F379410

General Info

Members Datasets Scaffolds Average Seq Length
274 196 274 124

Family's Representative Sequence

Representative Sequence 3300000546|LJNas_1021193|LJNas_10211932
Length 125
Sequence MDWVVQIGLIELALGGLLGWAMVIRAEKSEWLTRIGVVAPQRIRQVHLDYVMMGLILIGVGLAVPDLPTVVAAALVFGTFVNPFLFVPLAFDPDAEKRLWYRALAVVSFLGVSGGLVAAAIVGPA

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
100 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
101 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
102 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
103 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
104 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
107 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
108 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
109 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
119 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
120 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
121 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
151 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
191 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
192 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
195 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
196 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.46
Nodule 0
Rhizoplane 8.39
Rhizosphere 87.59
Stem 0
Stem Tuber 0
Unclassified 2.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1021193 3300000546 Unclassified 693
2 JGI25404J52841_10009270 3300003659 Unclassified 2103
3 Ga0070658_10120170 3300005327 Unclassified 2183
4 Ga0070683_100010609 3300005329 Bacteria 7919
5 Ga0070683_100015665 3300005329 Bacteria 6665
6 Ga0070683_100169725 3300005329 Bacteria 2071
7 Ga0070690_100458763 3300005330 Bacteria 946
8 Ga0070666_10324761 3300005335 Unclassified 1098
9 Ga0070682_100000061 3300005337 Bacteria 105134
10 Ga0068868_100000220 3300005338 Bacteria 38739
11 Ga0070691_10000275 3300005341 Bacteria 17919
12 Ga0070661_100105022 3300005344 Bacteria 2105
13 Ga0070675_100000069 3300005354 Bacteria 59717
14 Ga0070674_100716678 3300005356 Bacteria 857
15 Ga0070688_100000053 3300005365 Bacteria 55064
16 Ga0070688_100000316 3300005365 Bacteria 24693
17 Ga0070667_100184534 3300005367 Bacteria 1846
18 Ga0070667_100422079 3300005367 Bacteria 1216
19 Ga0070714_100037035 3300005435 Bacteria 4097
20 Ga0070701_10144213 3300005438 Bacteria 1365
21 Ga0070711_100031118 3300005439 Bacteria 3539
22 Ga0070663_100093004 3300005455 Bacteria 2237
23 Ga0070678_100003823 3300005456 Bacteria 8447
24 Ga0070685_10000032 3300005466 Bacteria 84253
25 Ga0070685_10000086 3300005466 Bacteria 57017
26 Ga0070685_10219115 3300005466 Bacteria 1246
27 Ga0070684_100151612 3300005535 Bacteria 2100
28 Ga0070684_100185513 3300005535 Bacteria 1892
29 Ga0070684_100856764 3300005535 Bacteria 851
30 Ga0068853_100058665 3300005539 Bacteria 3323
31 Ga0070672_100000005 3300005543 Bacteria 121014
32 Ga0070686_100486802 3300005544 Unclassified 955
33 Ga0070695_100302955 3300005545 Bacteria 1182
34 Ga0070696_101223973 3300005546 Bacteria 635
35 Ga0070693_100957902 3300005547 Bacteria 645
36 Ga0070665_100017640 3300005548 Bacteria 7168
37 Ga0070665_100034780 3300005548 Bacteria 5068
38 Ga0070665_100094251 3300005548 Bacteria 2999
39 Ga0068855_100490572 3300005563 Bacteria 1336
40 Ga0070664_100136301 3300005564 Unclassified 2159
41 Ga0068857_100419184 3300005577 Bacteria 1248
42 Ga0068854_100000345 3300005578 Bacteria 29913
43 Ga0068856_100003669 3300005614 Bacteria 15395
44 Ga0068856_100026420 3300005614 Bacteria 5662
45 Ga0068852_100000037 3300005616 Bacteria 97602
46 Ga0068852_100008636 3300005616 Bacteria 7526
47 Ga0068866_10049416 3300005718 Bacteria 2131
48 Ga0068861_101149695 3300005719 Bacteria 748
49 Ga0068851_10005227 3300005834 Bacteria 5890
50 Ga0068851_10015919 3300005834 Bacteria 3591
51 Ga0068863_100002888 3300005841 Bacteria 17015
52 Ga0068858_100000017 3300005842 Bacteria 186913
53 Ga0068860_101528878 3300005843 Unclassified 689
54 Ga0081540_1000046 3300005983 Bacteria 131375
55 Ga0081539_10001074 3300005985 Bacteria 49797
56 Ga0068871_100279524 3300006358 Bacteria 1460
57 Ga0075430_100070718 3300006846 Bacteria 2927
58 Ga0068865_100000081 3300006881 Bacteria 51047
59 Ga0075435_100646448 3300007076 Bacteria 918
60 Ga0105240_12297302 3300009093 Bacteria 559
61 Ga0105245_10000249 3300009098 Bacteria 51282
62 Ga0105245_10019398 3300009098 Bacteria 5956
63 Ga0105245_11367778 3300009098 Bacteria 758
64 Ga0105247_10002606 3300009101 Bacteria 12180
65 Ga0105247_10100671 3300009101 Bacteria 1847
66 Ga0105243_10049213 3300009148 Bacteria 3324
67 Ga0105241_11495896 3300009174 Bacteria 650
68 Ga0105242_10000052 3300009176 Bacteria 79244
69 Ga0105242_12852226 3300009176 Bacteria 534
70 Ga0105248_10000017 3300009177 Bacteria 298089
71 Ga0105239_10024700 3300010375 Bacteria 6619
72 Ga0105239_10313526 3300010375 Bacteria 1768
73 Ga0105246_10462196 3300011119 Bacteria 1069
74 Ga0157370_10052505 3300013104 Bacteria 3892
75 Ga0157370_10143802 3300013104 Bacteria 2222
76 Ga0157369_10000105 3300013105 Bacteria 117996
77 Ga0157374_11684137 3300013296 Bacteria 659
78 Ga0157378_10046947 3300013297 Bacteria 3839
79 Ga0157378_10052908 3300013297 Bacteria 3613
80 Ga0157378_10064214 3300013297 Bacteria 3283
81 Ga0163162_10552816 3300013306 Unclassified 1279
82 Ga0157372_10000284 3300013307 Bacteria 56386
83 Ga0157372_11829947 3300013307 Bacteria 698
84 Ga0157375_10030632 3300013308 Bacteria 5076
85 Ga0157375_13615504 3300013308 Bacteria 514
86 Ga0157380_10000838 3300014326 Bacteria 19239
87 Ga0157380_10089529 3300014326 Bacteria 2536
88 Ga0157376_10178848 3300014969 Bacteria 1937
89 Ga0163161_10083146 3300017792 Bacteria 2359
90 Ga0163161_10738570 3300017792 Unclassified 822
91 Ga0207656_10002224 3300025321 Bacteria 6496
92 Ga0207656_10070113 3300025321 Bacteria 1556
93 Ga0207710_10000096 3300025900 Bacteria 116063
94 Ga0207680_10088670 3300025903 Unclassified 1962
95 Ga0207705_10575305 3300025909 Bacteria 876
96 Ga0207654_10150717 3300025911 Bacteria 1492
97 Ga0207663_10233557 3300025916 Bacteria 1345
98 Ga0207649_10309552 3300025920 Bacteria 1157
99 Ga0207659_10001302 3300025926 Bacteria 14889
100 Ga0207687_10000106 3300025927 Bacteria 61275
101 Ga0207687_10010977 3300025927 Bacteria 5919
102 Ga0207664_10030260 3300025929 Bacteria 4134
103 Ga0207686_10000035 3300025934 Bacteria 130483
104 Ga0207686_10003508 3300025934 Bacteria 8424
105 Ga0207709_10019786 3300025935 Bacteria 3789
106 Ga0207704_10000018 3300025938 Bacteria 153994
107 Ga0207691_10000028 3300025940 Bacteria 121090
108 Ga0207711_10000011 3300025941 Bacteria 518817
109 Ga0207661_10005996 3300025944 Bacteria 8582
110 Ga0207661_10019548 3300025944 Bacteria 5053
111 Ga0207679_10028232 3300025945 Bacteria 3891
112 Ga0207667_10359931 3300025949 Bacteria 1484
113 Ga0207668_10068403 3300025972 Bacteria 2525
114 Ga0207640_10000077 3300025981 Bacteria 76155
115 Ga0207658_10201985 3300025986 Unclassified 1660
116 Ga0207677_10005880 3300026023 Bacteria 6674
117 Ga0207703_10000030 3300026035 Bacteria 199014
118 Ga0207639_10025045 3300026041 Bacteria 4324
119 Ga0207639_10824265 3300026041 Unclassified 865
120 Ga0207678_10080828 3300026067 Bacteria 2782
121 Ga0207708_11677816 3300026075 Unclassified 558
122 Ga0207702_10000419 3300026078 Bacteria 48574
123 Ga0207702_10003965 3300026078 Bacteria 13291
124 Ga0207641_10002314 3300026088 Bacteria 17689
125 Ga0207641_12531078 3300026088 Bacteria 511
126 Ga0207674_10332300 3300026116 Bacteria 1470
127 Ga0207675_100267659 3300026118 Bacteria 1658
128 Ga0207683_10013197 3300026121 Bacteria 7048
129 Ga0207698_10000015 3300026142 Bacteria 207368
130 Ga0207698_10008081 3300026142 Bacteria 6635
131 Ga0268266_10001186 3300028379 Bacteria 32148
132 Ga0268266_10051928 3300028379 Bacteria 3520
133 Ga0268266_10650678 3300028379 Bacteria 1014
134 Ga0265337_1000101 3300028556 Bacteria 42173
135 Ga0265326_10000033 3300028558 Bacteria 91972
136 Ga0265319_1000010 3300028563 Bacteria 188773
137 Ga0265334_10109384 3300028573 Unclassified 994
138 Ga0265322_10000005 3300028654 Bacteria 246112
139 Ga0265322_10061772 3300028654 Bacteria 1063
140 Ga0265336_10010477 3300028666 Bacteria 3174
141 Ga0265338_10000051 3300028800 Bacteria 211202
142 Ga0265324_10000207 3300029957 Bacteria 44991
143 Ga0265324_10029327 3300029957 Bacteria 1935
144 Ga0307511_10292023 3300030521 Bacteria 744
145 Ga0265328_10001194 3300031239 Bacteria 12029
146 Ga0265320_10000010 3300031240 Bacteria 250501
147 Ga0265325_10005471 3300031241 Bacteria 7835
148 Ga0265329_10008633 3300031242 Bacteria 3850
149 Ga0265339_10016352 3300031249 Bacteria 4424
150 Ga0265331_10000869 3300031250 Bacteria 24602
151 Ga0265331_10027582 3300031250 Bacteria 2846
152 Ga0265327_10000040 3300031251 Bacteria 291052
153 Ga0265314_10000208 3300031711 Bacteria 86855
154 Ga0307412_11063347 3300031911 Bacteria 718
155 Ga0307415_100028559 3300032126 Bacteria 3551
156 Ga0451802_1404588 3300041460 Bacteria 590
157 Ga0451807_0572068 3300041486 Bacteria 1250
158 Ga0451835_0619253 3300041492 Unclassified 516
159 Ga0451849_1012422 3300041505 Bacteria 1003
160 Ga0451853_0492883 3300041512 Bacteria 940
161 Ga0451853_1795677 3300041512 Bacteria 1127
162 Ga0451853_2397034 3300041512 Bacteria 1347
163 Ga0466963_0042882 3300044694 Bacteria 2972
164 Ga0466957_0027253 3300044842 Bacteria 3395
165 Ga0466957_0040557 3300044842 Bacteria 2812
166 Ga0466967_0000012 3300045976 Bacteria 104270
167 Ga0495592_0099196 3300046454 Bacteria 2078
168 Ga0495592_0116149 3300046454 Bacteria 1889
169 Ga0495603_0000861 3300046455 Bacteria 17377
170 Ga0495603_0096067 3300046455 Bacteria 1731
171 Ga0495629_0000421 3300046459 Bacteria 35460
172 Ga0495629_0018857 3300046459 Bacteria 4932
173 Ga0495629_0033550 3300046459 Bacteria 3630
174 Ga0495629_0108204 3300046459 Bacteria 1939
175 Ga0495629_0245955 3300046459 Bacteria 1231
176 Ga0495638_0034123 3300046460 Bacteria 3250
177 Ga0495651_0057381 3300046462 Bacteria 2989
178 Ga0495651_0404482 3300046462 Bacteria 891
179 Ga0495594_0000012 3300046499 Bacteria 105133
180 Ga0495606_0000908 3300046507 Bacteria 43982
181 Ga0495608_0000013 3300046511 Bacteria 228481
182 Ga0495620_0141824 3300046515 Bacteria 939
183 Ga0495628_0686825 3300046516 Bacteria 724
184 Ga0495630_0000592 3300046517 Bacteria 26406
185 Ga0495630_0079524 3300046517 Bacteria 2473
186 Ga0495637_0062760 3300046520 Bacteria 1520
187 Ga0495652_0000009 3300046529 Bacteria 311000
188 Ga0495652_0024825 3300046529 Bacteria 5304
189 Ga0495640_0020061 3300046533 Bacteria 4927
190 Ga0495587_0011918 3300046536 Bacteria 5495
191 Ga0495645_0054850 3300046543 Bacteria 2894
192 Ga0495645_0141275 3300046543 Bacteria 1679
193 Ga0495622_0000076 3300046557 Bacteria 86777
194 Ga0495667_0000019 3300046559 Bacteria 181645
195 Ga0495667_0425596 3300046559 Bacteria 835
196 Ga0495667_0808870 3300046559 Unclassified 578
197 Ga0495656_0000151 3300046615 Bacteria 25724
198 Ga0495634_0000558 3300046642 Bacteria 36397
199 Ga0495634_0001012 3300046642 Bacteria 26406
200 Ga0495634_0012242 3300046642 Bacteria 6219
201 Ga0495625_0000395 3300046660 Bacteria 66640
202 Ga0495625_0629609 3300046660 Bacteria 641
203 Ga0495588_0000247 3300046674 Bacteria 45295
204 Ga0495657_0000003 3300046675 Bacteria 279680
205 Ga0495599_0255373 3300046678 Bacteria 1066
206 Ga0495646_0349694 3300046680 Bacteria 775
207 Ga0495647_0033958 3300046681 Bacteria 1908
208 Ga0495647_0219750 3300046681 Bacteria 838
209 Ga0495658_0002902 3300046683 Bacteria 8612
210 Ga0495669_0247364 3300046684 Unclassified 856
211 Ga0495613_0000132 3300046689 Bacteria 74233
212 Ga0495613_0048989 3300046689 Bacteria 3119
213 Ga0495613_0082962 3300046689 Bacteria 2328
214 Ga0495613_0924156 3300046689 Unclassified 564
215 Ga0495624_0000196 3300046690 Bacteria 46319
216 Ga0495600_0004607 3300046809 Bacteria 8259
217 Ga0495604_0099828 3300047317 Bacteria 2135
218 Ga0495674_0000024 3300047319 Bacteria 141746
219 Ga0495672_0244916 3300047320 Bacteria 873
220 Ga0495676_0037445 3300047321 Bacteria 4037
221 Ga0495676_0120390 3300047321 Bacteria 1910
222 Ga0495676_0301818 3300047321 Bacteria 1080
223 Ga0495680_0007564 3300047322 Bacteria 9935
224 Ga0495680_0011541 3300047322 Bacteria 7816
225 Ga0495675_0000094 3300047444 Bacteria 63338
226 Ga0495675_0370097 3300047444 Archaea 840
227 Ga0495684_0293572 3300047471 Bacteria 1169
228 Ga0495686_0069368 3300047472 Bacteria 2173
229 Ga0495593_0048881 3300047673 Unclassified 2247
230 Ga0495593_0091058 3300047673 Unclassified 1570
231 Ga0495593_0154458 3300047673 Bacteria 1160
232 Ga0495602_0000641 3300048088 Bacteria 32698
233 Ga0495602_0244943 3300048088 Bacteria 1339
234 Ga0495602_0245984 3300048088 Unclassified 1335
235 Ga0496100_0000019 3300048903 Bacteria 149995
236 Ga0496101_0000005 3300048904 Bacteria 331455
237 Ga0496102_0000438 3300048905 Bacteria 47526
238 Ga0496103_0000001 3300048906 Bacteria 643471
239 Ga0496104_0000010 3300048907 Bacteria 475255
240 Ga0496104_0077504 3300048907 Bacteria 3167
241 Ga0496105_0000005 3300048908 Bacteria 475797
242 Ga0496106_0000156 3300048909 Bacteria 50301
243 Ga0496107_0000004 3300048910 Bacteria 297680
244 Ga0496108_0000349 3300048911 Bacteria 39032
245 Ga0496108_0279757 3300048911 Bacteria 1453
246 Ga0496109_0000307 3300048912 Bacteria 46191
247 Ga0496110_0000166 3300048913 Bacteria 40195
248 Ga0496110_0365212 3300048913 Unclassified 1315
249 Ga0496111_0000046 3300048914 Bacteria 48246
250 Ga0496113_0013671 3300048916 Bacteria 5511
251 Ga0496113_0136022 3300048916 Unclassified 1931
252 Ga0496114_0000003 3300048917 Bacteria 630981
253 Ga0496114_0264178 3300048917 Bacteria 1516
254 Ga0496115_0000022 3300048918 Bacteria 164224
255 Ga0496115_0000027 3300048918 Bacteria 145505
256 Ga0496119_0365374 3300048922 Unclassified 695
257 Ga0501042_0092181 3300049578 Bacteria 2175
258 Ga0501068_0288091 3300049584 Bacteria 1050
259 Ga0501083_0820985 3300049744 Bacteria 605
260 nmdc:mga0yw44_379428_c1 3300050492 Unclassified 954
261 nmdc:mga0qj67_444336_c1 3300050509 Bacteria 1045
262 nmdc:mga0rr50_622054_c1 3300050513 Bacteria 921
263 Ga0495601_0154284 3300053077 Bacteria 1499
264 Ga0495612_0002233 3300053078 Bacteria 7962
265 Ga0495655_0000010 3300053083 Bacteria 125615
266 Ga0495655_0002765 3300053083 Bacteria 2822
267 Ga0495595_0000007 3300053084 Bacteria 228504
268 Ga0495595_0019454 3300053084 Bacteria 2945
269 Ga0495619_0000001 3300053085 Bacteria 586054
270 Ga0495619_0000747 3300053085 Bacteria 21190
271 Ga0495619_0001241 3300053085 Bacteria 16706
272 Ga0500566_0009429 3300053094 Bacteria 5768
273 Ga0500641_0001760 3300053096 Bacteria 7670
274 Ga0500628_000039 3300053129 Bacteria 49907

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009176 Ga0105242_12852226 Ga0105242_128522262 103
2 3300041460 Ga0451802_1404588 Ga0451802_1404588_251_565 104
3 3300041505 Ga0451849_1012422 Ga0451849_1012422_25_339 104
4 3300046559 Ga0495667_0425596 Ga0495667_0425596_11_325 104
5 3300046533 Ga0495640_0020061 Ga0495640_0020061_3608_4030 109
6 3300047319 Ga0495674_0000024 Ga0495674_0000024_24202_24624 109
7 3300046459 Ga0495629_0108204 Ga0495629_0108204_1110_1478 116
8 3300049584 Ga0501068_0288091 Ga0501068_0288091_70_447 119
9 3300005455 Ga0070663_100093004 Ga0070663_1000930043 120
10 3300009093 Ga0105240_12297302 Ga0105240_122973021 121
11 3300026067 Ga0207678_10080828 Ga0207678_100808283 121
12 3300046642 Ga0495634_0000558 Ga0495634_0000558_2943_3308 121
13 3300005435 Ga0070714_100037035 Ga0070714_1000370354 122
14 3300005546 Ga0070696_101223973 Ga0070696_1012239731 122
15 3300025929 Ga0207664_10030260 Ga0207664_100302603 122
16 3300045976 Ga0466967_0000012 Ga0466967_0000012_42892_43260 122
17 3300046455 Ga0495603_0096067 Ga0495603_0096067_177_545 122
18 3300046543 Ga0495645_0054850 Ga0495645_0054850_890_1258 122
19 3300046642 Ga0495634_0001012 Ga0495634_0001012_20937_21305 122
20 3300046681 Ga0495647_0033958 Ga0495647_0033958_684_1052 122
21 3300048088 Ga0495602_0245984 Ga0495602_0245984_870_1238 122
22 3300053078 Ga0495612_0002233 Ga0495612_0002233_3008_3376 122
23 3300005327 Ga0070658_10120170 Ga0070658_101201703 124
24 3300005330 Ga0070690_100458763 Ga0070690_1004587632 124
25 3300005335 Ga0070666_10324761 Ga0070666_103247612 124
26 3300005338 Ga0068868_100000220 Ga0068868_1000002207 124
27 3300005365 Ga0070688_100000316 Ga0070688_10000031621 124
28 3300005367 Ga0070667_100422079 Ga0070667_1004220792 124
29 3300005466 Ga0070685_10000032 Ga0070685_1000003235 124
30 3300005535 Ga0070684_100151612 Ga0070684_1001516122 124
31 3300005543 Ga0070672_100000005 Ga0070672_10000000536 124
32 3300005544 Ga0070686_100486802 Ga0070686_1004868022 124
33 3300005563 Ga0068855_100490572 Ga0068855_1004905722 124
34 3300005577 Ga0068857_100419184 Ga0068857_1004191842 124
35 3300005842 Ga0068858_100000017 Ga0068858_100000017127 124
36 3300005843 Ga0068860_101528878 Ga0068860_1015288782 124
37 3300009098 Ga0105245_10000249 Ga0105245_100002494 124
38 3300013104 Ga0157370_10143802 Ga0157370_101438022 124
39 3300013105 Ga0157369_10000105 Ga0157369_1000010591 124
40 3300013297 Ga0157378_10064214 Ga0157378_100642145 124
41 3300013308 Ga0157375_13615504 Ga0157375_136155041 124
42 3300017792 Ga0163161_10738570 Ga0163161_107385702 124
43 3300025903 Ga0207680_10088670 Ga0207680_100886703 124
44 3300025909 Ga0207705_10575305 Ga0207705_105753052 124
45 3300025927 Ga0207687_10000106 Ga0207687_100001064 124
46 3300025940 Ga0207691_10000028 Ga0207691_1000002894 124
47 3300025949 Ga0207667_10359931 Ga0207667_103599312 124
48 3300026023 Ga0207677_10005880 Ga0207677_100058802 124
49 3300026035 Ga0207703_10000030 Ga0207703_10000030125 124
50 3300026116 Ga0207674_10332300 Ga0207674_103323002 124
51 3300046462 Ga0495651_0057381 Ga0495651_0057381_856_1230 124
52 3300046507 Ga0495606_0000908 Ga0495606_0000908_30989_31363 124
53 3300046516 Ga0495628_0686825 Ga0495628_0686825_294_668 124
54 3300046520 Ga0495637_0062760 Ga0495637_0062760_933_1307 124
55 3300046559 Ga0495667_0808870 Ga0495667_0808870_34_408 124
56 3300046615 Ga0495656_0000151 Ga0495656_0000151_19910_20284 124
57 3300046660 Ga0495625_0629609 Ga0495625_0629609_62_436 124
58 3300046689 Ga0495613_0048989 Ga0495613_0048989_1223_1597 124
59 3300053085 Ga0495619_0000001 Ga0495619_0000001_300606_300980 124
60 3300000546 LJNas_1021193 LJNas_10211932 125
61 3300003659 JGI25404J52841_10009270 JGI25404J52841_100092703 125
62 3300005329 Ga0070683_100010609 Ga0070683_1000106094 125
63 3300005329 Ga0070683_100015665 Ga0070683_1000156654 125
64 3300005329 Ga0070683_100169725 Ga0070683_1001697252 125
65 3300005337 Ga0070682_100000061 Ga0070682_10000006132 125
66 3300005341 Ga0070691_10000275 Ga0070691_100002755 125
67 3300005344 Ga0070661_100105022 Ga0070661_1001050222 125
68 3300005354 Ga0070675_100000069 Ga0070675_10000006951 125
69 3300005356 Ga0070674_100716678 Ga0070674_1007166782 125
70 3300005365 Ga0070688_100000053 Ga0070688_10000005340 125
71 3300005367 Ga0070667_100184534 Ga0070667_1001845344 125
72 3300005438 Ga0070701_10144213 Ga0070701_101442132 125
73 3300005439 Ga0070711_100031118 Ga0070711_1000311183 125
74 3300005456 Ga0070678_100003823 Ga0070678_1000038236 125
75 3300005466 Ga0070685_10000086 Ga0070685_1000008620 125
76 3300005466 Ga0070685_10219115 Ga0070685_102191152 125
77 3300005535 Ga0070684_100185513 Ga0070684_1001855133 125
78 3300005535 Ga0070684_100856764 Ga0070684_1008567642 125
79 3300005539 Ga0068853_100058665 Ga0068853_1000586652 125
80 3300005545 Ga0070695_100302955 Ga0070695_1003029552 125
81 3300005547 Ga0070693_100957902 Ga0070693_1009579021 125
82 3300005548 Ga0070665_100017640 Ga0070665_1000176405 125
83 3300005548 Ga0070665_100034780 Ga0070665_1000347803 125
84 3300005548 Ga0070665_100094251 Ga0070665_1000942512 125
85 3300005564 Ga0070664_100136301 Ga0070664_1001363011 125
86 3300005578 Ga0068854_100000345 Ga0068854_10000034523 125
87 3300005614 Ga0068856_100003669 Ga0068856_1000036699 125
88 3300005614 Ga0068856_100026420 Ga0068856_1000264205 125
89 3300005616 Ga0068852_100000037 Ga0068852_10000003794 125
90 3300005616 Ga0068852_100008636 Ga0068852_1000086365 125
91 3300005718 Ga0068866_10049416 Ga0068866_100494162 125
92 3300005719 Ga0068861_101149695 Ga0068861_1011496952 125
93 3300005834 Ga0068851_10005227 Ga0068851_100052274 125
94 3300005834 Ga0068851_10015919 Ga0068851_100159194 125
95 3300005841 Ga0068863_100002888 Ga0068863_1000028885 125
96 3300005983 Ga0081540_1000046 Ga0081540_100004636 125
97 3300005985 Ga0081539_10001074 Ga0081539_1000107421 125
98 3300006358 Ga0068871_100279524 Ga0068871_1002795242 125
99 3300006846 Ga0075430_100070718 Ga0075430_1000707182 125
100 3300006881 Ga0068865_100000081 Ga0068865_10000008119 125
101 3300007076 Ga0075435_100646448 Ga0075435_1006464482 125
102 3300009098 Ga0105245_10019398 Ga0105245_100193984 125
103 3300009098 Ga0105245_11367778 Ga0105245_113677782 125
104 3300009101 Ga0105247_10002606 Ga0105247_100026068 125
105 3300009101 Ga0105247_10100671 Ga0105247_101006712 125
106 3300009148 Ga0105243_10049213 Ga0105243_100492133 125
107 3300009174 Ga0105241_11495896 Ga0105241_114958962 125
108 3300009176 Ga0105242_10000052 Ga0105242_100000524 125
109 3300009177 Ga0105248_10000017 Ga0105248_10000017215 125
110 3300010375 Ga0105239_10024700 Ga0105239_100247002 125
111 3300010375 Ga0105239_10313526 Ga0105239_103135262 125
112 3300011119 Ga0105246_10462196 Ga0105246_104621962 125
113 3300013104 Ga0157370_10052505 Ga0157370_100525053 125
114 3300013296 Ga0157374_11684137 Ga0157374_116841372 125
115 3300013297 Ga0157378_10046947 Ga0157378_100469475 125
116 3300013297 Ga0157378_10052908 Ga0157378_100529083 125
117 3300013306 Ga0163162_10552816 Ga0163162_105528162 125
118 3300013307 Ga0157372_10000284 Ga0157372_1000028426 125
119 3300013307 Ga0157372_11829947 Ga0157372_118299472 125
120 3300013308 Ga0157375_10030632 Ga0157375_100306324 125
121 3300014326 Ga0157380_10000838 Ga0157380_1000083815 125
122 3300014326 Ga0157380_10089529 Ga0157380_100895292 125
123 3300014969 Ga0157376_10178848 Ga0157376_101788482 125
124 3300017792 Ga0163161_10083146 Ga0163161_100831462 125
125 3300025321 Ga0207656_10002224 Ga0207656_100022245 125
126 3300025321 Ga0207656_10070113 Ga0207656_100701132 125
127 3300025900 Ga0207710_10000096 Ga0207710_1000009668 125
128 3300025911 Ga0207654_10150717 Ga0207654_101507172 125
129 3300025916 Ga0207663_10233557 Ga0207663_102335572 125
130 3300025920 Ga0207649_10309552 Ga0207649_103095522 125
131 3300025926 Ga0207659_10001302 Ga0207659_1000130213 125
132 3300025927 Ga0207687_10010977 Ga0207687_100109775 125
133 3300025934 Ga0207686_10000035 Ga0207686_10000035120 125
134 3300025934 Ga0207686_10003508 Ga0207686_100035084 125
135 3300025935 Ga0207709_10019786 Ga0207709_100197865 125
136 3300025938 Ga0207704_10000018 Ga0207704_1000001863 125
137 3300025941 Ga0207711_10000011 Ga0207711_10000011262 125
138 3300025944 Ga0207661_10005996 Ga0207661_100059965 125
139 3300025944 Ga0207661_10019548 Ga0207661_100195485 125
140 3300025945 Ga0207679_10028232 Ga0207679_100282324 125
141 3300025972 Ga0207668_10068403 Ga0207668_100684032 125
142 3300025981 Ga0207640_10000077 Ga0207640_1000007722 125
143 3300025986 Ga0207658_10201985 Ga0207658_102019852 125
144 3300026041 Ga0207639_10025045 Ga0207639_100250454 125
145 3300026041 Ga0207639_10824265 Ga0207639_108242652 125
146 3300026075 Ga0207708_11677816 Ga0207708_116778162 125
147 3300026078 Ga0207702_10000419 Ga0207702_1000041937 125
148 3300026078 Ga0207702_10003965 Ga0207702_100039659 125
149 3300026088 Ga0207641_10002314 Ga0207641_100023144 125
150 3300026088 Ga0207641_12531078 Ga0207641_125310782 125
151 3300026118 Ga0207675_100267659 Ga0207675_1002676593 125
152 3300026121 Ga0207683_10013197 Ga0207683_100131976 125
153 3300026142 Ga0207698_10000015 Ga0207698_10000015216 125
154 3300026142 Ga0207698_10008081 Ga0207698_100080815 125
155 3300028379 Ga0268266_10001186 Ga0268266_100011865 125
156 3300028379 Ga0268266_10051928 Ga0268266_100519283 125
157 3300028379 Ga0268266_10650678 Ga0268266_106506781 125
158 3300028556 Ga0265337_1000101 Ga0265337_100010113 125
159 3300028558 Ga0265326_10000033 Ga0265326_1000003386 125
160 3300028563 Ga0265319_1000010 Ga0265319_1000010167 125
161 3300028573 Ga0265334_10109384 Ga0265334_101093842 125
162 3300028654 Ga0265322_10000005 Ga0265322_1000000540 125
163 3300028654 Ga0265322_10061772 Ga0265322_100617722 125
164 3300028666 Ga0265336_10010477 Ga0265336_100104772 125
165 3300028800 Ga0265338_10000051 Ga0265338_1000005160 125
166 3300029957 Ga0265324_10000207 Ga0265324_1000020724 125
167 3300029957 Ga0265324_10029327 Ga0265324_100293272 125
168 3300030521 Ga0307511_10292023 Ga0307511_102920232 125
169 3300031239 Ga0265328_10001194 Ga0265328_100011948 125
170 3300031240 Ga0265320_10000010 Ga0265320_1000001086 125
171 3300031241 Ga0265325_10005471 Ga0265325_100054712 125
172 3300031242 Ga0265329_10008633 Ga0265329_100086336 125
173 3300031249 Ga0265339_10016352 Ga0265339_100163523 125
174 3300031250 Ga0265331_10000869 Ga0265331_1000086919 125
175 3300031250 Ga0265331_10027582 Ga0265331_100275823 125
176 3300031251 Ga0265327_10000040 Ga0265327_10000040221 125
177 3300031711 Ga0265314_10000208 Ga0265314_1000020820 125
178 3300031911 Ga0307412_11063347 Ga0307412_110633472 125
179 3300032126 Ga0307415_100028559 Ga0307415_1000285591 125
180 3300041486 Ga0451807_0572068 Ga0451807_0572068_838_1215 125
181 3300041492 Ga0451835_0619253 Ga0451835_0619253_55_432 125
182 3300041512 Ga0451853_0492883 Ga0451853_0492883_154_531 125
183 3300041512 Ga0451853_1795677 Ga0451853_1795677_396_773 125
184 3300041512 Ga0451853_2397034 Ga0451853_2397034_165_542 125
185 3300044694 Ga0466963_0042882 Ga0466963_0042882_930_1307 125
186 3300044842 Ga0466957_0027253 Ga0466957_0027253_907_1284 125
187 3300044842 Ga0466957_0040557 Ga0466957_0040557_2360_2737 125
188 3300046454 Ga0495592_0099196 Ga0495592_0099196_1206_1583 125
189 3300046454 Ga0495592_0116149 Ga0495592_0116149_1377_1754 125
190 3300046455 Ga0495603_0000861 Ga0495603_0000861_8071_8448 125
191 3300046459 Ga0495629_0000421 Ga0495629_0000421_31373_31750 125
192 3300046459 Ga0495629_0018857 Ga0495629_0018857_3639_4016 125
193 3300046459 Ga0495629_0033550 Ga0495629_0033550_441_818 125
194 3300046459 Ga0495629_0245955 Ga0495629_0245955_669_1046 125
195 3300046460 Ga0495638_0034123 Ga0495638_0034123_721_1098 125
196 3300046462 Ga0495651_0404482 Ga0495651_0404482_168_545 125
197 3300046499 Ga0495594_0000012 Ga0495594_0000012_7838_8215 125
198 3300046511 Ga0495608_0000013 Ga0495608_0000013_215801_216178 125
199 3300046515 Ga0495620_0141824 Ga0495620_0141824_214_591 125
200 3300046517 Ga0495630_0000592 Ga0495630_0000592_56_433 125
201 3300046517 Ga0495630_0079524 Ga0495630_0079524_691_1068 125
202 3300046529 Ga0495652_0000009 Ga0495652_0000009_5990_6367 125
203 3300046529 Ga0495652_0024825 Ga0495652_0024825_462_839 125
204 3300046536 Ga0495587_0011918 Ga0495587_0011918_2341_2718 125
205 3300046543 Ga0495645_0141275 Ga0495645_0141275_336_713 125
206 3300046557 Ga0495622_0000076 Ga0495622_0000076_45007_45384 125
207 3300046559 Ga0495667_0000019 Ga0495667_0000019_147329_147706 125
208 3300046642 Ga0495634_0012242 Ga0495634_0012242_2360_2737 125
209 3300046660 Ga0495625_0000395 Ga0495625_0000395_25066_25443 125
210 3300046674 Ga0495588_0000247 Ga0495588_0000247_27047_27424 125
211 3300046675 Ga0495657_0000003 Ga0495657_0000003_267000_267377 125
212 3300046678 Ga0495599_0255373 Ga0495599_0255373_296_673 125
213 3300046680 Ga0495646_0349694 Ga0495646_0349694_87_464 125
214 3300046681 Ga0495647_0219750 Ga0495647_0219750_35_412 125
215 3300046683 Ga0495658_0002902 Ga0495658_0002902_7117_7494 125
216 3300046684 Ga0495669_0247364 Ga0495669_0247364_333_710 125
217 3300046689 Ga0495613_0000132 Ga0495613_0000132_32746_33123 125
218 3300046689 Ga0495613_0082962 Ga0495613_0082962_1821_2198 125
219 3300046689 Ga0495613_0924156 Ga0495613_0924156_172_549 125
220 3300046690 Ga0495624_0000196 Ga0495624_0000196_26851_27228 125
221 3300046809 Ga0495600_0004607 Ga0495600_0004607_996_1373 125
222 3300047317 Ga0495604_0099828 Ga0495604_0099828_1149_1526 125
223 3300047320 Ga0495672_0244916 Ga0495672_0244916_256_633 125
224 3300047321 Ga0495676_0037445 Ga0495676_0037445_255_632 125
225 3300047321 Ga0495676_0120390 Ga0495676_0120390_390_767 125
226 3300047321 Ga0495676_0301818 Ga0495676_0301818_225_602 125
227 3300047322 Ga0495680_0007564 Ga0495680_0007564_5667_6044 125
228 3300047322 Ga0495680_0011541 Ga0495680_0011541_2860_3237 125
229 3300047444 Ga0495675_0000094 Ga0495675_0000094_12304_12681 125
230 3300047444 Ga0495675_0370097 Ga0495675_0370097_114_491 125
231 3300047471 Ga0495684_0293572 Ga0495684_0293572_733_1110 125
232 3300047472 Ga0495686_0069368 Ga0495686_0069368_786_1163 125
233 3300047673 Ga0495593_0048881 Ga0495593_0048881_201_578 125
234 3300047673 Ga0495593_0091058 Ga0495593_0091058_46_423 125
235 3300047673 Ga0495593_0154458 Ga0495593_0154458_710_1087 125
236 3300048088 Ga0495602_0000641 Ga0495602_0000641_1117_1494 125
237 3300048088 Ga0495602_0244943 Ga0495602_0244943_247_624 125
238 3300048903 Ga0496100_0000019 Ga0496100_0000019_32274_32651 125
239 3300048904 Ga0496101_0000005 Ga0496101_0000005_32274_32651 125
240 3300048905 Ga0496102_0000438 Ga0496102_0000438_40280_40657 125
241 3300048906 Ga0496103_0000001 Ga0496103_0000001_636197_636574 125
242 3300048907 Ga0496104_0000010 Ga0496104_0000010_407504_407881 125
243 3300048907 Ga0496104_0077504 Ga0496104_0077504_2075_2452 125
244 3300048908 Ga0496105_0000005 Ga0496105_0000005_407504_407881 125
245 3300048909 Ga0496106_0000156 Ga0496106_0000156_32565_32942 125
246 3300048910 Ga0496107_0000004 Ga0496107_0000004_32491_32868 125
247 3300048911 Ga0496108_0000349 Ga0496108_0000349_12736_13113 125
248 3300048911 Ga0496108_0279757 Ga0496108_0279757_906_1283 125
249 3300048912 Ga0496109_0000307 Ga0496109_0000307_12727_13104 125
250 3300048913 Ga0496110_0000166 Ga0496110_0000166_7324_7701 125
251 3300048913 Ga0496110_0365212 Ga0496110_0365212_751_1128 125
252 3300048914 Ga0496111_0000046 Ga0496111_0000046_44252_44629 125
253 3300048916 Ga0496113_0013671 Ga0496113_0013671_3616_3993 125
254 3300048916 Ga0496113_0136022 Ga0496113_0136022_1109_1486 125
255 3300048917 Ga0496114_0000003 Ga0496114_0000003_384864_385241 125
256 3300048917 Ga0496114_0264178 Ga0496114_0264178_244_621 125
257 3300048918 Ga0496115_0000022 Ga0496115_0000022_81526_81903 125
258 3300048918 Ga0496115_0000027 Ga0496115_0000027_111151_111528 125
259 3300048922 Ga0496119_0365374 Ga0496119_0365374_49_426 125
260 3300049578 Ga0501042_0092181 Ga0501042_0092181_1247_1624 125
261 3300049744 Ga0501083_0820985 Ga0501083_0820985_184_561 125
262 3300050492 nmdc:mga0yw44_379428_c1 nmdc:mga0yw44_379428_c1_59_436 125
263 3300050509 nmdc:mga0qj67_444336_c1 nmdc:mga0qj67_444336_c1_120_497 125
264 3300050513 nmdc:mga0rr50_622054_c1 nmdc:mga0rr50_622054_c1_177_554 125
265 3300053077 Ga0495601_0154284 Ga0495601_0154284_370_747 125
266 3300053083 Ga0495655_0000010 Ga0495655_0000010_24995_25372 125
267 3300053083 Ga0495655_0002765 Ga0495655_0002765_2391_2768 125
268 3300053084 Ga0495595_0000007 Ga0495595_0000007_215824_216201 125
269 3300053084 Ga0495595_0019454 Ga0495595_0019454_1092_1469 125
270 3300053085 Ga0495619_0000747 Ga0495619_0000747_19690_20067 125
271 3300053085 Ga0495619_0001241 Ga0495619_0001241_4026_4403 125
272 3300053094 Ga0500566_0009429 Ga0500566_0009429_4755_5132 125
273 3300053096 Ga0500641_0001760 Ga0500641_0001760_2182_2559 125
274 3300053129 Ga0500628_000039 Ga0500628_000039_19483_19860 125

Structural Annotation

Top 5 Hits

ID Description Score Start End
8oyy-assembly2.cif.gz_B de novo designed soluble gpcr-like fold glf_32 0.5979 1 86
1oed-assembly1.cif.gz_E structure of acetylcholine receptor pore from electron images 0.4999 2 97
4jrz-assembly1.cif.gz_A human ltc4 synthase in complex with product analogs - implications for enzyme catalysis 0.4856 4 118
6v4l-assembly1.cif.gz_A structure of trkh-trka in complex with atpgammas 0.4791 4 113
7njl-assembly1.cif.gz_R mycobacterium smegmatis atp synthase state 1b 0.4755 3 79
ID Description Score Start End Superfamily
af_Q5T9Z0_97_218_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.6809 41 119 1.20.58.390
af_Q4CM10_1_131_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.604 23 122 1.20.140.150
af_Q6Z250_27_140_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.555 4 116 1.20.930.20
af_A0A0N7KMI5_9_203_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5498 1 118 1.20.1070.10
af_Q8MZ67_1_133_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5459 2 124 1.20.140.150
ID Description Score Start End GO Terms
AF-X5DQ22-F1-model_v4 Putative membrane protein 0.9297 4 121 GO:0016020
AF-A0A124E5P1-F1-model_v4 deleted 0.9281 4 122
AF-A0A1M9G936-F1-model_v4 deleted 0.9228 1 121
AF-H6N3Q9-F1-model_v4 Uncharacterized protein 0.9183 4 121
AF-D3FB85-F1-model_v4 Uncharacterized protein 0.915 4 124 GO:0016020

Feature Viewer

pLDDT pTM Quality
74.74 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map