F379368
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 273 | 189 | 273 | 187 |
Family's Representative Sequence
| Representative Sequence | 3300059426|Ga0590077_014595|Ga0590077_014595_127_789 |
| Length | 220 |
| Sequence | MPRPGGSLDSAATPIGRLLPPTGDQTQAERGAMIGPRFPELLAAAQGGDEQAFAVLWRDLQPALLRYFQVAANEVAEDLAADTWVSVIRRLGRFRGGEPAFRAWVFTVARHRVIDWHRQAARRPITLVPAEQLAERRAPDDPAVEVLEVQSTRAALALLAELPADQAEVVALRVLGGLEVAEVARIVGKRPGTVRVLAHRGLRRLAKQLEAAGLAGGVTR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 44 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 45 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 50 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 51 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 52 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 55 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 71 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 108 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 110 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 111 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 112 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 113 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 114 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 115 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 116 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 117 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 118 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 119 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 120 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 121 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 122 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 124 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 125 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 126 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 127 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 128 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 129 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 130 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 131 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 132 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 133 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 134 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 135 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 136 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 137 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 138 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 147 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 148 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 149 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 150 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 153 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 154 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 155 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 156 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 157 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 158 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 180 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 187 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 188 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.73 |
| Nodule | 0 |
| Rhizoplane | 5.13 |
| Rhizosphere | 93.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10060260 | 3300003203 | Bacteria | 1229 |
| 2 | JGI25407J50210_10007212 | 3300003373 | Bacteria | 2784 |
| 3 | Ga0070676_10107949 | 3300005328 | Bacteria | 1729 |
| 4 | Ga0070670_100146463 | 3300005331 | Bacteria | 2043 |
| 5 | Ga0068869_100002084 | 3300005334 | Bacteria | 12019 |
| 6 | Ga0070666_10127897 | 3300005335 | Bacteria | 1764 |
| 7 | Ga0070680_100616659 | 3300005336 | Bacteria | 931 |
| 8 | Ga0070682_100052108 | 3300005337 | Bacteria | 2560 |
| 9 | Ga0068868_100016592 | 3300005338 | Bacteria | 5474 |
| 10 | Ga0070689_100092404 | 3300005340 | Bacteria | 2387 |
| 11 | Ga0070691_10024993 | 3300005341 | Bacteria | 2779 |
| 12 | Ga0070687_100300873 | 3300005343 | Bacteria | 1018 |
| 13 | Ga0070661_100278732 | 3300005344 | Bacteria | 1296 |
| 14 | Ga0070671_100152031 | 3300005355 | Bacteria | 1955 |
| 15 | Ga0070673_100083258 | 3300005364 | Bacteria | 2599 |
| 16 | Ga0070713_100619447 | 3300005436 | Bacteria | 1029 |
| 17 | Ga0070705_100042980 | 3300005440 | Bacteria | 2587 |
| 18 | Ga0070708_100079807 | 3300005445 | Unclassified | 2961 |
| 19 | Ga0070708_100121759 | 3300005445 | Bacteria | 2407 |
| 20 | Ga0070663_100069282 | 3300005455 | Bacteria | 2562 |
| 21 | Ga0070681_10127180 | 3300005458 | Bacteria | 2481 |
| 22 | Ga0070681_10220598 | 3300005458 | Bacteria | 1811 |
| 23 | Ga0068867_100438321 | 3300005459 | Bacteria | 1110 |
| 24 | Ga0070685_10042660 | 3300005466 | Bacteria | 2589 |
| 25 | Ga0070706_100184811 | 3300005467 | Bacteria | 1947 |
| 26 | Ga0070706_100644830 | 3300005467 | Bacteria | 983 |
| 27 | Ga0070707_100218552 | 3300005468 | Bacteria | 1856 |
| 28 | Ga0070707_101031100 | 3300005468 | Bacteria | 788 |
| 29 | Ga0070698_100001656 | 3300005471 | Bacteria | 24850 |
| 30 | Ga0070698_100014318 | 3300005471 | Bacteria | 8382 |
| 31 | Ga0070698_100016597 | 3300005471 | Bacteria | 7771 |
| 32 | Ga0070698_100074521 | 3300005471 | Bacteria | 3399 |
| 33 | Ga0070699_100003199 | 3300005518 | Bacteria | 14485 |
| 34 | Ga0070699_100058059 | 3300005518 | Bacteria | 3352 |
| 35 | Ga0070699_100451947 | 3300005518 | Bacteria | 1165 |
| 36 | Ga0070699_100722605 | 3300005518 | Unclassified | 910 |
| 37 | Ga0070679_100255623 | 3300005530 | Bacteria | 1707 |
| 38 | Ga0070697_100168697 | 3300005536 | Bacteria | 1852 |
| 39 | Ga0070697_100214690 | 3300005536 | Bacteria | 1639 |
| 40 | Ga0068853_100120301 | 3300005539 | Bacteria | 2341 |
| 41 | Ga0070672_100109448 | 3300005543 | Bacteria | 2250 |
| 42 | Ga0070693_100004012 | 3300005547 | Bacteria | 6921 |
| 43 | Ga0070704_100356456 | 3300005549 | Bacteria | 1236 |
| 44 | Ga0070704_100458301 | 3300005549 | Bacteria | 1099 |
| 45 | Ga0068855_100070092 | 3300005563 | Bacteria | 4079 |
| 46 | Ga0068855_100948560 | 3300005563 | Unclassified | 906 |
| 47 | Ga0068854_100103273 | 3300005578 | Bacteria | 2140 |
| 48 | Ga0070702_100001166 | 3300005615 | Bacteria | 10572 |
| 49 | Ga0068852_100162335 | 3300005616 | Bacteria | 2087 |
| 50 | Ga0068859_100032834 | 3300005617 | Bacteria | 5214 |
| 51 | Ga0068851_10092629 | 3300005834 | Bacteria | 1593 |
| 52 | Ga0068870_10001631 | 3300005840 | Bacteria | 9151 |
| 53 | Ga0068863_100016586 | 3300005841 | Bacteria | 7068 |
| 54 | Ga0068858_100020398 | 3300005842 | Bacteria | 6198 |
| 55 | Ga0081538_10000487 | 3300005981 | Bacteria | 44314 |
| 56 | Ga0081538_10001113 | 3300005981 | Bacteria | 28482 |
| 57 | Ga0081538_10004477 | 3300005981 | Bacteria | 12868 |
| 58 | Ga0081539_10005408 | 3300005985 | Bacteria | 13066 |
| 59 | Ga0081539_10007081 | 3300005985 | Bacteria | 10372 |
| 60 | Ga0075365_10023105 | 3300006038 | Bacteria | 3906 |
| 61 | Ga0070715_10488312 | 3300006163 | Bacteria | 703 |
| 62 | Ga0070716_100719580 | 3300006173 | Unclassified | 764 |
| 63 | Ga0070712_100031379 | 3300006175 | Bacteria | 3579 |
| 64 | Ga0097621_100021098 | 3300006237 | Bacteria | 5031 |
| 65 | Ga0075428_100122918 | 3300006844 | Bacteria | 2825 |
| 66 | Ga0075434_100014328 | 3300006871 | Bacteria | 7578 |
| 67 | Ga0075429_100432669 | 3300006880 | Bacteria | 1153 |
| 68 | Ga0075436_100151929 | 3300006914 | Bacteria | 1630 |
| 69 | Ga0097620_100032834 | 3300006931 | Bacteria | 5214 |
| 70 | Ga0075435_100141264 | 3300007076 | Bacteria | 2020 |
| 71 | Ga0105244_10418135 | 3300009036 | Bacteria | 616 |
| 72 | Ga0105240_10508207 | 3300009093 | Bacteria | 1339 |
| 73 | Ga0111539_10097718 | 3300009094 | Bacteria | 3450 |
| 74 | Ga0105245_10055913 | 3300009098 | Bacteria | 3546 |
| 75 | Ga0105247_10022272 | 3300009101 | Bacteria | 3815 |
| 76 | Ga0114129_10613243 | 3300009147 | Bacteria | 1408 |
| 77 | Ga0114129_10781454 | 3300009147 | Bacteria | 1220 |
| 78 | Ga0105241_10042926 | 3300009174 | Bacteria | 3424 |
| 79 | Ga0105248_10020756 | 3300009177 | Bacteria | 7278 |
| 80 | Ga0105238_10034619 | 3300009551 | Bacteria | 5138 |
| 81 | Ga0105239_10675928 | 3300010375 | Bacteria | 1180 |
| 82 | Ga0105246_10002247 | 3300011119 | Bacteria | 11647 |
| 83 | Ga0157371_10061939 | 3300013102 | Bacteria | 2653 |
| 84 | Ga0157370_10063780 | 3300013104 | Bacteria | 3490 |
| 85 | Ga0157374_10061657 | 3300013296 | Bacteria | 3513 |
| 86 | Ga0157380_10342774 | 3300014326 | Bacteria | 1395 |
| 87 | Ga0182008_10075568 | 3300014497 | Bacteria | 1657 |
| 88 | Ga0157377_10035092 | 3300014745 | Bacteria | 2749 |
| 89 | Ga0157379_10126788 | 3300014968 | Bacteria | 2297 |
| 90 | Ga0207656_10090420 | 3300025321 | Bacteria | 1389 |
| 91 | Ga0207692_10279631 | 3300025898 | Unclassified | 1009 |
| 92 | Ga0207688_10006353 | 3300025901 | Bacteria | 6434 |
| 93 | Ga0207645_10105414 | 3300025907 | Bacteria | 1821 |
| 94 | Ga0207643_10000070 | 3300025908 | Bacteria | 68946 |
| 95 | Ga0207705_10137059 | 3300025909 | Bacteria | 1825 |
| 96 | Ga0207654_10007104 | 3300025911 | Bacteria | 5642 |
| 97 | Ga0207707_10159450 | 3300025912 | Bacteria | 1973 |
| 98 | Ga0207695_10292502 | 3300025913 | Bacteria | 1521 |
| 99 | Ga0207693_10151267 | 3300025915 | Unclassified | 1825 |
| 100 | Ga0207657_10016748 | 3300025919 | Bacteria | 7058 |
| 101 | Ga0207649_10041426 | 3300025920 | Bacteria | 2803 |
| 102 | Ga0207652_10068739 | 3300025921 | Bacteria | 3074 |
| 103 | Ga0207681_10309955 | 3300025923 | Bacteria | 1252 |
| 104 | Ga0207659_10335969 | 3300025926 | Bacteria | 1250 |
| 105 | Ga0207687_10021695 | 3300025927 | Bacteria | 4268 |
| 106 | Ga0207644_10066802 | 3300025931 | Bacteria | 2619 |
| 107 | Ga0207670_10100656 | 3300025936 | Bacteria | 2063 |
| 108 | Ga0207691_10273925 | 3300025940 | Bacteria | 1453 |
| 109 | Ga0207711_10194668 | 3300025941 | Bacteria | 1848 |
| 110 | Ga0207689_10000256 | 3300025942 | Bacteria | 47650 |
| 111 | Ga0207661_10036448 | 3300025944 | Bacteria | 3839 |
| 112 | Ga0207679_10082362 | 3300025945 | Bacteria | 2463 |
| 113 | Ga0207667_11094176 | 3300025949 | Unclassified | 780 |
| 114 | Ga0207640_10145954 | 3300025981 | Bacteria | 1731 |
| 115 | Ga0207703_10585708 | 3300026035 | Bacteria | 1054 |
| 116 | Ga0207678_10001449 | 3300026067 | Bacteria | 21802 |
| 117 | Ga0207702_10002759 | 3300026078 | Bacteria | 16441 |
| 118 | Ga0207641_10009110 | 3300026088 | Bacteria | 8199 |
| 119 | Ga0207648_10412529 | 3300026089 | Bacteria | 1225 |
| 120 | Ga0207676_10002056 | 3300026095 | Bacteria | 14601 |
| 121 | Ga0207674_10135100 | 3300026116 | Bacteria | 2428 |
| 122 | Ga0207675_100860502 | 3300026118 | Bacteria | 922 |
| 123 | Ga0207683_10007051 | 3300026121 | Bacteria | 9635 |
| 124 | Ga0207428_10025863 | 3300027907 | Bacteria | 4906 |
| 125 | Ga0268266_10039318 | 3300028379 | Bacteria | 4029 |
| 126 | Ga0265327_10060775 | 3300031251 | Unclassified | 1930 |
| 127 | Ga0307408_100141467 | 3300031548 | Bacteria | 1889 |
| 128 | Ga0307405_10022305 | 3300031731 | Plasmid | 3577 |
| 129 | Ga0307405_10027384 | 3300031731 | Bacteria | 3304 |
| 130 | Ga0307405_10038094 | 3300031731 | Plasmid | 2895 |
| 131 | Ga0307405_10048108 | 3300031731 | Unclassified | 2629 |
| 132 | Ga0307405_10057477 | 3300031731 | Unclassified | 2444 |
| 133 | Ga0307413_10011932 | 3300031824 | Unclassified | 4299 |
| 134 | Ga0307413_10027356 | 3300031824 | Bacteria | 3159 |
| 135 | Ga0307413_10096240 | 3300031824 | Unclassified | 1943 |
| 136 | Ga0307410_10028347 | 3300031852 | Unclassified | 3550 |
| 137 | Ga0307410_10303558 | 3300031852 | Unclassified | 1260 |
| 138 | Ga0307406_10084517 | 3300031901 | Unclassified | 2119 |
| 139 | Ga0307406_10146567 | 3300031901 | Unclassified | 1678 |
| 140 | Ga0307406_11321715 | 3300031901 | Bacteria | 630 |
| 141 | Ga0307407_10021112 | 3300031903 | Bacteria | 3351 |
| 142 | Ga0307407_10046537 | 3300031903 | Unclassified | 2457 |
| 143 | Ga0307407_10056697 | 3300031903 | Bacteria | 2270 |
| 144 | Ga0307407_10098597 | 3300031903 | Unclassified | 1808 |
| 145 | Ga0307407_10291566 | 3300031903 | Unclassified | 1134 |
| 146 | Ga0307412_10329271 | 3300031911 | Unclassified | 1218 |
| 147 | Ga0307409_100007795 | 3300031995 | Bacteria | 6441 |
| 148 | Ga0307409_100011799 | 3300031995 | Bacteria | 5532 |
| 149 | Ga0307409_100025455 | 3300031995 | Bacteria | 4151 |
| 150 | Ga0307409_100059882 | 3300031995 | Bacteria | 2966 |
| 151 | Ga0307409_100098088 | 3300031995 | Bacteria | 2422 |
| 152 | Ga0307409_100373184 | 3300031995 | Unclassified | 1353 |
| 153 | Ga0307409_101138631 | 3300031995 | Bacteria | 802 |
| 154 | Ga0307416_100004161 | 3300032002 | Bacteria | 8670 |
| 155 | Ga0307416_100008590 | 3300032002 | Bacteria | 6604 |
| 156 | Ga0307416_100018273 | 3300032002 | Bacteria | 4934 |
| 157 | Ga0307416_100025542 | 3300032002 | Bacteria | 4332 |
| 158 | Ga0307416_100046508 | 3300032002 | Bacteria | 3425 |
| 159 | Ga0307416_100058816 | 3300032002 | Unclassified | 3119 |
| 160 | Ga0307416_100060809 | 3300032002 | Unclassified | 3078 |
| 161 | Ga0307416_100132642 | 3300032002 | Unclassified | 2246 |
| 162 | Ga0307416_100488795 | 3300032002 | Unclassified | 1292 |
| 163 | Ga0307416_101347924 | 3300032002 | Unclassified | 819 |
| 164 | Ga0307414_10045182 | 3300032004 | Bacteria | 3015 |
| 165 | Ga0307414_10340454 | 3300032004 | Bacteria | 1284 |
| 166 | Ga0307414_10363037 | 3300032004 | Bacteria | 1247 |
| 167 | Ga0307414_11099490 | 3300032004 | Bacteria | 734 |
| 168 | Ga0307411_10060218 | 3300032005 | Unclassified | 2520 |
| 169 | Ga0307411_10066440 | 3300032005 | Bacteria | 2423 |
| 170 | Ga0307411_11360902 | 3300032005 | Bacteria | 648 |
| 171 | Ga0307415_100000790 | 3300032126 | Bacteria | 14365 |
| 172 | Ga0307415_100003127 | 3300032126 | Bacteria | 8383 |
| 173 | Ga0307415_100003306 | 3300032126 | Bacteria | 8181 |
| 174 | Ga0307415_100007732 | 3300032126 | Bacteria | 5904 |
| 175 | Ga0307415_100014821 | 3300032126 | Bacteria | 4597 |
| 176 | Ga0307415_100021313 | 3300032126 | Unclassified | 3980 |
| 177 | Ga0307415_100023425 | 3300032126 | Bacteria | 3831 |
| 178 | Ga0307415_100039233 | 3300032126 | Bacteria | 3128 |
| 179 | Ga0307415_100442985 | 3300032126 | Unclassified | 1121 |
| 180 | Ga0307415_100482524 | 3300032126 | Bacteria | 1079 |
| 181 | Ga0373925_0593695 | 3300037068 | Bacteria | 912 |
| 182 | Ga0395899_0002229 | 3300037312 | Bacteria | 15878 |
| 183 | Ga0395899_0364354 | 3300037312 | Unclassified | 964 |
| 184 | Ga0395900_0005158 | 3300037418 | Bacteria | 13719 |
| 185 | Ga0395900_0022936 | 3300037418 | Bacteria | 6387 |
| 186 | Ga0395900_0035735 | 3300037418 | Bacteria | 5119 |
| 187 | Ga0395898_0023339 | 3300037466 | Bacteria | 6252 |
| 188 | Ga0395898_0070312 | 3300037466 | Bacteria | 3384 |
| 189 | Ga0395898_0340552 | 3300037466 | Bacteria | 1430 |
| 190 | Ga0395905_0000949 | 3300037471 | Bacteria | 37219 |
| 191 | Ga0395905_0041490 | 3300037471 | Bacteria | 4318 |
| 192 | Ga0395905_0334056 | 3300037471 | Bacteria | 1406 |
| 193 | Ga0436364_0555836 | 3300037853 | Bacteria | 2041 |
| 194 | Ga0395901_0001416 | 3300038443 | Bacteria | 25049 |
| 195 | Ga0395901_0211990 | 3300038443 | Bacteria | 2027 |
| 196 | Ga0395901_0260082 | 3300038443 | Bacteria | 1807 |
| 197 | Ga0439450_018952 | 3300042008 | Bacteria | 1452 |
| 198 | Ga0439455_0019803 | 3300042012 | Unclassified | 1590 |
| 199 | Ga0439463_008137 | 3300042016 | Bacteria | 2586 |
| 200 | Ga0439463_013242 | 3300042016 | Bacteria | 2030 |
| 201 | Ga0450905_015616 | 3300042142 | Bacteria | 1089 |
| 202 | Ga0439464_0040809 | 3300042439 | Bacteria | 1323 |
| 203 | Ga0439460_0010715 | 3300042461 | Bacteria | 2354 |
| 204 | Ga0439460_0024300 | 3300042461 | Bacteria | 1677 |
| 205 | Ga0439440_0005578 | 3300042993 | Bacteria | 2502 |
| 206 | Ga0466961_0128163 | 3300044693 | Bacteria | 1591 |
| 207 | Ga0466967_0285032 | 3300045976 | Bacteria | 1586 |
| 208 | Ga0495662_0181241 | 3300046476 | Bacteria | 1038 |
| 209 | Ga0495584_0043795 | 3300046491 | Bacteria | 2259 |
| 210 | Ga0495663_0035454 | 3300046525 | Bacteria | 1498 |
| 211 | Ga0495621_0043854 | 3300046539 | Bacteria | 1579 |
| 212 | Ga0495656_0303600 | 3300046615 | Bacteria | 818 |
| 213 | Ga0495615_0048886 | 3300048090 | Bacteria | 1083 |
| 214 | Ga0496100_0542457 | 3300048903 | Bacteria | 899 |
| 215 | Ga0496101_0178213 | 3300048904 | Bacteria | 1636 |
| 216 | Ga0496102_0360208 | 3300048905 | Bacteria | 1369 |
| 217 | Ga0496102_0629190 | 3300048905 | Unclassified | 996 |
| 218 | Ga0496104_0018843 | 3300048907 | Bacteria | 6304 |
| 219 | Ga0496105_0017991 | 3300048908 | Bacteria | 5671 |
| 220 | Ga0496106_0006614 | 3300048909 | Bacteria | 8577 |
| 221 | Ga0496108_0402329 | 3300048911 | Bacteria | 1196 |
| 222 | Ga0496109_0099613 | 3300048912 | Bacteria | 2695 |
| 223 | Ga0496110_0055579 | 3300048913 | Bacteria | 3483 |
| 224 | Ga0496111_0053633 | 3300048914 | Bacteria | 2913 |
| 225 | Ga0496112_0346860 | 3300048915 | Bacteria | 1427 |
| 226 | Ga0496113_0037956 | 3300048916 | Bacteria | 3538 |
| 227 | Ga0496115_0412262 | 3300048918 | Bacteria | 1095 |
| 228 | Ga0496119_0041143 | 3300048922 | Plasmid | 2947 |
| 229 | Ga0501031_0245801 | 3300049568 | Bacteria | 1163 |
| 230 | Ga0501032_0003267 | 3300049569 | Bacteria | 12478 |
| 231 | Ga0501036_0068006 | 3300049572 | Bacteria | 3014 |
| 232 | Ga0501038_0028278 | 3300049574 | Bacteria | 4981 |
| 233 | Ga0501040_0029377 | 3300049576 | Bacteria | 3710 |
| 234 | Ga0501041_0468109 | 3300049577 | Unclassified | 801 |
| 235 | Ga0501041_0525300 | 3300049577 | Bacteria | 754 |
| 236 | Ga0501042_0000110 | 3300049578 | Bacteria | 34194 |
| 237 | Ga0501043_0014804 | 3300049579 | Bacteria | 6107 |
| 238 | Ga0501043_0422598 | 3300049579 | Bacteria | 1005 |
| 239 | Ga0501048_0054600 | 3300049582 | Bacteria | 2838 |
| 240 | Ga0501068_0078201 | 3300049584 | Bacteria | 2027 |
| 241 | Ga0501070_0003962 | 3300049586 | Bacteria | 12745 |
| 242 | Ga0501070_0023327 | 3300049586 | Bacteria | 5183 |
| 243 | Ga0501070_0079384 | 3300049586 | Bacteria | 2715 |
| 244 | Ga0501070_0101130 | 3300049586 | Bacteria | 2384 |
| 245 | Ga0501071_0904300 | 3300049587 | Unclassified | 681 |
| 246 | Ga0501073_0104766 | 3300049589 | Bacteria | 1963 |
| 247 | Ga0501073_0247611 | 3300049589 | Unclassified | 1230 |
| 248 | Ga0501074_0009525 | 3300049590 | Bacteria | 7055 |
| 249 | Ga0501074_0010199 | 3300049590 | Bacteria | 6819 |
| 250 | Ga0501075_0113179 | 3300049591 | Bacteria | 2063 |
| 251 | Ga0501079_0000038 | 3300049741 | Bacteria | 56523 |
| 252 | Ga0501080_0000094 | 3300049742 | Bacteria | 60247 |
| 253 | Ga0501080_0007112 | 3300049742 | Bacteria | 10103 |
| 254 | Ga0501080_0048014 | 3300049742 | Bacteria | 3975 |
| 255 | Ga0501080_0050247 | 3300049742 | Bacteria | 3882 |
| 256 | Ga0501081_0046449 | 3300049743 | Bacteria | 2985 |
| 257 | Ga0501081_0403645 | 3300049743 | Bacteria | 1012 |
| 258 | Ga0501035_0782012 | 3300049822 | Bacteria | 764 |
| 259 | Ga0501044_0000201 | 3300049823 | Bacteria | 75685 |
| 260 | Ga0501045_0527498 | 3300049824 | Bacteria | 876 |
| 261 | nmdc:mga0yw44_19408_c1 | 3300050492 | Bacteria | 3749 |
| 262 | nmdc:mga05p37_164617_c1 | 3300050507 | Bacteria | 2707 |
| 263 | nmdc:mga05p37_192160_c1 | 3300050507 | Bacteria | 2477 |
| 264 | nmdc:mga0rr50_225284_c1 | 3300050513 | Bacteria | 1550 |
| 265 | nmdc:mga08x19_72357_c1 | 3300050514 | Bacteria | 2249 |
| 266 | nmdc:mga0a205_15431_c2 | 3300050515 | Bacteria | 1721 |
| 267 | Ga0495601_0205975 | 3300053077 | Unclassified | 1285 |
| 268 | Ga0501084_0005026 | 3300054114 | Bacteria | 10818 |
| 269 | Ga0501084_0383833 | 3300054114 | Bacteria | 1187 |
| 270 | Ga0590075_000813 | 3300059424 | Bacteria | 8191 |
| 271 | Ga0590077_014595 | 3300059426 | Unclassified | 1637 |
| 272 | Ga0501082_0048190 | 3300060353 | Bacteria | 3672 |
| 273 | Ga0530510_0390748 | 3300061734 | Unclassified | 1048 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045976 | Ga0466967_0285032 | Ga0466967_0285032_313_912 | 166 |
| 2 | 3300049577 | Ga0501041_0468109 | Ga0501041_0468109_99_656 | 166 |
| 3 | 3300061734 | Ga0530510_0390748 | Ga0530510_0390748_32_589 | 166 |
| 4 | 3300049743 | Ga0501081_0403645 | Ga0501081_0403645_228_785 | 167 |
| 5 | 3300059424 | Ga0590075_000813 | Ga0590075_000813_6412_6978 | 172 |
| 6 | 3300005445 | Ga0070708_100079807 | Ga0070708_1000798073 | 174 |
| 7 | 3300005445 | Ga0070708_100121759 | Ga0070708_1001217591 | 174 |
| 8 | 3300005467 | Ga0070706_100184811 | Ga0070706_1001848114 | 174 |
| 9 | 3300005468 | Ga0070707_100218552 | Ga0070707_1002185522 | 174 |
| 10 | 3300005468 | Ga0070707_101031100 | Ga0070707_1010311001 | 176 |
| 11 | 3300049568 | Ga0501031_0245801 | Ga0501031_0245801_240_824 | 178 |
| 12 | 3300049572 | Ga0501036_0068006 | Ga0501036_0068006_384_968 | 178 |
| 13 | 3300049574 | Ga0501038_0028278 | Ga0501038_0028278_2419_3003 | 178 |
| 14 | 3300049576 | Ga0501040_0029377 | Ga0501040_0029377_280_864 | 178 |
| 15 | 3300049578 | Ga0501042_0000110 | Ga0501042_0000110_6292_6876 | 178 |
| 16 | 3300049582 | Ga0501048_0054600 | Ga0501048_0054600_252_836 | 178 |
| 17 | 3300049584 | Ga0501068_0078201 | Ga0501068_0078201_984_1568 | 178 |
| 18 | 3300049590 | Ga0501074_0010199 | Ga0501074_0010199_4850_5434 | 178 |
| 19 | 3300049591 | Ga0501075_0113179 | Ga0501075_0113179_147_731 | 178 |
| 20 | 3300049743 | Ga0501081_0046449 | Ga0501081_0046449_766_1350 | 178 |
| 21 | 3300049822 | Ga0501035_0782012 | Ga0501035_0782012_64_648 | 178 |
| 22 | 3300049824 | Ga0501045_0527498 | Ga0501045_0527498_280_864 | 178 |
| 23 | 3300054114 | Ga0501084_0005026 | Ga0501084_0005026_6876_7460 | 178 |
| 24 | 3300060353 | Ga0501082_0048190 | Ga0501082_0048190_1778_2362 | 178 |
| 25 | 3300006038 | Ga0075365_10023105 | Ga0075365_100231054 | 179 |
| 26 | 3300046491 | Ga0495584_0043795 | Ga0495584_0043795_864_1418 | 179 |
| 27 | 3300046525 | Ga0495663_0035454 | Ga0495663_0035454_417_971 | 179 |
| 28 | 3300046539 | Ga0495621_0043854 | Ga0495621_0043854_224_778 | 179 |
| 29 | 3300046615 | Ga0495656_0303600 | Ga0495656_0303600_253_807 | 179 |
| 30 | 3300048090 | Ga0495615_0048886 | Ga0495615_0048886_273_827 | 179 |
| 31 | 3300049579 | Ga0501043_0422598 | Ga0501043_0422598_142_717 | 179 |
| 32 | 3300049586 | Ga0501070_0003962 | Ga0501070_0003962_6397_6972 | 179 |
| 33 | 3300049589 | Ga0501073_0247611 | Ga0501073_0247611_190_765 | 179 |
| 34 | 3300049590 | Ga0501074_0009525 | Ga0501074_0009525_3824_4399 | 179 |
| 35 | 3300049741 | Ga0501079_0000038 | Ga0501079_0000038_20422_20997 | 179 |
| 36 | 3300049742 | Ga0501080_0007112 | Ga0501080_0007112_74_649 | 179 |
| 37 | 3300050492 | nmdc:mga0yw44_19408_c1 | nmdc:mga0yw44_19408_c1_1856_2401 | 179 |
| 38 | 3300005471 | Ga0070698_100001656 | Ga0070698_10000165619 | 180 |
| 39 | 3300005471 | Ga0070698_100014318 | Ga0070698_1000143184 | 180 |
| 40 | 3300005518 | Ga0070699_100058059 | Ga0070699_1000580593 | 180 |
| 41 | 3300005518 | Ga0070699_100451947 | Ga0070699_1004519471 | 180 |
| 42 | 3300005518 | Ga0070699_100722605 | Ga0070699_1007226052 | 180 |
| 43 | 3300005536 | Ga0070697_100214690 | Ga0070697_1002146902 | 180 |
| 44 | 3300005549 | Ga0070704_100356456 | Ga0070704_1003564562 | 180 |
| 45 | 3300037312 | Ga0395899_0002229 | Ga0395899_0002229_14156_14716 | 180 |
| 46 | 3300037418 | Ga0395900_0005158 | Ga0395900_0005158_1294_1854 | 180 |
| 47 | 3300037418 | Ga0395900_0035735 | Ga0395900_0035735_873_1430 | 180 |
| 48 | 3300037466 | Ga0395898_0070312 | Ga0395898_0070312_974_1534 | 180 |
| 49 | 3300037466 | Ga0395898_0340552 | Ga0395898_0340552_243_800 | 180 |
| 50 | 3300037471 | Ga0395905_0000949 | Ga0395905_0000949_13965_14525 | 180 |
| 51 | 3300037471 | Ga0395905_0041490 | Ga0395905_0041490_2689_3246 | 180 |
| 52 | 3300038443 | Ga0395901_0001416 | Ga0395901_0001416_20692_21249 | 180 |
| 53 | 3300049577 | Ga0501041_0525300 | Ga0501041_0525300_20_577 | 180 |
| 54 | 3300049587 | Ga0501071_0904300 | Ga0501071_0904300_58_615 | 180 |
| 55 | 3300054114 | Ga0501084_0383833 | Ga0501084_0383833_479_1036 | 180 |
| 56 | 3300005458 | Ga0070681_10127180 | Ga0070681_101271802 | 182 |
| 57 | 3300005471 | Ga0070698_100016597 | Ga0070698_1000165975 | 182 |
| 58 | 3300005518 | Ga0070699_100003199 | Ga0070699_1000031994 | 182 |
| 59 | 3300005536 | Ga0070697_100168697 | Ga0070697_1001686972 | 182 |
| 60 | 3300006163 | Ga0070715_10488312 | Ga0070715_104883121 | 182 |
| 61 | 3300006173 | Ga0070716_100719580 | Ga0070716_1007195801 | 182 |
| 62 | 3300006175 | Ga0070712_100031379 | Ga0070712_1000313795 | 182 |
| 63 | 3300025898 | Ga0207692_10279631 | Ga0207692_102796312 | 182 |
| 64 | 3300025912 | Ga0207707_10159450 | Ga0207707_101594502 | 182 |
| 65 | 3300025915 | Ga0207693_10151267 | Ga0207693_101512673 | 182 |
| 66 | 3300031903 | Ga0307407_10291566 | Ga0307407_102915662 | 182 |
| 67 | 3300032002 | Ga0307416_100488795 | Ga0307416_1004887952 | 182 |
| 68 | 3300032004 | Ga0307414_11099490 | Ga0307414_110994901 | 182 |
| 69 | 3300032126 | Ga0307415_100023425 | Ga0307415_1000234255 | 182 |
| 70 | 3300032126 | Ga0307415_100482524 | Ga0307415_1004825242 | 182 |
| 71 | 3300037068 | Ga0373925_0593695 | Ga0373925_0593695_316_867 | 182 |
| 72 | 3300037853 | Ga0436364_0555836 | Ga0436364_0555836_1241_1792 | 182 |
| 73 | 3300046476 | Ga0495662_0181241 | Ga0495662_0181241_384_935 | 182 |
| 74 | 3300003373 | JGI25407J50210_10007212 | JGI25407J50210_100072125 | 183 |
| 75 | 3300005328 | Ga0070676_10107949 | Ga0070676_101079492 | 183 |
| 76 | 3300005331 | Ga0070670_100146463 | Ga0070670_1001464632 | 183 |
| 77 | 3300005334 | Ga0068869_100002084 | Ga0068869_1000020847 | 183 |
| 78 | 3300005335 | Ga0070666_10127897 | Ga0070666_101278972 | 183 |
| 79 | 3300005336 | Ga0070680_100616659 | Ga0070680_1006166592 | 183 |
| 80 | 3300005337 | Ga0070682_100052108 | Ga0070682_1000521083 | 183 |
| 81 | 3300005338 | Ga0068868_100016592 | Ga0068868_1000165922 | 183 |
| 82 | 3300005340 | Ga0070689_100092404 | Ga0070689_1000924042 | 183 |
| 83 | 3300005341 | Ga0070691_10024993 | Ga0070691_100249932 | 183 |
| 84 | 3300005343 | Ga0070687_100300873 | Ga0070687_1003008731 | 183 |
| 85 | 3300005344 | Ga0070661_100278732 | Ga0070661_1002787322 | 183 |
| 86 | 3300005355 | Ga0070671_100152031 | Ga0070671_1001520312 | 183 |
| 87 | 3300005364 | Ga0070673_100083258 | Ga0070673_1000832582 | 183 |
| 88 | 3300005440 | Ga0070705_100042980 | Ga0070705_1000429803 | 183 |
| 89 | 3300005455 | Ga0070663_100069282 | Ga0070663_1000692823 | 183 |
| 90 | 3300005458 | Ga0070681_10220598 | Ga0070681_102205982 | 183 |
| 91 | 3300005459 | Ga0068867_100438321 | Ga0068867_1004383211 | 183 |
| 92 | 3300005466 | Ga0070685_10042660 | Ga0070685_100426603 | 183 |
| 93 | 3300005530 | Ga0070679_100255623 | Ga0070679_1002556232 | 183 |
| 94 | 3300005539 | Ga0068853_100120301 | Ga0068853_1001203012 | 183 |
| 95 | 3300005543 | Ga0070672_100109448 | Ga0070672_1001094481 | 183 |
| 96 | 3300005547 | Ga0070693_100004012 | Ga0070693_1000040122 | 183 |
| 97 | 3300005549 | Ga0070704_100458301 | Ga0070704_1004583012 | 183 |
| 98 | 3300005563 | Ga0068855_100070092 | Ga0068855_1000700923 | 183 |
| 99 | 3300005578 | Ga0068854_100103273 | Ga0068854_1001032732 | 183 |
| 100 | 3300005615 | Ga0070702_100001166 | Ga0070702_1000011666 | 183 |
| 101 | 3300005616 | Ga0068852_100162335 | Ga0068852_1001623352 | 183 |
| 102 | 3300005617 | Ga0068859_100032834 | Ga0068859_1000328343 | 183 |
| 103 | 3300005834 | Ga0068851_10092629 | Ga0068851_100926291 | 183 |
| 104 | 3300005840 | Ga0068870_10001631 | Ga0068870_1000163111 | 183 |
| 105 | 3300005841 | Ga0068863_100016586 | Ga0068863_1000165862 | 183 |
| 106 | 3300005842 | Ga0068858_100020398 | Ga0068858_1000203983 | 183 |
| 107 | 3300005981 | Ga0081538_10000487 | Ga0081538_100004876 | 183 |
| 108 | 3300005981 | Ga0081538_10001113 | Ga0081538_100011136 | 183 |
| 109 | 3300005981 | Ga0081538_10004477 | Ga0081538_100044775 | 183 |
| 110 | 3300005985 | Ga0081539_10007081 | Ga0081539_100070813 | 183 |
| 111 | 3300006237 | Ga0097621_100021098 | Ga0097621_1000210983 | 183 |
| 112 | 3300006844 | Ga0075428_100122918 | Ga0075428_1001229183 | 183 |
| 113 | 3300006871 | Ga0075434_100014328 | Ga0075434_1000143284 | 183 |
| 114 | 3300006880 | Ga0075429_100432669 | Ga0075429_1004326692 | 183 |
| 115 | 3300006914 | Ga0075436_100151929 | Ga0075436_1001519292 | 183 |
| 116 | 3300006931 | Ga0097620_100032834 | Ga0097620_1000328343 | 183 |
| 117 | 3300007076 | Ga0075435_100141264 | Ga0075435_1001412642 | 183 |
| 118 | 3300009036 | Ga0105244_10418135 | Ga0105244_104181351 | 183 |
| 119 | 3300009093 | Ga0105240_10508207 | Ga0105240_105082071 | 183 |
| 120 | 3300009094 | Ga0111539_10097718 | Ga0111539_100977183 | 183 |
| 121 | 3300009098 | Ga0105245_10055913 | Ga0105245_100559132 | 183 |
| 122 | 3300009101 | Ga0105247_10022272 | Ga0105247_100222721 | 183 |
| 123 | 3300009147 | Ga0114129_10613243 | Ga0114129_106132432 | 183 |
| 124 | 3300009174 | Ga0105241_10042926 | Ga0105241_100429263 | 183 |
| 125 | 3300009177 | Ga0105248_10020756 | Ga0105248_100207564 | 183 |
| 126 | 3300009551 | Ga0105238_10034619 | Ga0105238_100346193 | 183 |
| 127 | 3300010375 | Ga0105239_10675928 | Ga0105239_106759282 | 183 |
| 128 | 3300011119 | Ga0105246_10002247 | Ga0105246_100022474 | 183 |
| 129 | 3300013102 | Ga0157371_10061939 | Ga0157371_100619392 | 183 |
| 130 | 3300013104 | Ga0157370_10063780 | Ga0157370_100637803 | 183 |
| 131 | 3300013296 | Ga0157374_10061657 | Ga0157374_100616572 | 183 |
| 132 | 3300014326 | Ga0157380_10342774 | Ga0157380_103427742 | 183 |
| 133 | 3300014497 | Ga0182008_10075568 | Ga0182008_100755681 | 183 |
| 134 | 3300014745 | Ga0157377_10035092 | Ga0157377_100350923 | 183 |
| 135 | 3300014968 | Ga0157379_10126788 | Ga0157379_101267882 | 183 |
| 136 | 3300025321 | Ga0207656_10090420 | Ga0207656_100904202 | 183 |
| 137 | 3300025901 | Ga0207688_10006353 | Ga0207688_100063531 | 183 |
| 138 | 3300025907 | Ga0207645_10105414 | Ga0207645_101054142 | 183 |
| 139 | 3300025908 | Ga0207643_10000070 | Ga0207643_1000007044 | 183 |
| 140 | 3300025909 | Ga0207705_10137059 | Ga0207705_101370592 | 183 |
| 141 | 3300025911 | Ga0207654_10007104 | Ga0207654_100071043 | 183 |
| 142 | 3300025913 | Ga0207695_10292502 | Ga0207695_102925022 | 183 |
| 143 | 3300025919 | Ga0207657_10016748 | Ga0207657_100167484 | 183 |
| 144 | 3300025920 | Ga0207649_10041426 | Ga0207649_100414263 | 183 |
| 145 | 3300025921 | Ga0207652_10068739 | Ga0207652_100687392 | 183 |
| 146 | 3300025923 | Ga0207681_10309955 | Ga0207681_103099551 | 183 |
| 147 | 3300025926 | Ga0207659_10335969 | Ga0207659_103359692 | 183 |
| 148 | 3300025927 | Ga0207687_10021695 | Ga0207687_100216953 | 183 |
| 149 | 3300025931 | Ga0207644_10066802 | Ga0207644_100668022 | 183 |
| 150 | 3300025936 | Ga0207670_10100656 | Ga0207670_101006562 | 183 |
| 151 | 3300025940 | Ga0207691_10273925 | Ga0207691_102739252 | 183 |
| 152 | 3300025941 | Ga0207711_10194668 | Ga0207711_101946682 | 183 |
| 153 | 3300025942 | Ga0207689_10000256 | Ga0207689_100002563 | 183 |
| 154 | 3300025944 | Ga0207661_10036448 | Ga0207661_100364483 | 183 |
| 155 | 3300025945 | Ga0207679_10082362 | Ga0207679_100823622 | 183 |
| 156 | 3300025981 | Ga0207640_10145954 | Ga0207640_101459542 | 183 |
| 157 | 3300026035 | Ga0207703_10585708 | Ga0207703_105857082 | 183 |
| 158 | 3300026067 | Ga0207678_10001449 | Ga0207678_100014492 | 183 |
| 159 | 3300026078 | Ga0207702_10002759 | Ga0207702_100027592 | 183 |
| 160 | 3300026088 | Ga0207641_10009110 | Ga0207641_100091104 | 183 |
| 161 | 3300026089 | Ga0207648_10412529 | Ga0207648_104125291 | 183 |
| 162 | 3300026095 | Ga0207676_10002056 | Ga0207676_100020569 | 183 |
| 163 | 3300026116 | Ga0207674_10135100 | Ga0207674_101351002 | 183 |
| 164 | 3300026118 | Ga0207675_100860502 | Ga0207675_1008605022 | 183 |
| 165 | 3300026121 | Ga0207683_10007051 | Ga0207683_100070512 | 183 |
| 166 | 3300027907 | Ga0207428_10025863 | Ga0207428_100258632 | 183 |
| 167 | 3300028379 | Ga0268266_10039318 | Ga0268266_100393182 | 183 |
| 168 | 3300031548 | Ga0307408_100141467 | Ga0307408_1001414672 | 183 |
| 169 | 3300031731 | Ga0307405_10022305 | Ga0307405_100223052 | 183 |
| 170 | 3300031731 | Ga0307405_10027384 | Ga0307405_100273844 | 183 |
| 171 | 3300031731 | Ga0307405_10038094 | Ga0307405_100380943 | 183 |
| 172 | 3300031731 | Ga0307405_10048108 | Ga0307405_100481082 | 183 |
| 173 | 3300031731 | Ga0307405_10057477 | Ga0307405_100574773 | 183 |
| 174 | 3300031824 | Ga0307413_10011932 | Ga0307413_100119324 | 183 |
| 175 | 3300031824 | Ga0307413_10027356 | Ga0307413_100273565 | 183 |
| 176 | 3300031824 | Ga0307413_10096240 | Ga0307413_100962402 | 183 |
| 177 | 3300031852 | Ga0307410_10028347 | Ga0307410_100283473 | 183 |
| 178 | 3300031852 | Ga0307410_10303558 | Ga0307410_103035581 | 183 |
| 179 | 3300031901 | Ga0307406_10146567 | Ga0307406_101465672 | 183 |
| 180 | 3300031901 | Ga0307406_11321715 | Ga0307406_113217151 | 183 |
| 181 | 3300031903 | Ga0307407_10021112 | Ga0307407_100211121 | 183 |
| 182 | 3300031903 | Ga0307407_10046537 | Ga0307407_100465372 | 183 |
| 183 | 3300031903 | Ga0307407_10056697 | Ga0307407_100566971 | 183 |
| 184 | 3300031903 | Ga0307407_10098597 | Ga0307407_100985972 | 183 |
| 185 | 3300031911 | Ga0307412_10329271 | Ga0307412_103292712 | 183 |
| 186 | 3300031995 | Ga0307409_100007795 | Ga0307409_1000077954 | 183 |
| 187 | 3300031995 | Ga0307409_100011799 | Ga0307409_1000117994 | 183 |
| 188 | 3300031995 | Ga0307409_100025455 | Ga0307409_1000254553 | 183 |
| 189 | 3300031995 | Ga0307409_100059882 | Ga0307409_1000598822 | 183 |
| 190 | 3300031995 | Ga0307409_100098088 | Ga0307409_1000980882 | 183 |
| 191 | 3300031995 | Ga0307409_100373184 | Ga0307409_1003731842 | 183 |
| 192 | 3300031995 | Ga0307409_101138631 | Ga0307409_1011386311 | 183 |
| 193 | 3300032002 | Ga0307416_100004161 | Ga0307416_1000041619 | 183 |
| 194 | 3300032002 | Ga0307416_100008590 | Ga0307416_1000085902 | 183 |
| 195 | 3300032002 | Ga0307416_100018273 | Ga0307416_1000182736 | 183 |
| 196 | 3300032002 | Ga0307416_100025542 | Ga0307416_1000255422 | 183 |
| 197 | 3300032002 | Ga0307416_100046508 | Ga0307416_1000465082 | 183 |
| 198 | 3300032002 | Ga0307416_100058816 | Ga0307416_1000588162 | 183 |
| 199 | 3300032002 | Ga0307416_100060809 | Ga0307416_1000608093 | 183 |
| 200 | 3300032002 | Ga0307416_100132642 | Ga0307416_1001326423 | 183 |
| 201 | 3300032002 | Ga0307416_101347924 | Ga0307416_1013479242 | 183 |
| 202 | 3300032004 | Ga0307414_10045182 | Ga0307414_100451824 | 183 |
| 203 | 3300032004 | Ga0307414_10340454 | Ga0307414_103404542 | 183 |
| 204 | 3300032004 | Ga0307414_10363037 | Ga0307414_103630372 | 183 |
| 205 | 3300032005 | Ga0307411_10060218 | Ga0307411_100602183 | 183 |
| 206 | 3300032005 | Ga0307411_10066440 | Ga0307411_100664403 | 183 |
| 207 | 3300032005 | Ga0307411_11360902 | Ga0307411_113609021 | 183 |
| 208 | 3300032126 | Ga0307415_100000790 | Ga0307415_1000007905 | 183 |
| 209 | 3300032126 | Ga0307415_100003127 | Ga0307415_10000312711 | 183 |
| 210 | 3300032126 | Ga0307415_100003306 | Ga0307415_1000033065 | 183 |
| 211 | 3300032126 | Ga0307415_100007732 | Ga0307415_1000077324 | 183 |
| 212 | 3300032126 | Ga0307415_100014821 | Ga0307415_1000148215 | 183 |
| 213 | 3300032126 | Ga0307415_100021313 | Ga0307415_1000213134 | 183 |
| 214 | 3300032126 | Ga0307415_100039233 | Ga0307415_1000392333 | 183 |
| 215 | 3300032126 | Ga0307415_100442985 | Ga0307415_1004429852 | 183 |
| 216 | 3300037312 | Ga0395899_0364354 | Ga0395899_0364354_86_652 | 183 |
| 217 | 3300037418 | Ga0395900_0022936 | Ga0395900_0022936_1913_2479 | 183 |
| 218 | 3300037466 | Ga0395898_0023339 | Ga0395898_0023339_2382_2948 | 183 |
| 219 | 3300037471 | Ga0395905_0334056 | Ga0395905_0334056_203_769 | 183 |
| 220 | 3300042008 | Ga0439450_018952 | Ga0439450_018952_634_1200 | 183 |
| 221 | 3300042012 | Ga0439455_0019803 | Ga0439455_0019803_243_809 | 183 |
| 222 | 3300042016 | Ga0439463_008137 | Ga0439463_008137_716_1282 | 183 |
| 223 | 3300042016 | Ga0439463_013242 | Ga0439463_013242_1435_2001 | 183 |
| 224 | 3300042142 | Ga0450905_015616 | Ga0450905_015616_29_595 | 183 |
| 225 | 3300042439 | Ga0439464_0040809 | Ga0439464_0040809_742_1308 | 183 |
| 226 | 3300042461 | Ga0439460_0010715 | Ga0439460_0010715_669_1235 | 183 |
| 227 | 3300042461 | Ga0439460_0024300 | Ga0439460_0024300_743_1309 | 183 |
| 228 | 3300042993 | Ga0439440_0005578 | Ga0439440_0005578_1921_2487 | 183 |
| 229 | 3300048903 | Ga0496100_0542457 | Ga0496100_0542457_283_834 | 183 |
| 230 | 3300048904 | Ga0496101_0178213 | Ga0496101_0178213_198_749 | 183 |
| 231 | 3300048905 | Ga0496102_0360208 | Ga0496102_0360208_586_1137 | 183 |
| 232 | 3300048907 | Ga0496104_0018843 | Ga0496104_0018843_330_881 | 183 |
| 233 | 3300048908 | Ga0496105_0017991 | Ga0496105_0017991_1078_1629 | 183 |
| 234 | 3300048909 | Ga0496106_0006614 | Ga0496106_0006614_1028_1579 | 183 |
| 235 | 3300048912 | Ga0496109_0099613 | Ga0496109_0099613_1899_2450 | 183 |
| 236 | 3300048913 | Ga0496110_0055579 | Ga0496110_0055579_557_1108 | 183 |
| 237 | 3300048914 | Ga0496111_0053633 | Ga0496111_0053633_1910_2461 | 183 |
| 238 | 3300048915 | Ga0496112_0346860 | Ga0496112_0346860_441_992 | 183 |
| 239 | 3300048916 | Ga0496113_0037956 | Ga0496113_0037956_1089_1640 | 183 |
| 240 | 3300048918 | Ga0496115_0412262 | Ga0496115_0412262_280_831 | 183 |
| 241 | 3300049586 | Ga0501070_0101130 | Ga0501070_0101130_44_634 | 183 |
| 242 | 3300050507 | nmdc:mga05p37_164617_c1 | nmdc:mga05p37_164617_c1_1661_2212 | 183 |
| 243 | 3300050513 | nmdc:mga0rr50_225284_c1 | nmdc:mga0rr50_225284_c1_837_1388 | 183 |
| 244 | 3300050514 | nmdc:mga08x19_72357_c1 | nmdc:mga08x19_72357_c1_511_1062 | 183 |
| 245 | 3300050515 | nmdc:mga0a205_15431_c2 | nmdc:mga0a205_15431_c2_785_1336 | 183 |
| 246 | 3300005467 | Ga0070706_100644830 | Ga0070706_1006448302 | 184 |
| 247 | 3300005563 | Ga0068855_100948560 | Ga0068855_1009485601 | 184 |
| 248 | 3300025949 | Ga0207667_11094176 | Ga0207667_110941761 | 184 |
| 249 | 3300038443 | Ga0395901_0260082 | Ga0395901_0260082_755_1324 | 184 |
| 250 | 3300049569 | Ga0501032_0003267 | Ga0501032_0003267_6944_7537 | 184 |
| 251 | 3300049579 | Ga0501043_0014804 | Ga0501043_0014804_5445_6038 | 184 |
| 252 | 3300049586 | Ga0501070_0023327 | Ga0501070_0023327_3231_3824 | 184 |
| 253 | 3300049586 | Ga0501070_0079384 | Ga0501070_0079384_1641_2234 | 184 |
| 254 | 3300049589 | Ga0501073_0104766 | Ga0501073_0104766_1206_1799 | 184 |
| 255 | 3300049742 | Ga0501080_0000094 | Ga0501080_0000094_7076_7669 | 184 |
| 256 | 3300049742 | Ga0501080_0048014 | Ga0501080_0048014_1765_2358 | 184 |
| 257 | 3300049742 | Ga0501080_0050247 | Ga0501080_0050247_279_872 | 184 |
| 258 | 3300049823 | Ga0501044_0000201 | Ga0501044_0000201_31911_32504 | 184 |
| 259 | 3300005436 | Ga0070713_100619447 | Ga0070713_1006194471 | 185 |
| 260 | 3300005471 | Ga0070698_100074521 | Ga0070698_1000745212 | 185 |
| 261 | 3300031901 | Ga0307406_10084517 | Ga0307406_100845173 | 185 |
| 262 | 3300038443 | Ga0395901_0211990 | Ga0395901_0211990_18_638 | 185 |
| 263 | 3300059426 | Ga0590077_014595 | Ga0590077_014595_127_789 | 185 |
| 264 | 3300005985 | Ga0081539_10005408 | Ga0081539_100054088 | 186 |
| 265 | 3300009147 | Ga0114129_10781454 | Ga0114129_107814541 | 186 |
| 266 | 3300031251 | Ga0265327_10060775 | Ga0265327_100607752 | 186 |
| 267 | 3300044693 | Ga0466961_0128163 | Ga0466961_0128163_86_727 | 186 |
| 268 | 3300048911 | Ga0496108_0402329 | Ga0496108_0402329_328_936 | 186 |
| 269 | 3300050507 | nmdc:mga05p37_192160_c1 | nmdc:mga05p37_192160_c1_45_698 | 186 |
| 270 | 3300053077 | Ga0495601_0205975 | Ga0495601_0205975_606_1193 | 187 |
| 271 | 3300003203 | JGI25406J46586_10060260 | JGI25406J46586_100602602 | 188 |
| 272 | 3300048905 | Ga0496102_0629190 | Ga0496102_0629190_241_864 | 188 |
| 273 | 3300048922 | Ga0496119_0041143 | Ga0496119_0041143_1914_2537 | 188 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5fgm-assembly1.cif.gz_A | streptomyces coelicolor sigr region 4 | 0.975 | 127 | 178 |
| 6jhe-assembly1.cif.gz_A | crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna | 0.9536 | 132 | 178 |
| 6eo3-assembly1.cif.gz_A | conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. s207c p212121 | 0.939 | 132 | 175 |
| 8hno-assembly1.cif.gz_B | archaeal transcription factor wild type | 0.9373 | 132 | 177 |
| 3vfz-assembly3.cif.gz_A | crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis | 0.9318 | 121 | 178 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xsvA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9586 | 131 | 178 | 1.10.10.10 |
| 5fgmA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9552 | 127 | 174 | 1.10.10.10 |
| 3vfzA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9212 | 124 | 178 | 1.10.10.10 |
| 3sztA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9037 | 132 | 174 | 1.10.10.10 |
| 6cbqB02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8995 | 132 | 174 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E0RUU2-F1-model_v4 | RNA polymerase subunit sigma-24 | 0.9504 | 8 | 180 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A4R7I0C6-F1-model_v4 | RNA polymerase sigma-70 factor (ECF subfamily) | 0.9421 | 1 | 177 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A3N5L264-F1-model_v4 | RNA polymerase sigma factor | 0.9328 | 8 | 181 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A848UHH8-F1-model_v4 | RNA polymerase sigma factor | 0.929 | 9 | 180 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A538B1R8-F1-model_v4 | RNA polymerase sigma factor | 0.9159 | 8 | 178 |
GO:0003677
GO:0006352 GO:0016987 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar