ga0307507_10000034
470 Ga0307510_10015806
471 Ga0395899_0000002
472 Ga0395899_0000087
473 Ga0395899_0007220
474 Ga0395900_0000141
475 Ga0395900_0000155
476 Ga0395898_0026547
477 Ga0395905_0000124
478 Ga0395905_0000266
479 Ga0395901_0000138
480 Ga0395901_0018250
481 Ga0436361_1090084
482 Ga0466963_0260016
483 Ga0495650_0000127
484 Ga0495585_0000088
485 Ga0495585_0176069
486 Ga0495596_0042180
487 Ga0495583_0061464
488 Ga0495606_0000033
489 Ga0495606_0020130
490 Ga0495606_0024496
491 Ga0495606_0056676
492 Ga0495610_0005698
493 Ga0495616_0008296
494 Ga0495616_0022904
495 Ga0495631_0025914
496 Ga0495632_0134523
497 Ga0495637_0099317
498 Ga0495648_0003282
499 Ga0495609_0003980
500 Ga0495633_0000177
501 Ga0495633_0006763
502 Ga0495668_0000009
503 Ga0495625_0000048
504 Ga0495625_0000375
505 Ga0495625_0000791
506 Ga0495625_0009028
507 Ga0495625_0072089
508 Ga0495661_0000636
509 Ga0495649_0000146
510 Ga0495660_0004999
511 Ga0495687_003961
512 Ga0495687_014650
513 Ga0495687_053267
514 Ga0495686_0002752
515 Ga0495686_0127893
516 Ga0495686_0133790
517 Ga0495614_0043006
518 Ga0496122_0001846
519 Ga0496123_0002062
520 Ga0495678_049334
521 Ga0495682_0044058
522 Ga0501241_005494
523 nmdc:mga0k408_18054_c1
524 nmdc:mga0k408_4142_c1
525 nmdc:mga0k408_884_c1
526 Ga0500635_0000774
527 Ga0500651_0007451
528 Ga0500608_004762
529 Ga0500618_000124
530 Ga0500622_0003198
531 Ga0500624_000551
532 Ga0500634_0065673
533 2599478860
534 2738757184
535 2738762800
536 2739300480
537 2776614363
538 2852624684
539 2852630258
540 2881956487
541 2884936429
542 2902048979
543 2919190025
544 2919438904
545 2928082916
546 2928149936
547 2932086238
548 2939668306
549 2977233698

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01904

DUF72

Protein of unknown function DUF72

57

286

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.7743 37 290
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.7657 37 290
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.7309 39 300
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.6975 39 300
4rnf-assembly1.cif.gz_A pamora tandem diguanylate cyclase - mutant phosphodiesterase, apo form 0.6395 144 282
ID Description Score Start End Superfamily
af_P37348_1_259_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8529 39 290 3.20.20.410
af_P37348_1_259_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.828 39 290 3.20.20.410
af_Q4E4B4_140_369_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8189 105 288 3.20.20.410
af_Q2FZX7_1_282_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7872 39 295 3.20.20.410
1vpyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7429 39 290 3.20.20.410
ID Description Score Start End GO Terms
AF-A0A318VS80-F1-model_v4 deleted 0.9898 1 298
AF-A0A1H8LUM7-F1-model_v4 Uncharacterized conserved protein YecE, DUF72 family 0.9871 1 297
AF-A0A318VS80-F1-model_v4 deleted 0.9866 1 298
AF-A0A7K1SU90-F1-model_v4 DUF72 domain-containing protein 0.9854 1 299
AF-A0A7Y4XSG5-F1-model_v4 DUF72 domain-containing protein 0.982 1 298

Map