F379410
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 274 | 196 | 274 | 124 |
Family's Representative Sequence
| Representative Sequence | 3300000546|LJNas_1021193|LJNas_10211932 |
| Length | 125 |
| Sequence | MDWVVQIGLIELALGGLLGWAMVIRAEKSEWLTRIGVVAPQRIRQVHLDYVMMGLILIGVGLAVPDLPTVVAAALVFGTFVNPFLFVPLAFDPDAEKRLWYRALAVVSFLGVSGGLVAAAIVGPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 42 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 100 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 101 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 102 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 103 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 104 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 105 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 106 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 107 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 108 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 109 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 110 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 111 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 112 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 114 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 115 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 116 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 117 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 118 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 119 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 120 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 121 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 122 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 123 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 124 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 125 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 126 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 170 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 171 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 172 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 173 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 174 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 175 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 178 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 179 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 180 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 181 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 182 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 183 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 187 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 195 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 196 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.46 |
| Nodule | 0 |
| Rhizoplane | 8.39 |
| Rhizosphere | 87.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1021193 | 3300000546 | Unclassified | 693 |
| 2 | JGI25404J52841_10009270 | 3300003659 | Unclassified | 2103 |
| 3 | Ga0070658_10120170 | 3300005327 | Unclassified | 2183 |
| 4 | Ga0070683_100010609 | 3300005329 | Bacteria | 7919 |
| 5 | Ga0070683_100015665 | 3300005329 | Bacteria | 6665 |
| 6 | Ga0070683_100169725 | 3300005329 | Bacteria | 2071 |
| 7 | Ga0070690_100458763 | 3300005330 | Bacteria | 946 |
| 8 | Ga0070666_10324761 | 3300005335 | Unclassified | 1098 |
| 9 | Ga0070682_100000061 | 3300005337 | Bacteria | 105134 |
| 10 | Ga0068868_100000220 | 3300005338 | Bacteria | 38739 |
| 11 | Ga0070691_10000275 | 3300005341 | Bacteria | 17919 |
| 12 | Ga0070661_100105022 | 3300005344 | Bacteria | 2105 |
| 13 | Ga0070675_100000069 | 3300005354 | Bacteria | 59717 |
| 14 | Ga0070674_100716678 | 3300005356 | Bacteria | 857 |
| 15 | Ga0070688_100000053 | 3300005365 | Bacteria | 55064 |
| 16 | Ga0070688_100000316 | 3300005365 | Bacteria | 24693 |
| 17 | Ga0070667_100184534 | 3300005367 | Bacteria | 1846 |
| 18 | Ga0070667_100422079 | 3300005367 | Bacteria | 1216 |
| 19 | Ga0070714_100037035 | 3300005435 | Bacteria | 4097 |
| 20 | Ga0070701_10144213 | 3300005438 | Bacteria | 1365 |
| 21 | Ga0070711_100031118 | 3300005439 | Bacteria | 3539 |
| 22 | Ga0070663_100093004 | 3300005455 | Bacteria | 2237 |
| 23 | Ga0070678_100003823 | 3300005456 | Bacteria | 8447 |
| 24 | Ga0070685_10000032 | 3300005466 | Bacteria | 84253 |
| 25 | Ga0070685_10000086 | 3300005466 | Bacteria | 57017 |
| 26 | Ga0070685_10219115 | 3300005466 | Bacteria | 1246 |
| 27 | Ga0070684_100151612 | 3300005535 | Bacteria | 2100 |
| 28 | Ga0070684_100185513 | 3300005535 | Bacteria | 1892 |
| 29 | Ga0070684_100856764 | 3300005535 | Bacteria | 851 |
| 30 | Ga0068853_100058665 | 3300005539 | Bacteria | 3323 |
| 31 | Ga0070672_100000005 | 3300005543 | Bacteria | 121014 |
| 32 | Ga0070686_100486802 | 3300005544 | Unclassified | 955 |
| 33 | Ga0070695_100302955 | 3300005545 | Bacteria | 1182 |
| 34 | Ga0070696_101223973 | 3300005546 | Bacteria | 635 |
| 35 | Ga0070693_100957902 | 3300005547 | Bacteria | 645 |
| 36 | Ga0070665_100017640 | 3300005548 | Bacteria | 7168 |
| 37 | Ga0070665_100034780 | 3300005548 | Bacteria | 5068 |
| 38 | Ga0070665_100094251 | 3300005548 | Bacteria | 2999 |
| 39 | Ga0068855_100490572 | 3300005563 | Bacteria | 1336 |
| 40 | Ga0070664_100136301 | 3300005564 | Unclassified | 2159 |
| 41 | Ga0068857_100419184 | 3300005577 | Bacteria | 1248 |
| 42 | Ga0068854_100000345 | 3300005578 | Bacteria | 29913 |
| 43 | Ga0068856_100003669 | 3300005614 | Bacteria | 15395 |
| 44 | Ga0068856_100026420 | 3300005614 | Bacteria | 5662 |
| 45 | Ga0068852_100000037 | 3300005616 | Bacteria | 97602 |
| 46 | Ga0068852_100008636 | 3300005616 | Bacteria | 7526 |
| 47 | Ga0068866_10049416 | 3300005718 | Bacteria | 2131 |
| 48 | Ga0068861_101149695 | 3300005719 | Bacteria | 748 |
| 49 | Ga0068851_10005227 | 3300005834 | Bacteria | 5890 |
| 50 | Ga0068851_10015919 | 3300005834 | Bacteria | 3591 |
| 51 | Ga0068863_100002888 | 3300005841 | Bacteria | 17015 |
| 52 | Ga0068858_100000017 | 3300005842 | Bacteria | 186913 |
| 53 | Ga0068860_101528878 | 3300005843 | Unclassified | 689 |
| 54 | Ga0081540_1000046 | 3300005983 | Bacteria | 131375 |
| 55 | Ga0081539_10001074 | 3300005985 | Bacteria | 49797 |
| 56 | Ga0068871_100279524 | 3300006358 | Bacteria | 1460 |
| 57 | Ga0075430_100070718 | 3300006846 | Bacteria | 2927 |
| 58 | Ga0068865_100000081 | 3300006881 | Bacteria | 51047 |
| 59 | Ga0075435_100646448 | 3300007076 | Bacteria | 918 |
| 60 | Ga0105240_12297302 | 3300009093 | Bacteria | 559 |
| 61 | Ga0105245_10000249 | 3300009098 | Bacteria | 51282 |
| 62 | Ga0105245_10019398 | 3300009098 | Bacteria | 5956 |
| 63 | Ga0105245_11367778 | 3300009098 | Bacteria | 758 |
| 64 | Ga0105247_10002606 | 3300009101 | Bacteria | 12180 |
| 65 | Ga0105247_10100671 | 3300009101 | Bacteria | 1847 |
| 66 | Ga0105243_10049213 | 3300009148 | Bacteria | 3324 |
| 67 | Ga0105241_11495896 | 3300009174 | Bacteria | 650 |
| 68 | Ga0105242_10000052 | 3300009176 | Bacteria | 79244 |
| 69 | Ga0105242_12852226 | 3300009176 | Bacteria | 534 |
| 70 | Ga0105248_10000017 | 3300009177 | Bacteria | 298089 |
| 71 | Ga0105239_10024700 | 3300010375 | Bacteria | 6619 |
| 72 | Ga0105239_10313526 | 3300010375 | Bacteria | 1768 |
| 73 | Ga0105246_10462196 | 3300011119 | Bacteria | 1069 |
| 74 | Ga0157370_10052505 | 3300013104 | Bacteria | 3892 |
| 75 | Ga0157370_10143802 | 3300013104 | Bacteria | 2222 |
| 76 | Ga0157369_10000105 | 3300013105 | Bacteria | 117996 |
| 77 | Ga0157374_11684137 | 3300013296 | Bacteria | 659 |
| 78 | Ga0157378_10046947 | 3300013297 | Bacteria | 3839 |
| 79 | Ga0157378_10052908 | 3300013297 | Bacteria | 3613 |
| 80 | Ga0157378_10064214 | 3300013297 | Bacteria | 3283 |
| 81 | Ga0163162_10552816 | 3300013306 | Unclassified | 1279 |
| 82 | Ga0157372_10000284 | 3300013307 | Bacteria | 56386 |
| 83 | Ga0157372_11829947 | 3300013307 | Bacteria | 698 |
| 84 | Ga0157375_10030632 | 3300013308 | Bacteria | 5076 |
| 85 | Ga0157375_13615504 | 3300013308 | Bacteria | 514 |
| 86 | Ga0157380_10000838 | 3300014326 | Bacteria | 19239 |
| 87 | Ga0157380_10089529 | 3300014326 | Bacteria | 2536 |
| 88 | Ga0157376_10178848 | 3300014969 | Bacteria | 1937 |
| 89 | Ga0163161_10083146 | 3300017792 | Bacteria | 2359 |
| 90 | Ga0163161_10738570 | 3300017792 | Unclassified | 822 |
| 91 | Ga0207656_10002224 | 3300025321 | Bacteria | 6496 |
| 92 | Ga0207656_10070113 | 3300025321 | Bacteria | 1556 |
| 93 | Ga0207710_10000096 | 3300025900 | Bacteria | 116063 |
| 94 | Ga0207680_10088670 | 3300025903 | Unclassified | 1962 |
| 95 | Ga0207705_10575305 | 3300025909 | Bacteria | 876 |
| 96 | Ga0207654_10150717 | 3300025911 | Bacteria | 1492 |
| 97 | Ga0207663_10233557 | 3300025916 | Bacteria | 1345 |
| 98 | Ga0207649_10309552 | 3300025920 | Bacteria | 1157 |
| 99 | Ga0207659_10001302 | 3300025926 | Bacteria | 14889 |
| 100 | Ga0207687_10000106 | 3300025927 | Bacteria | 61275 |
| 101 | Ga0207687_10010977 | 3300025927 | Bacteria | 5919 |
| 102 | Ga0207664_10030260 | 3300025929 | Bacteria | 4134 |
| 103 | Ga0207686_10000035 | 3300025934 | Bacteria | 130483 |
| 104 | Ga0207686_10003508 | 3300025934 | Bacteria | 8424 |
| 105 | Ga0207709_10019786 | 3300025935 | Bacteria | 3789 |
| 106 | Ga0207704_10000018 | 3300025938 | Bacteria | 153994 |
| 107 | Ga0207691_10000028 | 3300025940 | Bacteria | 121090 |
| 108 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 109 | Ga0207661_10005996 | 3300025944 | Bacteria | 8582 |
| 110 | Ga0207661_10019548 | 3300025944 | Bacteria | 5053 |
| 111 | Ga0207679_10028232 | 3300025945 | Bacteria | 3891 |
| 112 | Ga0207667_10359931 | 3300025949 | Bacteria | 1484 |
| 113 | Ga0207668_10068403 | 3300025972 | Bacteria | 2525 |
| 114 | Ga0207640_10000077 | 3300025981 | Bacteria | 76155 |
| 115 | Ga0207658_10201985 | 3300025986 | Unclassified | 1660 |
| 116 | Ga0207677_10005880 | 3300026023 | Bacteria | 6674 |
| 117 | Ga0207703_10000030 | 3300026035 | Bacteria | 199014 |
| 118 | Ga0207639_10025045 | 3300026041 | Bacteria | 4324 |
| 119 | Ga0207639_10824265 | 3300026041 | Unclassified | 865 |
| 120 | Ga0207678_10080828 | 3300026067 | Bacteria | 2782 |
| 121 | Ga0207708_11677816 | 3300026075 | Unclassified | 558 |
| 122 | Ga0207702_10000419 | 3300026078 | Bacteria | 48574 |
| 123 | Ga0207702_10003965 | 3300026078 | Bacteria | 13291 |
| 124 | Ga0207641_10002314 | 3300026088 | Bacteria | 17689 |
| 125 | Ga0207641_12531078 | 3300026088 | Bacteria | 511 |
| 126 | Ga0207674_10332300 | 3300026116 | Bacteria | 1470 |
| 127 | Ga0207675_100267659 | 3300026118 | Bacteria | 1658 |
| 128 | Ga0207683_10013197 | 3300026121 | Bacteria | 7048 |
| 129 | Ga0207698_10000015 | 3300026142 | Bacteria | 207368 |
| 130 | Ga0207698_10008081 | 3300026142 | Bacteria | 6635 |
| 131 | Ga0268266_10001186 | 3300028379 | Bacteria | 32148 |
| 132 | Ga0268266_10051928 | 3300028379 | Bacteria | 3520 |
| 133 | Ga0268266_10650678 | 3300028379 | Bacteria | 1014 |
| 134 | Ga0265337_1000101 | 3300028556 | Bacteria | 42173 |
| 135 | Ga0265326_10000033 | 3300028558 | Bacteria | 91972 |
| 136 | Ga0265319_1000010 | 3300028563 | Bacteria | 188773 |
| 137 | Ga0265334_10109384 | 3300028573 | Unclassified | 994 |
| 138 | Ga0265322_10000005 | 3300028654 | Bacteria | 246112 |
| 139 | Ga0265322_10061772 | 3300028654 | Bacteria | 1063 |
| 140 | Ga0265336_10010477 | 3300028666 | Bacteria | 3174 |
| 141 | Ga0265338_10000051 | 3300028800 | Bacteria | 211202 |
| 142 | Ga0265324_10000207 | 3300029957 | Bacteria | 44991 |
| 143 | Ga0265324_10029327 | 3300029957 | Bacteria | 1935 |
| 144 | Ga0307511_10292023 | 3300030521 | Bacteria | 744 |
| 145 | Ga0265328_10001194 | 3300031239 | Bacteria | 12029 |
| 146 | Ga0265320_10000010 | 3300031240 | Bacteria | 250501 |
| 147 | Ga0265325_10005471 | 3300031241 | Bacteria | 7835 |
| 148 | Ga0265329_10008633 | 3300031242 | Bacteria | 3850 |
| 149 | Ga0265339_10016352 | 3300031249 | Bacteria | 4424 |
| 150 | Ga0265331_10000869 | 3300031250 | Bacteria | 24602 |
| 151 | Ga0265331_10027582 | 3300031250 | Bacteria | 2846 |
| 152 | Ga0265327_10000040 | 3300031251 | Bacteria | 291052 |
| 153 | Ga0265314_10000208 | 3300031711 | Bacteria | 86855 |
| 154 | Ga0307412_11063347 | 3300031911 | Bacteria | 718 |
| 155 | Ga0307415_100028559 | 3300032126 | Bacteria | 3551 |
| 156 | Ga0451802_1404588 | 3300041460 | Bacteria | 590 |
| 157 | Ga0451807_0572068 | 3300041486 | Bacteria | 1250 |
| 158 | Ga0451835_0619253 | 3300041492 | Unclassified | 516 |
| 159 | Ga0451849_1012422 | 3300041505 | Bacteria | 1003 |
| 160 | Ga0451853_0492883 | 3300041512 | Bacteria | 940 |
| 161 | Ga0451853_1795677 | 3300041512 | Bacteria | 1127 |
| 162 | Ga0451853_2397034 | 3300041512 | Bacteria | 1347 |
| 163 | Ga0466963_0042882 | 3300044694 | Bacteria | 2972 |
| 164 | Ga0466957_0027253 | 3300044842 | Bacteria | 3395 |
| 165 | Ga0466957_0040557 | 3300044842 | Bacteria | 2812 |
| 166 | Ga0466967_0000012 | 3300045976 | Bacteria | 104270 |
| 167 | Ga0495592_0099196 | 3300046454 | Bacteria | 2078 |
| 168 | Ga0495592_0116149 | 3300046454 | Bacteria | 1889 |
| 169 | Ga0495603_0000861 | 3300046455 | Bacteria | 17377 |
| 170 | Ga0495603_0096067 | 3300046455 | Bacteria | 1731 |
| 171 | Ga0495629_0000421 | 3300046459 | Bacteria | 35460 |
| 172 | Ga0495629_0018857 | 3300046459 | Bacteria | 4932 |
| 173 | Ga0495629_0033550 | 3300046459 | Bacteria | 3630 |
| 174 | Ga0495629_0108204 | 3300046459 | Bacteria | 1939 |
| 175 | Ga0495629_0245955 | 3300046459 | Bacteria | 1231 |
| 176 | Ga0495638_0034123 | 3300046460 | Bacteria | 3250 |
| 177 | Ga0495651_0057381 | 3300046462 | Bacteria | 2989 |
| 178 | Ga0495651_0404482 | 3300046462 | Bacteria | 891 |
| 179 | Ga0495594_0000012 | 3300046499 | Bacteria | 105133 |
| 180 | Ga0495606_0000908 | 3300046507 | Bacteria | 43982 |
| 181 | Ga0495608_0000013 | 3300046511 | Bacteria | 228481 |
| 182 | Ga0495620_0141824 | 3300046515 | Bacteria | 939 |
| 183 | Ga0495628_0686825 | 3300046516 | Bacteria | 724 |
| 184 | Ga0495630_0000592 | 3300046517 | Bacteria | 26406 |
| 185 | Ga0495630_0079524 | 3300046517 | Bacteria | 2473 |
| 186 | Ga0495637_0062760 | 3300046520 | Bacteria | 1520 |
| 187 | Ga0495652_0000009 | 3300046529 | Bacteria | 311000 |
| 188 | Ga0495652_0024825 | 3300046529 | Bacteria | 5304 |
| 189 | Ga0495640_0020061 | 3300046533 | Bacteria | 4927 |
| 190 | Ga0495587_0011918 | 3300046536 | Bacteria | 5495 |
| 191 | Ga0495645_0054850 | 3300046543 | Bacteria | 2894 |
| 192 | Ga0495645_0141275 | 3300046543 | Bacteria | 1679 |
| 193 | Ga0495622_0000076 | 3300046557 | Bacteria | 86777 |
| 194 | Ga0495667_0000019 | 3300046559 | Bacteria | 181645 |
| 195 | Ga0495667_0425596 | 3300046559 | Bacteria | 835 |
| 196 | Ga0495667_0808870 | 3300046559 | Unclassified | 578 |
| 197 | Ga0495656_0000151 | 3300046615 | Bacteria | 25724 |
| 198 | Ga0495634_0000558 | 3300046642 | Bacteria | 36397 |
| 199 | Ga0495634_0001012 | 3300046642 | Bacteria | 26406 |
| 200 | Ga0495634_0012242 | 3300046642 | Bacteria | 6219 |
| 201 | Ga0495625_0000395 | 3300046660 | Bacteria | 66640 |
| 202 | Ga0495625_0629609 | 3300046660 | Bacteria | 641 |
| 203 | Ga0495588_0000247 | 3300046674 | Bacteria | 45295 |
| 204 | Ga0495657_0000003 | 3300046675 | Bacteria | 279680 |
| 205 | Ga0495599_0255373 | 3300046678 | Bacteria | 1066 |
| 206 | Ga0495646_0349694 | 3300046680 | Bacteria | 775 |
| 207 | Ga0495647_0033958 | 3300046681 | Bacteria | 1908 |
| 208 | Ga0495647_0219750 | 3300046681 | Bacteria | 838 |
| 209 | Ga0495658_0002902 | 3300046683 | Bacteria | 8612 |
| 210 | Ga0495669_0247364 | 3300046684 | Unclassified | 856 |
| 211 | Ga0495613_0000132 | 3300046689 | Bacteria | 74233 |
| 212 | Ga0495613_0048989 | 3300046689 | Bacteria | 3119 |
| 213 | Ga0495613_0082962 | 3300046689 | Bacteria | 2328 |
| 214 | Ga0495613_0924156 | 3300046689 | Unclassified | 564 |
| 215 | Ga0495624_0000196 | 3300046690 | Bacteria | 46319 |
| 216 | Ga0495600_0004607 | 3300046809 | Bacteria | 8259 |
| 217 | Ga0495604_0099828 | 3300047317 | Bacteria | 2135 |
| 218 | Ga0495674_0000024 | 3300047319 | Bacteria | 141746 |
| 219 | Ga0495672_0244916 | 3300047320 | Bacteria | 873 |
| 220 | Ga0495676_0037445 | 3300047321 | Bacteria | 4037 |
| 221 | Ga0495676_0120390 | 3300047321 | Bacteria | 1910 |
| 222 | Ga0495676_0301818 | 3300047321 | Bacteria | 1080 |
| 223 | Ga0495680_0007564 | 3300047322 | Bacteria | 9935 |
| 224 | Ga0495680_0011541 | 3300047322 | Bacteria | 7816 |
| 225 | Ga0495675_0000094 | 3300047444 | Bacteria | 63338 |
| 226 | Ga0495675_0370097 | 3300047444 | Archaea | 840 |
| 227 | Ga0495684_0293572 | 3300047471 | Bacteria | 1169 |
| 228 | Ga0495686_0069368 | 3300047472 | Bacteria | 2173 |
| 229 | Ga0495593_0048881 | 3300047673 | Unclassified | 2247 |
| 230 | Ga0495593_0091058 | 3300047673 | Unclassified | 1570 |
| 231 | Ga0495593_0154458 | 3300047673 | Bacteria | 1160 |
| 232 | Ga0495602_0000641 | 3300048088 | Bacteria | 32698 |
| 233 | Ga0495602_0244943 | 3300048088 | Bacteria | 1339 |
| 234 | Ga0495602_0245984 | 3300048088 | Unclassified | 1335 |
| 235 | Ga0496100_0000019 | 3300048903 | Bacteria | 149995 |
| 236 | Ga0496101_0000005 | 3300048904 | Bacteria | 331455 |
| 237 | Ga0496102_0000438 | 3300048905 | Bacteria | 47526 |
| 238 | Ga0496103_0000001 | 3300048906 | Bacteria | 643471 |
| 239 | Ga0496104_0000010 | 3300048907 | Bacteria | 475255 |
| 240 | Ga0496104_0077504 | 3300048907 | Bacteria | 3167 |
| 241 | Ga0496105_0000005 | 3300048908 | Bacteria | 475797 |
| 242 | Ga0496106_0000156 | 3300048909 | Bacteria | 50301 |
| 243 | Ga0496107_0000004 | 3300048910 | Bacteria | 297680 |
| 244 | Ga0496108_0000349 | 3300048911 | Bacteria | 39032 |
| 245 | Ga0496108_0279757 | 3300048911 | Bacteria | 1453 |
| 246 | Ga0496109_0000307 | 3300048912 | Bacteria | 46191 |
| 247 | Ga0496110_0000166 | 3300048913 | Bacteria | 40195 |
| 248 | Ga0496110_0365212 | 3300048913 | Unclassified | 1315 |
| 249 | Ga0496111_0000046 | 3300048914 | Bacteria | 48246 |
| 250 | Ga0496113_0013671 | 3300048916 | Bacteria | 5511 |
| 251 | Ga0496113_0136022 | 3300048916 | Unclassified | 1931 |
| 252 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 253 | Ga0496114_0264178 | 3300048917 | Bacteria | 1516 |
| 254 | Ga0496115_0000022 | 3300048918 | Bacteria | 164224 |
| 255 | Ga0496115_0000027 | 3300048918 | Bacteria | 145505 |
| 256 | Ga0496119_0365374 | 3300048922 | Unclassified | 695 |
| 257 | Ga0501042_0092181 | 3300049578 | Bacteria | 2175 |
| 258 | Ga0501068_0288091 | 3300049584 | Bacteria | 1050 |
| 259 | Ga0501083_0820985 | 3300049744 | Bacteria | 605 |
| 260 | nmdc:mga0yw44_379428_c1 | 3300050492 | Unclassified | 954 |
| 261 | nmdc:mga0qj67_444336_c1 | 3300050509 | Bacteria | 1045 |
| 262 | nmdc:mga0rr50_622054_c1 | 3300050513 | Bacteria | 921 |
| 263 | Ga0495601_0154284 | 3300053077 | Bacteria | 1499 |
| 264 | Ga0495612_0002233 | 3300053078 | Bacteria | 7962 |
| 265 | Ga0495655_0000010 | 3300053083 | Bacteria | 125615 |
| 266 | Ga0495655_0002765 | 3300053083 | Bacteria | 2822 |
| 267 | Ga0495595_0000007 | 3300053084 | Bacteria | 228504 |
| 268 | Ga0495595_0019454 | 3300053084 | Bacteria | 2945 |
| 269 | Ga0495619_0000001 | 3300053085 | Bacteria | 586054 |
| 270 | Ga0495619_0000747 | 3300053085 | Bacteria | 21190 |
| 271 | Ga0495619_0001241 | 3300053085 | Bacteria | 16706 |
| 272 | Ga0500566_0009429 | 3300053094 | Bacteria | 5768 |
| 273 | Ga0500641_0001760 | 3300053096 | Bacteria | 7670 |
| 274 | Ga0500628_000039 | 3300053129 | Bacteria | 49907 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009176 | Ga0105242_12852226 | Ga0105242_128522262 | 103 |
| 2 | 3300041460 | Ga0451802_1404588 | Ga0451802_1404588_251_565 | 104 |
| 3 | 3300041505 | Ga0451849_1012422 | Ga0451849_1012422_25_339 | 104 |
| 4 | 3300046559 | Ga0495667_0425596 | Ga0495667_0425596_11_325 | 104 |
| 5 | 3300046533 | Ga0495640_0020061 | Ga0495640_0020061_3608_4030 | 109 |
| 6 | 3300047319 | Ga0495674_0000024 | Ga0495674_0000024_24202_24624 | 109 |
| 7 | 3300046459 | Ga0495629_0108204 | Ga0495629_0108204_1110_1478 | 116 |
| 8 | 3300049584 | Ga0501068_0288091 | Ga0501068_0288091_70_447 | 119 |
| 9 | 3300005455 | Ga0070663_100093004 | Ga0070663_1000930043 | 120 |
| 10 | 3300009093 | Ga0105240_12297302 | Ga0105240_122973021 | 121 |
| 11 | 3300026067 | Ga0207678_10080828 | Ga0207678_100808283 | 121 |
| 12 | 3300046642 | Ga0495634_0000558 | Ga0495634_0000558_2943_3308 | 121 |
| 13 | 3300005435 | Ga0070714_100037035 | Ga0070714_1000370354 | 122 |
| 14 | 3300005546 | Ga0070696_101223973 | Ga0070696_1012239731 | 122 |
| 15 | 3300025929 | Ga0207664_10030260 | Ga0207664_100302603 | 122 |
| 16 | 3300045976 | Ga0466967_0000012 | Ga0466967_0000012_42892_43260 | 122 |
| 17 | 3300046455 | Ga0495603_0096067 | Ga0495603_0096067_177_545 | 122 |
| 18 | 3300046543 | Ga0495645_0054850 | Ga0495645_0054850_890_1258 | 122 |
| 19 | 3300046642 | Ga0495634_0001012 | Ga0495634_0001012_20937_21305 | 122 |
| 20 | 3300046681 | Ga0495647_0033958 | Ga0495647_0033958_684_1052 | 122 |
| 21 | 3300048088 | Ga0495602_0245984 | Ga0495602_0245984_870_1238 | 122 |
| 22 | 3300053078 | Ga0495612_0002233 | Ga0495612_0002233_3008_3376 | 122 |
| 23 | 3300005327 | Ga0070658_10120170 | Ga0070658_101201703 | 124 |
| 24 | 3300005330 | Ga0070690_100458763 | Ga0070690_1004587632 | 124 |
| 25 | 3300005335 | Ga0070666_10324761 | Ga0070666_103247612 | 124 |
| 26 | 3300005338 | Ga0068868_100000220 | Ga0068868_1000002207 | 124 |
| 27 | 3300005365 | Ga0070688_100000316 | Ga0070688_10000031621 | 124 |
| 28 | 3300005367 | Ga0070667_100422079 | Ga0070667_1004220792 | 124 |
| 29 | 3300005466 | Ga0070685_10000032 | Ga0070685_1000003235 | 124 |
| 30 | 3300005535 | Ga0070684_100151612 | Ga0070684_1001516122 | 124 |
| 31 | 3300005543 | Ga0070672_100000005 | Ga0070672_10000000536 | 124 |
| 32 | 3300005544 | Ga0070686_100486802 | Ga0070686_1004868022 | 124 |
| 33 | 3300005563 | Ga0068855_100490572 | Ga0068855_1004905722 | 124 |
| 34 | 3300005577 | Ga0068857_100419184 | Ga0068857_1004191842 | 124 |
| 35 | 3300005842 | Ga0068858_100000017 | Ga0068858_100000017127 | 124 |
| 36 | 3300005843 | Ga0068860_101528878 | Ga0068860_1015288782 | 124 |
| 37 | 3300009098 | Ga0105245_10000249 | Ga0105245_100002494 | 124 |
| 38 | 3300013104 | Ga0157370_10143802 | Ga0157370_101438022 | 124 |
| 39 | 3300013105 | Ga0157369_10000105 | Ga0157369_1000010591 | 124 |
| 40 | 3300013297 | Ga0157378_10064214 | Ga0157378_100642145 | 124 |
| 41 | 3300013308 | Ga0157375_13615504 | Ga0157375_136155041 | 124 |
| 42 | 3300017792 | Ga0163161_10738570 | Ga0163161_107385702 | 124 |
| 43 | 3300025903 | Ga0207680_10088670 | Ga0207680_100886703 | 124 |
| 44 | 3300025909 | Ga0207705_10575305 | Ga0207705_105753052 | 124 |
| 45 | 3300025927 | Ga0207687_10000106 | Ga0207687_100001064 | 124 |
| 46 | 3300025940 | Ga0207691_10000028 | Ga0207691_1000002894 | 124 |
| 47 | 3300025949 | Ga0207667_10359931 | Ga0207667_103599312 | 124 |
| 48 | 3300026023 | Ga0207677_10005880 | Ga0207677_100058802 | 124 |
| 49 | 3300026035 | Ga0207703_10000030 | Ga0207703_10000030125 | 124 |
| 50 | 3300026116 | Ga0207674_10332300 | Ga0207674_103323002 | 124 |
| 51 | 3300046462 | Ga0495651_0057381 | Ga0495651_0057381_856_1230 | 124 |
| 52 | 3300046507 | Ga0495606_0000908 | Ga0495606_0000908_30989_31363 | 124 |
| 53 | 3300046516 | Ga0495628_0686825 | Ga0495628_0686825_294_668 | 124 |
| 54 | 3300046520 | Ga0495637_0062760 | Ga0495637_0062760_933_1307 | 124 |
| 55 | 3300046559 | Ga0495667_0808870 | Ga0495667_0808870_34_408 | 124 |
| 56 | 3300046615 | Ga0495656_0000151 | Ga0495656_0000151_19910_20284 | 124 |
| 57 | 3300046660 | Ga0495625_0629609 | Ga0495625_0629609_62_436 | 124 |
| 58 | 3300046689 | Ga0495613_0048989 | Ga0495613_0048989_1223_1597 | 124 |
| 59 | 3300053085 | Ga0495619_0000001 | Ga0495619_0000001_300606_300980 | 124 |
| 60 | 3300000546 | LJNas_1021193 | LJNas_10211932 | 125 |
| 61 | 3300003659 | JGI25404J52841_10009270 | JGI25404J52841_100092703 | 125 |
| 62 | 3300005329 | Ga0070683_100010609 | Ga0070683_1000106094 | 125 |
| 63 | 3300005329 | Ga0070683_100015665 | Ga0070683_1000156654 | 125 |
| 64 | 3300005329 | Ga0070683_100169725 | Ga0070683_1001697252 | 125 |
| 65 | 3300005337 | Ga0070682_100000061 | Ga0070682_10000006132 | 125 |
| 66 | 3300005341 | Ga0070691_10000275 | Ga0070691_100002755 | 125 |
| 67 | 3300005344 | Ga0070661_100105022 | Ga0070661_1001050222 | 125 |
| 68 | 3300005354 | Ga0070675_100000069 | Ga0070675_10000006951 | 125 |
| 69 | 3300005356 | Ga0070674_100716678 | Ga0070674_1007166782 | 125 |
| 70 | 3300005365 | Ga0070688_100000053 | Ga0070688_10000005340 | 125 |
| 71 | 3300005367 | Ga0070667_100184534 | Ga0070667_1001845344 | 125 |
| 72 | 3300005438 | Ga0070701_10144213 | Ga0070701_101442132 | 125 |
| 73 | 3300005439 | Ga0070711_100031118 | Ga0070711_1000311183 | 125 |
| 74 | 3300005456 | Ga0070678_100003823 | Ga0070678_1000038236 | 125 |
| 75 | 3300005466 | Ga0070685_10000086 | Ga0070685_1000008620 | 125 |
| 76 | 3300005466 | Ga0070685_10219115 | Ga0070685_102191152 | 125 |
| 77 | 3300005535 | Ga0070684_100185513 | Ga0070684_1001855133 | 125 |
| 78 | 3300005535 | Ga0070684_100856764 | Ga0070684_1008567642 | 125 |
| 79 | 3300005539 | Ga0068853_100058665 | Ga0068853_1000586652 | 125 |
| 80 | 3300005545 | Ga0070695_100302955 | Ga0070695_1003029552 | 125 |
| 81 | 3300005547 | Ga0070693_100957902 | Ga0070693_1009579021 | 125 |
| 82 | 3300005548 | Ga0070665_100017640 | Ga0070665_1000176405 | 125 |
| 83 | 3300005548 | Ga0070665_100034780 | Ga0070665_1000347803 | 125 |
| 84 | 3300005548 | Ga0070665_100094251 | Ga0070665_1000942512 | 125 |
| 85 | 3300005564 | Ga0070664_100136301 | Ga0070664_1001363011 | 125 |
| 86 | 3300005578 | Ga0068854_100000345 | Ga0068854_10000034523 | 125 |
| 87 | 3300005614 | Ga0068856_100003669 | Ga0068856_1000036699 | 125 |
| 88 | 3300005614 | Ga0068856_100026420 | Ga0068856_1000264205 | 125 |
| 89 | 3300005616 | Ga0068852_100000037 | Ga0068852_10000003794 | 125 |
| 90 | 3300005616 | Ga0068852_100008636 | Ga0068852_1000086365 | 125 |
| 91 | 3300005718 | Ga0068866_10049416 | Ga0068866_100494162 | 125 |
| 92 | 3300005719 | Ga0068861_101149695 | Ga0068861_1011496952 | 125 |
| 93 | 3300005834 | Ga0068851_10005227 | Ga0068851_100052274 | 125 |
| 94 | 3300005834 | Ga0068851_10015919 | Ga0068851_100159194 | 125 |
| 95 | 3300005841 | Ga0068863_100002888 | Ga0068863_1000028885 | 125 |
| 96 | 3300005983 | Ga0081540_1000046 | Ga0081540_100004636 | 125 |
| 97 | 3300005985 | Ga0081539_10001074 | Ga0081539_1000107421 | 125 |
| 98 | 3300006358 | Ga0068871_100279524 | Ga0068871_1002795242 | 125 |
| 99 | 3300006846 | Ga0075430_100070718 | Ga0075430_1000707182 | 125 |
| 100 | 3300006881 | Ga0068865_100000081 | Ga0068865_10000008119 | 125 |
| 101 | 3300007076 | Ga0075435_100646448 | Ga0075435_1006464482 | 125 |
| 102 | 3300009098 | Ga0105245_10019398 | Ga0105245_100193984 | 125 |
| 103 | 3300009098 | Ga0105245_11367778 | Ga0105245_113677782 | 125 |
| 104 | 3300009101 | Ga0105247_10002606 | Ga0105247_100026068 | 125 |
| 105 | 3300009101 | Ga0105247_10100671 | Ga0105247_101006712 | 125 |
| 106 | 3300009148 | Ga0105243_10049213 | Ga0105243_100492133 | 125 |
| 107 | 3300009174 | Ga0105241_11495896 | Ga0105241_114958962 | 125 |
| 108 | 3300009176 | Ga0105242_10000052 | Ga0105242_100000524 | 125 |
| 109 | 3300009177 | Ga0105248_10000017 | Ga0105248_10000017215 | 125 |
| 110 | 3300010375 | Ga0105239_10024700 | Ga0105239_100247002 | 125 |
| 111 | 3300010375 | Ga0105239_10313526 | Ga0105239_103135262 | 125 |
| 112 | 3300011119 | Ga0105246_10462196 | Ga0105246_104621962 | 125 |
| 113 | 3300013104 | Ga0157370_10052505 | Ga0157370_100525053 | 125 |
| 114 | 3300013296 | Ga0157374_11684137 | Ga0157374_116841372 | 125 |
| 115 | 3300013297 | Ga0157378_10046947 | Ga0157378_100469475 | 125 |
| 116 | 3300013297 | Ga0157378_10052908 | Ga0157378_100529083 | 125 |
| 117 | 3300013306 | Ga0163162_10552816 | Ga0163162_105528162 | 125 |
| 118 | 3300013307 | Ga0157372_10000284 | Ga0157372_1000028426 | 125 |
| 119 | 3300013307 | Ga0157372_11829947 | Ga0157372_118299472 | 125 |
| 120 | 3300013308 | Ga0157375_10030632 | Ga0157375_100306324 | 125 |
| 121 | 3300014326 | Ga0157380_10000838 | Ga0157380_1000083815 | 125 |
| 122 | 3300014326 | Ga0157380_10089529 | Ga0157380_100895292 | 125 |
| 123 | 3300014969 | Ga0157376_10178848 | Ga0157376_101788482 | 125 |
| 124 | 3300017792 | Ga0163161_10083146 | Ga0163161_100831462 | 125 |
| 125 | 3300025321 | Ga0207656_10002224 | Ga0207656_100022245 | 125 |
| 126 | 3300025321 | Ga0207656_10070113 | Ga0207656_100701132 | 125 |
| 127 | 3300025900 | Ga0207710_10000096 | Ga0207710_1000009668 | 125 |
| 128 | 3300025911 | Ga0207654_10150717 | Ga0207654_101507172 | 125 |
| 129 | 3300025916 | Ga0207663_10233557 | Ga0207663_102335572 | 125 |
| 130 | 3300025920 | Ga0207649_10309552 | Ga0207649_103095522 | 125 |
| 131 | 3300025926 | Ga0207659_10001302 | Ga0207659_1000130213 | 125 |
| 132 | 3300025927 | Ga0207687_10010977 | Ga0207687_100109775 | 125 |
| 133 | 3300025934 | Ga0207686_10000035 | Ga0207686_10000035120 | 125 |
| 134 | 3300025934 | Ga0207686_10003508 | Ga0207686_100035084 | 125 |
| 135 | 3300025935 | Ga0207709_10019786 | Ga0207709_100197865 | 125 |
| 136 | 3300025938 | Ga0207704_10000018 | Ga0207704_1000001863 | 125 |
| 137 | 3300025941 | Ga0207711_10000011 | Ga0207711_10000011262 | 125 |
| 138 | 3300025944 | Ga0207661_10005996 | Ga0207661_100059965 | 125 |
| 139 | 3300025944 | Ga0207661_10019548 | Ga0207661_100195485 | 125 |
| 140 | 3300025945 | Ga0207679_10028232 | Ga0207679_100282324 | 125 |
| 141 | 3300025972 | Ga0207668_10068403 | Ga0207668_100684032 | 125 |
| 142 | 3300025981 | Ga0207640_10000077 | Ga0207640_1000007722 | 125 |
| 143 | 3300025986 | Ga0207658_10201985 | Ga0207658_102019852 | 125 |
| 144 | 3300026041 | Ga0207639_10025045 | Ga0207639_100250454 | 125 |
| 145 | 3300026041 | Ga0207639_10824265 | Ga0207639_108242652 | 125 |
| 146 | 3300026075 | Ga0207708_11677816 | Ga0207708_116778162 | 125 |
| 147 | 3300026078 | Ga0207702_10000419 | Ga0207702_1000041937 | 125 |
| 148 | 3300026078 | Ga0207702_10003965 | Ga0207702_100039659 | 125 |
| 149 | 3300026088 | Ga0207641_10002314 | Ga0207641_100023144 | 125 |
| 150 | 3300026088 | Ga0207641_12531078 | Ga0207641_125310782 | 125 |
| 151 | 3300026118 | Ga0207675_100267659 | Ga0207675_1002676593 | 125 |
| 152 | 3300026121 | Ga0207683_10013197 | Ga0207683_100131976 | 125 |
| 153 | 3300026142 | Ga0207698_10000015 | Ga0207698_10000015216 | 125 |
| 154 | 3300026142 | Ga0207698_10008081 | Ga0207698_100080815 | 125 |
| 155 | 3300028379 | Ga0268266_10001186 | Ga0268266_100011865 | 125 |
| 156 | 3300028379 | Ga0268266_10051928 | Ga0268266_100519283 | 125 |
| 157 | 3300028379 | Ga0268266_10650678 | Ga0268266_106506781 | 125 |
| 158 | 3300028556 | Ga0265337_1000101 | Ga0265337_100010113 | 125 |
| 159 | 3300028558 | Ga0265326_10000033 | Ga0265326_1000003386 | 125 |
| 160 | 3300028563 | Ga0265319_1000010 | Ga0265319_1000010167 | 125 |
| 161 | 3300028573 | Ga0265334_10109384 | Ga0265334_101093842 | 125 |
| 162 | 3300028654 | Ga0265322_10000005 | Ga0265322_1000000540 | 125 |
| 163 | 3300028654 | Ga0265322_10061772 | Ga0265322_100617722 | 125 |
| 164 | 3300028666 | Ga0265336_10010477 | Ga0265336_100104772 | 125 |
| 165 | 3300028800 | Ga0265338_10000051 | Ga0265338_1000005160 | 125 |
| 166 | 3300029957 | Ga0265324_10000207 | Ga0265324_1000020724 | 125 |
| 167 | 3300029957 | Ga0265324_10029327 | Ga0265324_100293272 | 125 |
| 168 | 3300030521 | Ga0307511_10292023 | Ga0307511_102920232 | 125 |
| 169 | 3300031239 | Ga0265328_10001194 | Ga0265328_100011948 | 125 |
| 170 | 3300031240 | Ga0265320_10000010 | Ga0265320_1000001086 | 125 |
| 171 | 3300031241 | Ga0265325_10005471 | Ga0265325_100054712 | 125 |
| 172 | 3300031242 | Ga0265329_10008633 | Ga0265329_100086336 | 125 |
| 173 | 3300031249 | Ga0265339_10016352 | Ga0265339_100163523 | 125 |
| 174 | 3300031250 | Ga0265331_10000869 | Ga0265331_1000086919 | 125 |
| 175 | 3300031250 | Ga0265331_10027582 | Ga0265331_100275823 | 125 |
| 176 | 3300031251 | Ga0265327_10000040 | Ga0265327_10000040221 | 125 |
| 177 | 3300031711 | Ga0265314_10000208 | Ga0265314_1000020820 | 125 |
| 178 | 3300031911 | Ga0307412_11063347 | Ga0307412_110633472 | 125 |
| 179 | 3300032126 | Ga0307415_100028559 | Ga0307415_1000285591 | 125 |
| 180 | 3300041486 | Ga0451807_0572068 | Ga0451807_0572068_838_1215 | 125 |
| 181 | 3300041492 | Ga0451835_0619253 | Ga0451835_0619253_55_432 | 125 |
| 182 | 3300041512 | Ga0451853_0492883 | Ga0451853_0492883_154_531 | 125 |
| 183 | 3300041512 | Ga0451853_1795677 | Ga0451853_1795677_396_773 | 125 |
| 184 | 3300041512 | Ga0451853_2397034 | Ga0451853_2397034_165_542 | 125 |
| 185 | 3300044694 | Ga0466963_0042882 | Ga0466963_0042882_930_1307 | 125 |
| 186 | 3300044842 | Ga0466957_0027253 | Ga0466957_0027253_907_1284 | 125 |
| 187 | 3300044842 | Ga0466957_0040557 | Ga0466957_0040557_2360_2737 | 125 |
| 188 | 3300046454 | Ga0495592_0099196 | Ga0495592_0099196_1206_1583 | 125 |
| 189 | 3300046454 | Ga0495592_0116149 | Ga0495592_0116149_1377_1754 | 125 |
| 190 | 3300046455 | Ga0495603_0000861 | Ga0495603_0000861_8071_8448 | 125 |
| 191 | 3300046459 | Ga0495629_0000421 | Ga0495629_0000421_31373_31750 | 125 |
| 192 | 3300046459 | Ga0495629_0018857 | Ga0495629_0018857_3639_4016 | 125 |
| 193 | 3300046459 | Ga0495629_0033550 | Ga0495629_0033550_441_818 | 125 |
| 194 | 3300046459 | Ga0495629_0245955 | Ga0495629_0245955_669_1046 | 125 |
| 195 | 3300046460 | Ga0495638_0034123 | Ga0495638_0034123_721_1098 | 125 |
| 196 | 3300046462 | Ga0495651_0404482 | Ga0495651_0404482_168_545 | 125 |
| 197 | 3300046499 | Ga0495594_0000012 | Ga0495594_0000012_7838_8215 | 125 |
| 198 | 3300046511 | Ga0495608_0000013 | Ga0495608_0000013_215801_216178 | 125 |
| 199 | 3300046515 | Ga0495620_0141824 | Ga0495620_0141824_214_591 | 125 |
| 200 | 3300046517 | Ga0495630_0000592 | Ga0495630_0000592_56_433 | 125 |
| 201 | 3300046517 | Ga0495630_0079524 | Ga0495630_0079524_691_1068 | 125 |
| 202 | 3300046529 | Ga0495652_0000009 | Ga0495652_0000009_5990_6367 | 125 |
| 203 | 3300046529 | Ga0495652_0024825 | Ga0495652_0024825_462_839 | 125 |
| 204 | 3300046536 | Ga0495587_0011918 | Ga0495587_0011918_2341_2718 | 125 |
| 205 | 3300046543 | Ga0495645_0141275 | Ga0495645_0141275_336_713 | 125 |
| 206 | 3300046557 | Ga0495622_0000076 | Ga0495622_0000076_45007_45384 | 125 |
| 207 | 3300046559 | Ga0495667_0000019 | Ga0495667_0000019_147329_147706 | 125 |
| 208 | 3300046642 | Ga0495634_0012242 | Ga0495634_0012242_2360_2737 | 125 |
| 209 | 3300046660 | Ga0495625_0000395 | Ga0495625_0000395_25066_25443 | 125 |
| 210 | 3300046674 | Ga0495588_0000247 | Ga0495588_0000247_27047_27424 | 125 |
| 211 | 3300046675 | Ga0495657_0000003 | Ga0495657_0000003_267000_267377 | 125 |
| 212 | 3300046678 | Ga0495599_0255373 | Ga0495599_0255373_296_673 | 125 |
| 213 | 3300046680 | Ga0495646_0349694 | Ga0495646_0349694_87_464 | 125 |
| 214 | 3300046681 | Ga0495647_0219750 | Ga0495647_0219750_35_412 | 125 |
| 215 | 3300046683 | Ga0495658_0002902 | Ga0495658_0002902_7117_7494 | 125 |
| 216 | 3300046684 | Ga0495669_0247364 | Ga0495669_0247364_333_710 | 125 |
| 217 | 3300046689 | Ga0495613_0000132 | Ga0495613_0000132_32746_33123 | 125 |
| 218 | 3300046689 | Ga0495613_0082962 | Ga0495613_0082962_1821_2198 | 125 |
| 219 | 3300046689 | Ga0495613_0924156 | Ga0495613_0924156_172_549 | 125 |
| 220 | 3300046690 | Ga0495624_0000196 | Ga0495624_0000196_26851_27228 | 125 |
| 221 | 3300046809 | Ga0495600_0004607 | Ga0495600_0004607_996_1373 | 125 |
| 222 | 3300047317 | Ga0495604_0099828 | Ga0495604_0099828_1149_1526 | 125 |
| 223 | 3300047320 | Ga0495672_0244916 | Ga0495672_0244916_256_633 | 125 |
| 224 | 3300047321 | Ga0495676_0037445 | Ga0495676_0037445_255_632 | 125 |
| 225 | 3300047321 | Ga0495676_0120390 | Ga0495676_0120390_390_767 | 125 |
| 226 | 3300047321 | Ga0495676_0301818 | Ga0495676_0301818_225_602 | 125 |
| 227 | 3300047322 | Ga0495680_0007564 | Ga0495680_0007564_5667_6044 | 125 |
| 228 | 3300047322 | Ga0495680_0011541 | Ga0495680_0011541_2860_3237 | 125 |
| 229 | 3300047444 | Ga0495675_0000094 | Ga0495675_0000094_12304_12681 | 125 |
| 230 | 3300047444 | Ga0495675_0370097 | Ga0495675_0370097_114_491 | 125 |
| 231 | 3300047471 | Ga0495684_0293572 | Ga0495684_0293572_733_1110 | 125 |
| 232 | 3300047472 | Ga0495686_0069368 | Ga0495686_0069368_786_1163 | 125 |
| 233 | 3300047673 | Ga0495593_0048881 | Ga0495593_0048881_201_578 | 125 |
| 234 | 3300047673 | Ga0495593_0091058 | Ga0495593_0091058_46_423 | 125 |
| 235 | 3300047673 | Ga0495593_0154458 | Ga0495593_0154458_710_1087 | 125 |
| 236 | 3300048088 | Ga0495602_0000641 | Ga0495602_0000641_1117_1494 | 125 |
| 237 | 3300048088 | Ga0495602_0244943 | Ga0495602_0244943_247_624 | 125 |
| 238 | 3300048903 | Ga0496100_0000019 | Ga0496100_0000019_32274_32651 | 125 |
| 239 | 3300048904 | Ga0496101_0000005 | Ga0496101_0000005_32274_32651 | 125 |
| 240 | 3300048905 | Ga0496102_0000438 | Ga0496102_0000438_40280_40657 | 125 |
| 241 | 3300048906 | Ga0496103_0000001 | Ga0496103_0000001_636197_636574 | 125 |
| 242 | 3300048907 | Ga0496104_0000010 | Ga0496104_0000010_407504_407881 | 125 |
| 243 | 3300048907 | Ga0496104_0077504 | Ga0496104_0077504_2075_2452 | 125 |
| 244 | 3300048908 | Ga0496105_0000005 | Ga0496105_0000005_407504_407881 | 125 |
| 245 | 3300048909 | Ga0496106_0000156 | Ga0496106_0000156_32565_32942 | 125 |
| 246 | 3300048910 | Ga0496107_0000004 | Ga0496107_0000004_32491_32868 | 125 |
| 247 | 3300048911 | Ga0496108_0000349 | Ga0496108_0000349_12736_13113 | 125 |
| 248 | 3300048911 | Ga0496108_0279757 | Ga0496108_0279757_906_1283 | 125 |
| 249 | 3300048912 | Ga0496109_0000307 | Ga0496109_0000307_12727_13104 | 125 |
| 250 | 3300048913 | Ga0496110_0000166 | Ga0496110_0000166_7324_7701 | 125 |
| 251 | 3300048913 | Ga0496110_0365212 | Ga0496110_0365212_751_1128 | 125 |
| 252 | 3300048914 | Ga0496111_0000046 | Ga0496111_0000046_44252_44629 | 125 |
| 253 | 3300048916 | Ga0496113_0013671 | Ga0496113_0013671_3616_3993 | 125 |
| 254 | 3300048916 | Ga0496113_0136022 | Ga0496113_0136022_1109_1486 | 125 |
| 255 | 3300048917 | Ga0496114_0000003 | Ga0496114_0000003_384864_385241 | 125 |
| 256 | 3300048917 | Ga0496114_0264178 | Ga0496114_0264178_244_621 | 125 |
| 257 | 3300048918 | Ga0496115_0000022 | Ga0496115_0000022_81526_81903 | 125 |
| 258 | 3300048918 | Ga0496115_0000027 | Ga0496115_0000027_111151_111528 | 125 |
| 259 | 3300048922 | Ga0496119_0365374 | Ga0496119_0365374_49_426 | 125 |
| 260 | 3300049578 | Ga0501042_0092181 | Ga0501042_0092181_1247_1624 | 125 |
| 261 | 3300049744 | Ga0501083_0820985 | Ga0501083_0820985_184_561 | 125 |
| 262 | 3300050492 | nmdc:mga0yw44_379428_c1 | nmdc:mga0yw44_379428_c1_59_436 | 125 |
| 263 | 3300050509 | nmdc:mga0qj67_444336_c1 | nmdc:mga0qj67_444336_c1_120_497 | 125 |
| 264 | 3300050513 | nmdc:mga0rr50_622054_c1 | nmdc:mga0rr50_622054_c1_177_554 | 125 |
| 265 | 3300053077 | Ga0495601_0154284 | Ga0495601_0154284_370_747 | 125 |
| 266 | 3300053083 | Ga0495655_0000010 | Ga0495655_0000010_24995_25372 | 125 |
| 267 | 3300053083 | Ga0495655_0002765 | Ga0495655_0002765_2391_2768 | 125 |
| 268 | 3300053084 | Ga0495595_0000007 | Ga0495595_0000007_215824_216201 | 125 |
| 269 | 3300053084 | Ga0495595_0019454 | Ga0495595_0019454_1092_1469 | 125 |
| 270 | 3300053085 | Ga0495619_0000747 | Ga0495619_0000747_19690_20067 | 125 |
| 271 | 3300053085 | Ga0495619_0001241 | Ga0495619_0001241_4026_4403 | 125 |
| 272 | 3300053094 | Ga0500566_0009429 | Ga0500566_0009429_4755_5132 | 125 |
| 273 | 3300053096 | Ga0500641_0001760 | Ga0500641_0001760_2182_2559 | 125 |
| 274 | 3300053129 | Ga0500628_000039 | Ga0500628_000039_19483_19860 | 125 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8oyy-assembly2.cif.gz_B | de novo designed soluble gpcr-like fold glf_32 | 0.5979 | 1 | 86 |
| 1oed-assembly1.cif.gz_E | structure of acetylcholine receptor pore from electron images | 0.4999 | 2 | 97 |
| 4jrz-assembly1.cif.gz_A | human ltc4 synthase in complex with product analogs - implications for enzyme catalysis | 0.4856 | 4 | 118 |
| 6v4l-assembly1.cif.gz_A | structure of trkh-trka in complex with atpgammas | 0.4791 | 4 | 113 |
| 7njl-assembly1.cif.gz_R | mycobacterium smegmatis atp synthase state 1b | 0.4755 | 3 | 79 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5T9Z0_97_218_1.20.58.390 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain | 0.6809 | 41 | 119 | 1.20.58.390 |
| af_Q4CM10_1_131_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.604 | 23 | 122 | 1.20.140.150 |
| af_Q6Z250_27_140_1.20.930.20 | Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain | 0.555 | 4 | 116 | 1.20.930.20 |
| af_A0A0N7KMI5_9_203_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.5498 | 1 | 118 | 1.20.1070.10 |
| af_Q8MZ67_1_133_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.5459 | 2 | 124 | 1.20.140.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X5DQ22-F1-model_v4 | Putative membrane protein | 0.9297 | 4 | 121 |
GO:0016020
|
| AF-A0A124E5P1-F1-model_v4 | deleted | 0.9281 | 4 | 122 |
|
| AF-A0A1M9G936-F1-model_v4 | deleted | 0.9228 | 1 | 121 |
|
| AF-H6N3Q9-F1-model_v4 | Uncharacterized protein | 0.9183 | 4 | 121 |
|
| AF-D3FB85-F1-model_v4 | Uncharacterized protein | 0.915 | 4 | 124 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar