F379368

General Info

Members Datasets Scaffolds Average Seq Length
273 189 273 187

Family's Representative Sequence

Representative Sequence 3300059426|Ga0590077_014595|Ga0590077_014595_127_789
Length 220
Sequence MPRPGGSLDSAATPIGRLLPPTGDQTQAERGAMIGPRFPELLAAAQGGDEQAFAVLWRDLQPALLRYFQVAANEVAEDLAADTWVSVIRRLGRFRGGEPAFRAWVFTVARHRVIDWHRQAARRPITLVPAEQLAERRAPDDPAVEVLEVQSTRAALALLAELPADQAEVVALRVLGGLEVAEVARIVGKRPGTVRVLAHRGLRRLAKQLEAAGLAGGVTR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
130 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
131 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
132 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
133 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
134 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
135 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
141 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
142 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
143 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
187 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 5.13
Rhizosphere 93.41
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10060260 3300003203 Bacteria 1229
2 JGI25407J50210_10007212 3300003373 Bacteria 2784
3 Ga0070676_10107949 3300005328 Bacteria 1729
4 Ga0070670_100146463 3300005331 Bacteria 2043
5 Ga0068869_100002084 3300005334 Bacteria 12019
6 Ga0070666_10127897 3300005335 Bacteria 1764
7 Ga0070680_100616659 3300005336 Bacteria 931
8 Ga0070682_100052108 3300005337 Bacteria 2560
9 Ga0068868_100016592 3300005338 Bacteria 5474
10 Ga0070689_100092404 3300005340 Bacteria 2387
11 Ga0070691_10024993 3300005341 Bacteria 2779
12 Ga0070687_100300873 3300005343 Bacteria 1018
13 Ga0070661_100278732 3300005344 Bacteria 1296
14 Ga0070671_100152031 3300005355 Bacteria 1955
15 Ga0070673_100083258 3300005364 Bacteria 2599
16 Ga0070713_100619447 3300005436 Bacteria 1029
17 Ga0070705_100042980 3300005440 Bacteria 2587
18 Ga0070708_100079807 3300005445 Unclassified 2961
19 Ga0070708_100121759 3300005445 Bacteria 2407
20 Ga0070663_100069282 3300005455 Bacteria 2562
21 Ga0070681_10127180 3300005458 Bacteria 2481
22 Ga0070681_10220598 3300005458 Bacteria 1811
23 Ga0068867_100438321 3300005459 Bacteria 1110
24 Ga0070685_10042660 3300005466 Bacteria 2589
25 Ga0070706_100184811 3300005467 Bacteria 1947
26 Ga0070706_100644830 3300005467 Bacteria 983
27 Ga0070707_100218552 3300005468 Bacteria 1856
28 Ga0070707_101031100 3300005468 Bacteria 788
29 Ga0070698_100001656 3300005471 Bacteria 24850
30 Ga0070698_100014318 3300005471 Bacteria 8382
31 Ga0070698_100016597 3300005471 Bacteria 7771
32 Ga0070698_100074521 3300005471 Bacteria 3399
33 Ga0070699_100003199 3300005518 Bacteria 14485
34 Ga0070699_100058059 3300005518 Bacteria 3352
35 Ga0070699_100451947 3300005518 Bacteria 1165
36 Ga0070699_100722605 3300005518 Unclassified 910
37 Ga0070679_100255623 3300005530 Bacteria 1707
38 Ga0070697_100168697 3300005536 Bacteria 1852
39 Ga0070697_100214690 3300005536 Bacteria 1639
40 Ga0068853_100120301 3300005539 Bacteria 2341
41 Ga0070672_100109448 3300005543 Bacteria 2250
42 Ga0070693_100004012 3300005547 Bacteria 6921
43 Ga0070704_100356456 3300005549 Bacteria 1236
44 Ga0070704_100458301 3300005549 Bacteria 1099
45 Ga0068855_100070092 3300005563 Bacteria 4079
46 Ga0068855_100948560 3300005563 Unclassified 906
47 Ga0068854_100103273 3300005578 Bacteria 2140
48 Ga0070702_100001166 3300005615 Bacteria 10572
49 Ga0068852_100162335 3300005616 Bacteria 2087
50 Ga0068859_100032834 3300005617 Bacteria 5214
51 Ga0068851_10092629 3300005834 Bacteria 1593
52 Ga0068870_10001631 3300005840 Bacteria 9151
53 Ga0068863_100016586 3300005841 Bacteria 7068
54 Ga0068858_100020398 3300005842 Bacteria 6198
55 Ga0081538_10000487 3300005981 Bacteria 44314
56 Ga0081538_10001113 3300005981 Bacteria 28482
57 Ga0081538_10004477 3300005981 Bacteria 12868
58 Ga0081539_10005408 3300005985 Bacteria 13066
59 Ga0081539_10007081 3300005985 Bacteria 10372
60 Ga0075365_10023105 3300006038 Bacteria 3906
61 Ga0070715_10488312 3300006163 Bacteria 703
62 Ga0070716_100719580 3300006173 Unclassified 764
63 Ga0070712_100031379 3300006175 Bacteria 3579
64 Ga0097621_100021098 3300006237 Bacteria 5031
65 Ga0075428_100122918 3300006844 Bacteria 2825
66 Ga0075434_100014328 3300006871 Bacteria 7578
67 Ga0075429_100432669 3300006880 Bacteria 1153
68 Ga0075436_100151929 3300006914 Bacteria 1630
69 Ga0097620_100032834 3300006931 Bacteria 5214
70 Ga0075435_100141264 3300007076 Bacteria 2020
71 Ga0105244_10418135 3300009036 Bacteria 616
72 Ga0105240_10508207 3300009093 Bacteria 1339
73 Ga0111539_10097718 3300009094 Bacteria 3450
74 Ga0105245_10055913 3300009098 Bacteria 3546
75 Ga0105247_10022272 3300009101 Bacteria 3815
76 Ga0114129_10613243 3300009147 Bacteria 1408
77 Ga0114129_10781454 3300009147 Bacteria 1220
78 Ga0105241_10042926 3300009174 Bacteria 3424
79 Ga0105248_10020756 3300009177 Bacteria 7278
80 Ga0105238_10034619 3300009551 Bacteria 5138
81 Ga0105239_10675928 3300010375 Bacteria 1180
82 Ga0105246_10002247 3300011119 Bacteria 11647
83 Ga0157371_10061939 3300013102 Bacteria 2653
84 Ga0157370_10063780 3300013104 Bacteria 3490
85 Ga0157374_10061657 3300013296 Bacteria 3513
86 Ga0157380_10342774 3300014326 Bacteria 1395
87 Ga0182008_10075568 3300014497 Bacteria 1657
88 Ga0157377_10035092 3300014745 Bacteria 2749
89 Ga0157379_10126788 3300014968 Bacteria 2297
90 Ga0207656_10090420 3300025321 Bacteria 1389
91 Ga0207692_10279631 3300025898 Unclassified 1009
92 Ga0207688_10006353 3300025901 Bacteria 6434
93 Ga0207645_10105414 3300025907 Bacteria 1821
94 Ga0207643_10000070 3300025908 Bacteria 68946
95 Ga0207705_10137059 3300025909 Bacteria 1825
96 Ga0207654_10007104 3300025911 Bacteria 5642
97 Ga0207707_10159450 3300025912 Bacteria 1973
98 Ga0207695_10292502 3300025913 Bacteria 1521
99 Ga0207693_10151267 3300025915 Unclassified 1825
100 Ga0207657_10016748 3300025919 Bacteria 7058
101 Ga0207649_10041426 3300025920 Bacteria 2803
102 Ga0207652_10068739 3300025921 Bacteria 3074
103 Ga0207681_10309955 3300025923 Bacteria 1252
104 Ga0207659_10335969 3300025926 Bacteria 1250
105 Ga0207687_10021695 3300025927 Bacteria 4268
106 Ga0207644_10066802 3300025931 Bacteria 2619
107 Ga0207670_10100656 3300025936 Bacteria 2063
108 Ga0207691_10273925 3300025940 Bacteria 1453
109 Ga0207711_10194668 3300025941 Bacteria 1848
110 Ga0207689_10000256 3300025942 Bacteria 47650
111 Ga0207661_10036448 3300025944 Bacteria 3839
112 Ga0207679_10082362 3300025945 Bacteria 2463
113 Ga0207667_11094176 3300025949 Unclassified 780
114 Ga0207640_10145954 3300025981 Bacteria 1731
115 Ga0207703_10585708 3300026035 Bacteria 1054
116 Ga0207678_10001449 3300026067 Bacteria 21802
117 Ga0207702_10002759 3300026078 Bacteria 16441
118 Ga0207641_10009110 3300026088 Bacteria 8199
119 Ga0207648_10412529 3300026089 Bacteria 1225
120 Ga0207676_10002056 3300026095 Bacteria 14601
121 Ga0207674_10135100 3300026116 Bacteria 2428
122 Ga0207675_100860502 3300026118 Bacteria 922
123 Ga0207683_10007051 3300026121 Bacteria 9635
124 Ga0207428_10025863 3300027907 Bacteria 4906
125 Ga0268266_10039318 3300028379 Bacteria 4029
126 Ga0265327_10060775 3300031251 Unclassified 1930
127 Ga0307408_100141467 3300031548 Bacteria 1889
128 Ga0307405_10022305 3300031731 Plasmid 3577
129 Ga0307405_10027384 3300031731 Bacteria 3304
130 Ga0307405_10038094 3300031731 Plasmid 2895
131 Ga0307405_10048108 3300031731 Unclassified 2629
132 Ga0307405_10057477 3300031731 Unclassified 2444
133 Ga0307413_10011932 3300031824 Unclassified 4299
134 Ga0307413_10027356 3300031824 Bacteria 3159
135 Ga0307413_10096240 3300031824 Unclassified 1943
136 Ga0307410_10028347 3300031852 Unclassified 3550
137 Ga0307410_10303558 3300031852 Unclassified 1260
138 Ga0307406_10084517 3300031901 Unclassified 2119
139 Ga0307406_10146567 3300031901 Unclassified 1678
140 Ga0307406_11321715 3300031901 Bacteria 630
141 Ga0307407_10021112 3300031903 Bacteria 3351
142 Ga0307407_10046537 3300031903 Unclassified 2457
143 Ga0307407_10056697 3300031903 Bacteria 2270
144 Ga0307407_10098597 3300031903 Unclassified 1808
145 Ga0307407_10291566 3300031903 Unclassified 1134
146 Ga0307412_10329271 3300031911 Unclassified 1218
147 Ga0307409_100007795 3300031995 Bacteria 6441
148 Ga0307409_100011799 3300031995 Bacteria 5532
149 Ga0307409_100025455 3300031995 Bacteria 4151
150 Ga0307409_100059882 3300031995 Bacteria 2966
151 Ga0307409_100098088 3300031995 Bacteria 2422
152 Ga0307409_100373184 3300031995 Unclassified 1353
153 Ga0307409_101138631 3300031995 Bacteria 802
154 Ga0307416_100004161 3300032002 Bacteria 8670
155 Ga0307416_100008590 3300032002 Bacteria 6604
156 Ga0307416_100018273 3300032002 Bacteria 4934
157 Ga0307416_100025542 3300032002 Bacteria 4332
158 Ga0307416_100046508 3300032002 Bacteria 3425
159 Ga0307416_100058816 3300032002 Unclassified 3119
160 Ga0307416_100060809 3300032002 Unclassified 3078
161 Ga0307416_100132642 3300032002 Unclassified 2246
162 Ga0307416_100488795 3300032002 Unclassified 1292
163 Ga0307416_101347924 3300032002 Unclassified 819
164 Ga0307414_10045182 3300032004 Bacteria 3015
165 Ga0307414_10340454 3300032004 Bacteria 1284
166 Ga0307414_10363037 3300032004 Bacteria 1247
167 Ga0307414_11099490 3300032004 Bacteria 734
168 Ga0307411_10060218 3300032005 Unclassified 2520
169 Ga0307411_10066440 3300032005 Bacteria 2423
170 Ga0307411_11360902 3300032005 Bacteria 648
171 Ga0307415_100000790 3300032126 Bacteria 14365
172 Ga0307415_100003127 3300032126 Bacteria 8383
173 Ga0307415_100003306 3300032126 Bacteria 8181
174 Ga0307415_100007732 3300032126 Bacteria 5904
175 Ga0307415_100014821 3300032126 Bacteria 4597
176 Ga0307415_100021313 3300032126 Unclassified 3980
177 Ga0307415_100023425 3300032126 Bacteria 3831
178 Ga0307415_100039233 3300032126 Bacteria 3128
179 Ga0307415_100442985 3300032126 Unclassified 1121
180 Ga0307415_100482524 3300032126 Bacteria 1079
181 Ga0373925_0593695 3300037068 Bacteria 912
182 Ga0395899_0002229 3300037312 Bacteria 15878
183 Ga0395899_0364354 3300037312 Unclassified 964
184 Ga0395900_0005158 3300037418 Bacteria 13719
185 Ga0395900_0022936 3300037418 Bacteria 6387
186 Ga0395900_0035735 3300037418 Bacteria 5119
187 Ga0395898_0023339 3300037466 Bacteria 6252
188 Ga0395898_0070312 3300037466 Bacteria 3384
189 Ga0395898_0340552 3300037466 Bacteria 1430
190 Ga0395905_0000949 3300037471 Bacteria 37219
191 Ga0395905_0041490 3300037471 Bacteria 4318
192 Ga0395905_0334056 3300037471 Bacteria 1406
193 Ga0436364_0555836 3300037853 Bacteria 2041
194 Ga0395901_0001416 3300038443 Bacteria 25049
195 Ga0395901_0211990 3300038443 Bacteria 2027
196 Ga0395901_0260082 3300038443 Bacteria 1807
197 Ga0439450_018952 3300042008 Bacteria 1452
198 Ga0439455_0019803 3300042012 Unclassified 1590
199 Ga0439463_008137 3300042016 Bacteria 2586
200 Ga0439463_013242 3300042016 Bacteria 2030
201 Ga0450905_015616 3300042142 Bacteria 1089
202 Ga0439464_0040809 3300042439 Bacteria 1323
203 Ga0439460_0010715 3300042461 Bacteria 2354
204 Ga0439460_0024300 3300042461 Bacteria 1677
205 Ga0439440_0005578 3300042993 Bacteria 2502
206 Ga0466961_0128163 3300044693 Bacteria 1591
207 Ga0466967_0285032 3300045976 Bacteria 1586
208 Ga0495662_0181241 3300046476 Bacteria 1038
209 Ga0495584_0043795 3300046491 Bacteria 2259
210 Ga0495663_0035454 3300046525 Bacteria 1498
211 Ga0495621_0043854 3300046539 Bacteria 1579
212 Ga0495656_0303600 3300046615 Bacteria 818
213 Ga0495615_0048886 3300048090 Bacteria 1083
214 Ga0496100_0542457 3300048903 Bacteria 899
215 Ga0496101_0178213 3300048904 Bacteria 1636
216 Ga0496102_0360208 3300048905 Bacteria 1369
217 Ga0496102_0629190 3300048905 Unclassified 996
218 Ga0496104_0018843 3300048907 Bacteria 6304
219 Ga0496105_0017991 3300048908 Bacteria 5671
220 Ga0496106_0006614 3300048909 Bacteria 8577
221 Ga0496108_0402329 3300048911 Bacteria 1196
222 Ga0496109_0099613 3300048912 Bacteria 2695
223 Ga0496110_0055579 3300048913 Bacteria 3483
224 Ga0496111_0053633 3300048914 Bacteria 2913
225 Ga0496112_0346860 3300048915 Bacteria 1427
226 Ga0496113_0037956 3300048916 Bacteria 3538
227 Ga0496115_0412262 3300048918 Bacteria 1095
228 Ga0496119_0041143 3300048922 Plasmid 2947
229 Ga0501031_0245801 3300049568 Bacteria 1163
230 Ga0501032_0003267 3300049569 Bacteria 12478
231 Ga0501036_0068006 3300049572 Bacteria 3014
232 Ga0501038_0028278 3300049574 Bacteria 4981
233 Ga0501040_0029377 3300049576 Bacteria 3710
234 Ga0501041_0468109 3300049577 Unclassified 801
235 Ga0501041_0525300 3300049577 Bacteria 754
236 Ga0501042_0000110 3300049578 Bacteria 34194
237 Ga0501043_0014804 3300049579 Bacteria 6107
238 Ga0501043_0422598 3300049579 Bacteria 1005
239 Ga0501048_0054600 3300049582 Bacteria 2838
240 Ga0501068_0078201 3300049584 Bacteria 2027
241 Ga0501070_0003962 3300049586 Bacteria 12745
242 Ga0501070_0023327 3300049586 Bacteria 5183
243 Ga0501070_0079384 3300049586 Bacteria 2715
244 Ga0501070_0101130 3300049586 Bacteria 2384
245 Ga0501071_0904300 3300049587 Unclassified 681
246 Ga0501073_0104766 3300049589 Bacteria 1963
247 Ga0501073_0247611 3300049589 Unclassified 1230
248 Ga0501074_0009525 3300049590 Bacteria 7055
249 Ga0501074_0010199 3300049590 Bacteria 6819
250 Ga0501075_0113179 3300049591 Bacteria 2063
251 Ga0501079_0000038 3300049741 Bacteria 56523
252 Ga0501080_0000094 3300049742 Bacteria 60247
253 Ga0501080_0007112 3300049742 Bacteria 10103
254 Ga0501080_0048014 3300049742 Bacteria 3975
255 Ga0501080_0050247 3300049742 Bacteria 3882
256 Ga0501081_0046449 3300049743 Bacteria 2985
257 Ga0501081_0403645 3300049743 Bacteria 1012
258 Ga0501035_0782012 3300049822 Bacteria 764
259 Ga0501044_0000201 3300049823 Bacteria 75685
260 Ga0501045_0527498 3300049824 Bacteria 876
261 nmdc:mga0yw44_19408_c1 3300050492 Bacteria 3749
262 nmdc:mga05p37_164617_c1 3300050507 Bacteria 2707
263 nmdc:mga05p37_192160_c1 3300050507 Bacteria 2477
264 nmdc:mga0rr50_225284_c1 3300050513 Bacteria 1550
265 nmdc:mga08x19_72357_c1 3300050514 Bacteria 2249
266 nmdc:mga0a205_15431_c2 3300050515 Bacteria 1721
267 Ga0495601_0205975 3300053077 Unclassified 1285
268 Ga0501084_0005026 3300054114 Bacteria 10818
269 Ga0501084_0383833 3300054114 Bacteria 1187
270 Ga0590075_000813 3300059424 Bacteria 8191
271 Ga0590077_014595 3300059426 Unclassified 1637
272 Ga0501082_0048190 3300060353 Bacteria 3672
273 Ga0530510_0390748 3300061734 Unclassified 1048

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0285032 Ga0466967_0285032_313_912 166
2 3300049577 Ga0501041_0468109 Ga0501041_0468109_99_656 166
3 3300061734 Ga0530510_0390748 Ga0530510_0390748_32_589 166
4 3300049743 Ga0501081_0403645 Ga0501081_0403645_228_785 167
5 3300059424 Ga0590075_000813 Ga0590075_000813_6412_6978 172
6 3300005445 Ga0070708_100079807 Ga0070708_1000798073 174
7 3300005445 Ga0070708_100121759 Ga0070708_1001217591 174
8 3300005467 Ga0070706_100184811 Ga0070706_1001848114 174
9 3300005468 Ga0070707_100218552 Ga0070707_1002185522 174
10 3300005468 Ga0070707_101031100 Ga0070707_1010311001 176
11 3300049568 Ga0501031_0245801 Ga0501031_0245801_240_824 178
12 3300049572 Ga0501036_0068006 Ga0501036_0068006_384_968 178
13 3300049574 Ga0501038_0028278 Ga0501038_0028278_2419_3003 178
14 3300049576 Ga0501040_0029377 Ga0501040_0029377_280_864 178
15 3300049578 Ga0501042_0000110 Ga0501042_0000110_6292_6876 178
16 3300049582 Ga0501048_0054600 Ga0501048_0054600_252_836 178
17 3300049584 Ga0501068_0078201 Ga0501068_0078201_984_1568 178
18 3300049590 Ga0501074_0010199 Ga0501074_0010199_4850_5434 178
19 3300049591 Ga0501075_0113179 Ga0501075_0113179_147_731 178
20 3300049743 Ga0501081_0046449 Ga0501081_0046449_766_1350 178
21 3300049822 Ga0501035_0782012 Ga0501035_0782012_64_648 178
22 3300049824 Ga0501045_0527498 Ga0501045_0527498_280_864 178
23 3300054114 Ga0501084_0005026 Ga0501084_0005026_6876_7460 178
24 3300060353 Ga0501082_0048190 Ga0501082_0048190_1778_2362 178
25 3300006038 Ga0075365_10023105 Ga0075365_100231054 179
26 3300046491 Ga0495584_0043795 Ga0495584_0043795_864_1418 179
27 3300046525 Ga0495663_0035454 Ga0495663_0035454_417_971 179
28 3300046539 Ga0495621_0043854 Ga0495621_0043854_224_778 179
29 3300046615 Ga0495656_0303600 Ga0495656_0303600_253_807 179
30 3300048090 Ga0495615_0048886 Ga0495615_0048886_273_827 179
31 3300049579 Ga0501043_0422598 Ga0501043_0422598_142_717 179
32 3300049586 Ga0501070_0003962 Ga0501070_0003962_6397_6972 179
33 3300049589 Ga0501073_0247611 Ga0501073_0247611_190_765 179
34 3300049590 Ga0501074_0009525 Ga0501074_0009525_3824_4399 179
35 3300049741 Ga0501079_0000038 Ga0501079_0000038_20422_20997 179
36 3300049742 Ga0501080_0007112 Ga0501080_0007112_74_649 179
37 3300050492 nmdc:mga0yw44_19408_c1 nmdc:mga0yw44_19408_c1_1856_2401 179
38 3300005471 Ga0070698_100001656 Ga0070698_10000165619 180
39 3300005471 Ga0070698_100014318 Ga0070698_1000143184 180
40 3300005518 Ga0070699_100058059 Ga0070699_1000580593 180
41 3300005518 Ga0070699_100451947 Ga0070699_1004519471 180
42 3300005518 Ga0070699_100722605 Ga0070699_1007226052 180
43 3300005536 Ga0070697_100214690 Ga0070697_1002146902 180
44 3300005549 Ga0070704_100356456 Ga0070704_1003564562 180
45 3300037312 Ga0395899_0002229 Ga0395899_0002229_14156_14716 180
46 3300037418 Ga0395900_0005158 Ga0395900_0005158_1294_1854 180
47 3300037418 Ga0395900_0035735 Ga0395900_0035735_873_1430 180
48 3300037466 Ga0395898_0070312 Ga0395898_0070312_974_1534 180
49 3300037466 Ga0395898_0340552 Ga0395898_0340552_243_800 180
50 3300037471 Ga0395905_0000949 Ga0395905_0000949_13965_14525 180
51 3300037471 Ga0395905_0041490 Ga0395905_0041490_2689_3246 180
52 3300038443 Ga0395901_0001416 Ga0395901_0001416_20692_21249 180
53 3300049577 Ga0501041_0525300 Ga0501041_0525300_20_577 180
54 3300049587 Ga0501071_0904300 Ga0501071_0904300_58_615 180
55 3300054114 Ga0501084_0383833 Ga0501084_0383833_479_1036 180
56 3300005458 Ga0070681_10127180 Ga0070681_101271802 182
57 3300005471 Ga0070698_100016597 Ga0070698_1000165975 182
58 3300005518 Ga0070699_100003199 Ga0070699_1000031994 182
59 3300005536 Ga0070697_100168697 Ga0070697_1001686972 182
60 3300006163 Ga0070715_10488312 Ga0070715_104883121 182
61 3300006173 Ga0070716_100719580 Ga0070716_1007195801 182
62 3300006175 Ga0070712_100031379 Ga0070712_1000313795 182
63 3300025898 Ga0207692_10279631 Ga0207692_102796312 182
64 3300025912 Ga0207707_10159450 Ga0207707_101594502 182
65 3300025915 Ga0207693_10151267 Ga0207693_101512673 182
66 3300031903 Ga0307407_10291566 Ga0307407_102915662 182
67 3300032002 Ga0307416_100488795 Ga0307416_1004887952 182
68 3300032004 Ga0307414_11099490 Ga0307414_110994901 182
69 3300032126 Ga0307415_100023425 Ga0307415_1000234255 182
70 3300032126 Ga0307415_100482524 Ga0307415_1004825242 182
71 3300037068 Ga0373925_0593695 Ga0373925_0593695_316_867 182
72 3300037853 Ga0436364_0555836 Ga0436364_0555836_1241_1792 182
73 3300046476 Ga0495662_0181241 Ga0495662_0181241_384_935 182
74 3300003373 JGI25407J50210_10007212 JGI25407J50210_100072125 183
75 3300005328 Ga0070676_10107949 Ga0070676_101079492 183
76 3300005331 Ga0070670_100146463 Ga0070670_1001464632 183
77 3300005334 Ga0068869_100002084 Ga0068869_1000020847 183
78 3300005335 Ga0070666_10127897 Ga0070666_101278972 183
79 3300005336 Ga0070680_100616659 Ga0070680_1006166592 183
80 3300005337 Ga0070682_100052108 Ga0070682_1000521083 183
81 3300005338 Ga0068868_100016592 Ga0068868_1000165922 183
82 3300005340 Ga0070689_100092404 Ga0070689_1000924042 183
83 3300005341 Ga0070691_10024993 Ga0070691_100249932 183
84 3300005343 Ga0070687_100300873 Ga0070687_1003008731 183
85 3300005344 Ga0070661_100278732 Ga0070661_1002787322 183
86 3300005355 Ga0070671_100152031 Ga0070671_1001520312 183
87 3300005364 Ga0070673_100083258 Ga0070673_1000832582 183
88 3300005440 Ga0070705_100042980 Ga0070705_1000429803 183
89 3300005455 Ga0070663_100069282 Ga0070663_1000692823 183
90 3300005458 Ga0070681_10220598 Ga0070681_102205982 183
91 3300005459 Ga0068867_100438321 Ga0068867_1004383211 183
92 3300005466 Ga0070685_10042660 Ga0070685_100426603 183
93 3300005530 Ga0070679_100255623 Ga0070679_1002556232 183
94 3300005539 Ga0068853_100120301 Ga0068853_1001203012 183
95 3300005543 Ga0070672_100109448 Ga0070672_1001094481 183
96 3300005547 Ga0070693_100004012 Ga0070693_1000040122 183
97 3300005549 Ga0070704_100458301 Ga0070704_1004583012 183
98 3300005563 Ga0068855_100070092 Ga0068855_1000700923 183
99 3300005578 Ga0068854_100103273 Ga0068854_1001032732 183
100 3300005615 Ga0070702_100001166 Ga0070702_1000011666 183
101 3300005616 Ga0068852_100162335 Ga0068852_1001623352 183
102 3300005617 Ga0068859_100032834 Ga0068859_1000328343 183
103 3300005834 Ga0068851_10092629 Ga0068851_100926291 183
104 3300005840 Ga0068870_10001631 Ga0068870_1000163111 183
105 3300005841 Ga0068863_100016586 Ga0068863_1000165862 183
106 3300005842 Ga0068858_100020398 Ga0068858_1000203983 183
107 3300005981 Ga0081538_10000487 Ga0081538_100004876 183
108 3300005981 Ga0081538_10001113 Ga0081538_100011136 183
109 3300005981 Ga0081538_10004477 Ga0081538_100044775 183
110 3300005985 Ga0081539_10007081 Ga0081539_100070813 183
111 3300006237 Ga0097621_100021098 Ga0097621_1000210983 183
112 3300006844 Ga0075428_100122918 Ga0075428_1001229183 183
113 3300006871 Ga0075434_100014328 Ga0075434_1000143284 183
114 3300006880 Ga0075429_100432669 Ga0075429_1004326692 183
115 3300006914 Ga0075436_100151929 Ga0075436_1001519292 183
116 3300006931 Ga0097620_100032834 Ga0097620_1000328343 183
117 3300007076 Ga0075435_100141264 Ga0075435_1001412642 183
118 3300009036 Ga0105244_10418135 Ga0105244_104181351 183
119 3300009093 Ga0105240_10508207 Ga0105240_105082071 183
120 3300009094 Ga0111539_10097718 Ga0111539_100977183 183
121 3300009098 Ga0105245_10055913 Ga0105245_100559132 183
122 3300009101 Ga0105247_10022272 Ga0105247_100222721 183
123 3300009147 Ga0114129_10613243 Ga0114129_106132432 183
124 3300009174 Ga0105241_10042926 Ga0105241_100429263 183
125 3300009177 Ga0105248_10020756 Ga0105248_100207564 183
126 3300009551 Ga0105238_10034619 Ga0105238_100346193 183
127 3300010375 Ga0105239_10675928 Ga0105239_106759282 183
128 3300011119 Ga0105246_10002247 Ga0105246_100022474 183
129 3300013102 Ga0157371_10061939 Ga0157371_100619392 183
130 3300013104 Ga0157370_10063780 Ga0157370_100637803 183
131 3300013296 Ga0157374_10061657 Ga0157374_100616572 183
132 3300014326 Ga0157380_10342774 Ga0157380_103427742 183
133 3300014497 Ga0182008_10075568 Ga0182008_100755681 183
134 3300014745 Ga0157377_10035092 Ga0157377_100350923 183
135 3300014968 Ga0157379_10126788 Ga0157379_101267882 183
136 3300025321 Ga0207656_10090420 Ga0207656_100904202 183
137 3300025901 Ga0207688_10006353 Ga0207688_100063531 183
138 3300025907 Ga0207645_10105414 Ga0207645_101054142 183
139 3300025908 Ga0207643_10000070 Ga0207643_1000007044 183
140 3300025909 Ga0207705_10137059 Ga0207705_101370592 183
141 3300025911 Ga0207654_10007104 Ga0207654_100071043 183
142 3300025913 Ga0207695_10292502 Ga0207695_102925022 183
143 3300025919 Ga0207657_10016748 Ga0207657_100167484 183
144 3300025920 Ga0207649_10041426 Ga0207649_100414263 183
145 3300025921 Ga0207652_10068739 Ga0207652_100687392 183
146 3300025923 Ga0207681_10309955 Ga0207681_103099551 183
147 3300025926 Ga0207659_10335969 Ga0207659_103359692 183
148 3300025927 Ga0207687_10021695 Ga0207687_100216953 183
149 3300025931 Ga0207644_10066802 Ga0207644_100668022 183
150 3300025936 Ga0207670_10100656 Ga0207670_101006562 183
151 3300025940 Ga0207691_10273925 Ga0207691_102739252 183
152 3300025941 Ga0207711_10194668 Ga0207711_101946682 183
153 3300025942 Ga0207689_10000256 Ga0207689_100002563 183
154 3300025944 Ga0207661_10036448 Ga0207661_100364483 183
155 3300025945 Ga0207679_10082362 Ga0207679_100823622 183
156 3300025981 Ga0207640_10145954 Ga0207640_101459542 183
157 3300026035 Ga0207703_10585708 Ga0207703_105857082 183
158 3300026067 Ga0207678_10001449 Ga0207678_100014492 183
159 3300026078 Ga0207702_10002759 Ga0207702_100027592 183
160 3300026088 Ga0207641_10009110 Ga0207641_100091104 183
161 3300026089 Ga0207648_10412529 Ga0207648_104125291 183
162 3300026095 Ga0207676_10002056 Ga0207676_100020569 183
163 3300026116 Ga0207674_10135100 Ga0207674_101351002 183
164 3300026118 Ga0207675_100860502 Ga0207675_1008605022 183
165 3300026121 Ga0207683_10007051 Ga0207683_100070512 183
166 3300027907 Ga0207428_10025863 Ga0207428_100258632 183
167 3300028379 Ga0268266_10039318 Ga0268266_100393182 183
168 3300031548 Ga0307408_100141467 Ga0307408_1001414672 183
169 3300031731 Ga0307405_10022305 Ga0307405_100223052 183
170 3300031731 Ga0307405_10027384 Ga0307405_100273844 183
171 3300031731 Ga0307405_10038094 Ga0307405_100380943 183
172 3300031731 Ga0307405_10048108 Ga0307405_100481082 183
173 3300031731 Ga0307405_10057477 Ga0307405_100574773 183
174 3300031824 Ga0307413_10011932 Ga0307413_100119324 183
175 3300031824 Ga0307413_10027356 Ga0307413_100273565 183
176 3300031824 Ga0307413_10096240 Ga0307413_100962402 183
177 3300031852 Ga0307410_10028347 Ga0307410_100283473 183
178 3300031852 Ga0307410_10303558 Ga0307410_103035581 183
179 3300031901 Ga0307406_10146567 Ga0307406_101465672 183
180 3300031901 Ga0307406_11321715 Ga0307406_113217151 183
181 3300031903 Ga0307407_10021112 Ga0307407_100211121 183
182 3300031903 Ga0307407_10046537 Ga0307407_100465372 183
183 3300031903 Ga0307407_10056697 Ga0307407_100566971 183
184 3300031903 Ga0307407_10098597 Ga0307407_100985972 183
185 3300031911 Ga0307412_10329271 Ga0307412_103292712 183
186 3300031995 Ga0307409_100007795 Ga0307409_1000077954 183
187 3300031995 Ga0307409_100011799 Ga0307409_1000117994 183
188 3300031995 Ga0307409_100025455 Ga0307409_1000254553 183
189 3300031995 Ga0307409_100059882 Ga0307409_1000598822 183
190 3300031995 Ga0307409_100098088 Ga0307409_1000980882 183
191 3300031995 Ga0307409_100373184 Ga0307409_1003731842 183
192 3300031995 Ga0307409_101138631 Ga0307409_1011386311 183
193 3300032002 Ga0307416_100004161 Ga0307416_1000041619 183
194 3300032002 Ga0307416_100008590 Ga0307416_1000085902 183
195 3300032002 Ga0307416_100018273 Ga0307416_1000182736 183
196 3300032002 Ga0307416_100025542 Ga0307416_1000255422 183
197 3300032002 Ga0307416_100046508 Ga0307416_1000465082 183
198 3300032002 Ga0307416_100058816 Ga0307416_1000588162 183
199 3300032002 Ga0307416_100060809 Ga0307416_1000608093 183
200 3300032002 Ga0307416_100132642 Ga0307416_1001326423 183
201 3300032002 Ga0307416_101347924 Ga0307416_1013479242 183
202 3300032004 Ga0307414_10045182 Ga0307414_100451824 183
203 3300032004 Ga0307414_10340454 Ga0307414_103404542 183
204 3300032004 Ga0307414_10363037 Ga0307414_103630372 183
205 3300032005 Ga0307411_10060218 Ga0307411_100602183 183
206 3300032005 Ga0307411_10066440 Ga0307411_100664403 183
207 3300032005 Ga0307411_11360902 Ga0307411_113609021 183
208 3300032126 Ga0307415_100000790 Ga0307415_1000007905 183
209 3300032126 Ga0307415_100003127 Ga0307415_10000312711 183
210 3300032126 Ga0307415_100003306 Ga0307415_1000033065 183
211 3300032126 Ga0307415_100007732 Ga0307415_1000077324 183
212 3300032126 Ga0307415_100014821 Ga0307415_1000148215 183
213 3300032126 Ga0307415_100021313 Ga0307415_1000213134 183
214 3300032126 Ga0307415_100039233 Ga0307415_1000392333 183
215 3300032126 Ga0307415_100442985 Ga0307415_1004429852 183
216 3300037312 Ga0395899_0364354 Ga0395899_0364354_86_652 183
217 3300037418 Ga0395900_0022936 Ga0395900_0022936_1913_2479 183
218 3300037466 Ga0395898_0023339 Ga0395898_0023339_2382_2948 183
219 3300037471 Ga0395905_0334056 Ga0395905_0334056_203_769 183
220 3300042008 Ga0439450_018952 Ga0439450_018952_634_1200 183
221 3300042012 Ga0439455_0019803 Ga0439455_0019803_243_809 183
222 3300042016 Ga0439463_008137 Ga0439463_008137_716_1282 183
223 3300042016 Ga0439463_013242 Ga0439463_013242_1435_2001 183
224 3300042142 Ga0450905_015616 Ga0450905_015616_29_595 183
225 3300042439 Ga0439464_0040809 Ga0439464_0040809_742_1308 183
226 3300042461 Ga0439460_0010715 Ga0439460_0010715_669_1235 183
227 3300042461 Ga0439460_0024300 Ga0439460_0024300_743_1309 183
228 3300042993 Ga0439440_0005578 Ga0439440_0005578_1921_2487 183
229 3300048903 Ga0496100_0542457 Ga0496100_0542457_283_834 183
230 3300048904 Ga0496101_0178213 Ga0496101_0178213_198_749 183
231 3300048905 Ga0496102_0360208 Ga0496102_0360208_586_1137 183
232 3300048907 Ga0496104_0018843 Ga0496104_0018843_330_881 183
233 3300048908 Ga0496105_0017991 Ga0496105_0017991_1078_1629 183
234 3300048909 Ga0496106_0006614 Ga0496106_0006614_1028_1579 183
235 3300048912 Ga0496109_0099613 Ga0496109_0099613_1899_2450 183
236 3300048913 Ga0496110_0055579 Ga0496110_0055579_557_1108 183
237 3300048914 Ga0496111_0053633 Ga0496111_0053633_1910_2461 183
238 3300048915 Ga0496112_0346860 Ga0496112_0346860_441_992 183
239 3300048916 Ga0496113_0037956 Ga0496113_0037956_1089_1640 183
240 3300048918 Ga0496115_0412262 Ga0496115_0412262_280_831 183
241 3300049586 Ga0501070_0101130 Ga0501070_0101130_44_634 183
242 3300050507 nmdc:mga05p37_164617_c1 nmdc:mga05p37_164617_c1_1661_2212 183
243 3300050513 nmdc:mga0rr50_225284_c1 nmdc:mga0rr50_225284_c1_837_1388 183
244 3300050514 nmdc:mga08x19_72357_c1 nmdc:mga08x19_72357_c1_511_1062 183
245 3300050515 nmdc:mga0a205_15431_c2 nmdc:mga0a205_15431_c2_785_1336 183
246 3300005467 Ga0070706_100644830 Ga0070706_1006448302 184
247 3300005563 Ga0068855_100948560 Ga0068855_1009485601 184
248 3300025949 Ga0207667_11094176 Ga0207667_110941761 184
249 3300038443 Ga0395901_0260082 Ga0395901_0260082_755_1324 184
250 3300049569 Ga0501032_0003267 Ga0501032_0003267_6944_7537 184
251 3300049579 Ga0501043_0014804 Ga0501043_0014804_5445_6038 184
252 3300049586 Ga0501070_0023327 Ga0501070_0023327_3231_3824 184
253 3300049586 Ga0501070_0079384 Ga0501070_0079384_1641_2234 184
254 3300049589 Ga0501073_0104766 Ga0501073_0104766_1206_1799 184
255 3300049742 Ga0501080_0000094 Ga0501080_0000094_7076_7669 184
256 3300049742 Ga0501080_0048014 Ga0501080_0048014_1765_2358 184
257 3300049742 Ga0501080_0050247 Ga0501080_0050247_279_872 184
258 3300049823 Ga0501044_0000201 Ga0501044_0000201_31911_32504 184
259 3300005436 Ga0070713_100619447 Ga0070713_1006194471 185
260 3300005471 Ga0070698_100074521 Ga0070698_1000745212 185
261 3300031901 Ga0307406_10084517 Ga0307406_100845173 185
262 3300038443 Ga0395901_0211990 Ga0395901_0211990_18_638 185
263 3300059426 Ga0590077_014595 Ga0590077_014595_127_789 185
264 3300005985 Ga0081539_10005408 Ga0081539_100054088 186
265 3300009147 Ga0114129_10781454 Ga0114129_107814541 186
266 3300031251 Ga0265327_10060775 Ga0265327_100607752 186
267 3300044693 Ga0466961_0128163 Ga0466961_0128163_86_727 186
268 3300048911 Ga0496108_0402329 Ga0496108_0402329_328_936 186
269 3300050507 nmdc:mga05p37_192160_c1 nmdc:mga05p37_192160_c1_45_698 186
270 3300053077 Ga0495601_0205975 Ga0495601_0205975_606_1193 187
271 3300003203 JGI25406J46586_10060260 JGI25406J46586_100602602 188
272 3300048905 Ga0496102_0629190 Ga0496102_0629190_241_864 188
273 3300048922 Ga0496119_0041143 Ga0496119_0041143_1914_2537 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

158

207

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

152

205

0.96

PF04542

Sigma70_r2

Sigma-70 region 2

56

123

0.84

PF07638

Sigma70_ECF

ECF sigma factor

36

203

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fgm-assembly1.cif.gz_A streptomyces coelicolor sigr region 4 0.975 127 178
6jhe-assembly1.cif.gz_A crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna 0.9536 132 178
6eo3-assembly1.cif.gz_A conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. s207c p212121 0.939 132 175
8hno-assembly1.cif.gz_B archaeal transcription factor wild type 0.9373 132 177
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.9318 121 178
ID Description Score Start End Superfamily
1xsvA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9586 131 178 1.10.10.10
5fgmA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9552 127 174 1.10.10.10
3vfzA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9212 124 178 1.10.10.10
3sztA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9037 132 174 1.10.10.10
6cbqB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8995 132 174 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2E0RUU2-F1-model_v4 RNA polymerase subunit sigma-24 0.9504 8 180 GO:0003677
GO:0006352
GO:0016987
AF-A0A4R7I0C6-F1-model_v4 RNA polymerase sigma-70 factor (ECF subfamily) 0.9421 1 177 GO:0003677
GO:0006352
GO:0016987
AF-A0A3N5L264-F1-model_v4 RNA polymerase sigma factor 0.9328 8 181 GO:0003677
GO:0006352
GO:0016987
AF-A0A848UHH8-F1-model_v4 RNA polymerase sigma factor 0.929 9 180 GO:0003677
GO:0006352
GO:0016987
AF-A0A538B1R8-F1-model_v4 RNA polymerase sigma factor 0.9159 8 178 GO:0003677
GO:0006352
GO:0016987

Feature Viewer

pLDDT pTM Quality
84.52 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map