F379321

General Info

Members Datasets Scaffolds Average Seq Length
273 176 546 418

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0043141|Ga0501037_0043141_609_2042
Length 477
Sequence VRAALPVKPDFFVRKGILAGCPPPVANRAVAKAALRSDRFRPCNPRFNWLDSCQMNAVPTASTATPTDSSVPLRPAIDRFVAWLDDFGETSQDHQDFFASRLGRAAKNLYYRRPALGKFAVLPMVACEALAPWTRRFYFPRMRLPISDAHFAMGFAYLHRVTGERRHLDRAIHFLEVLEATRCPGFERHGWGYPFDWQTRNGILPRGTPLITTTPYCYEAFADVFRIDGQPRWREIMRSIAEHVLLDYRELDAGPNATTCSYIPTGEFHVVNASAYRAFTLFAAWKEFGDERYRAPAERNLNFVLQSQQADGSWPYAMDGVRPFVDHFHTCFVMKALAKIEALIGHAGCTAALARGVGYYTQHLFDEAGLPRPFARAPRLVIYRRELYDCAECLNLGVLLRGRWAALDTAADRTAKEIVQQWQLPDGHFRSRRLLLGWDNVPMHRWGQSEMFRALCLRLAAGRNPAKSEQAGTAVGS

Samples

Sample ID Description Type Environment
1 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
130 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
167 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.03
Rhizosphere 95.24
Stem 0
Stem Tuber 0
Unclassified 10.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501037_0043141 3300049573 Bacteria 3315
2 MBSR1b_contig_1603956 2162886012 Unclassified 2017
3 JGI24752J21851_1000164 3300001976 Bacteria 9131
4 JGI24743J22301_10001045 3300001991 Bacteria 3657
5 rootH2_10288236 3300003320 Bacteria 4705
6 Ga0065715_10002542 3300005293 Bacteria 7040
7 Ga0065715_10151890 3300005293 Unclassified 1719
8 Ga0070676_10013306 3300005328 Bacteria 4508
9 Ga0070683_100000165 3300005329 Bacteria 43737
10 Ga0070683_100071771 3300005329 Viruses 3231
11 Ga0070683_100235207 3300005329 Bacteria 1742
12 Ga0070690_100000609 3300005330 Bacteria 18087
13 Ga0070690_100008907 3300005330 Bacteria 5795
14 Ga0070670_100011562 3300005331 Bacteria 7546
15 Ga0070677_10003319 3300005333 Bacteria 5182
16 Ga0068869_100001978 3300005334 Bacteria 12300
17 Ga0070666_10017234 3300005335 Bacteria 4629
18 Ga0070666_10028659 3300005335 Bacteria 3655
19 Ga0068868_100000907 3300005338 Bacteria 20145
20 Ga0068868_100034675 3300005338 Bacteria 3897
21 Ga0070689_100055181 3300005340 Bacteria 3078
22 Ga0070661_100067707 3300005344 Bacteria 2624
23 Ga0070668_100090984 3300005347 Bacteria 2405
24 Ga0070675_100108515 3300005354 Bacteria 2344
25 Ga0070671_100029991 3300005355 Bacteria 4488
26 Ga0070673_100133272 3300005364 Bacteria 2088
27 Ga0070673_100183934 3300005364 Bacteria 1790
28 Ga0070688_100068298 3300005365 Unclassified 2266
29 Ga0070667_100000649 3300005367 Bacteria 33783
30 Ga0070667_100001610 3300005367 Bacteria 20204
31 Ga0070711_100020559 3300005439 Unclassified 4256
32 Ga0070663_100012725 3300005455 Bacteria 5333
33 Ga0068867_100005287 3300005459 Bacteria 9119
34 Ga0068867_100011712 3300005459 Bacteria 6192
35 Ga0070706_100036627 3300005467 Bacteria 4532
36 Ga0070706_100050500 3300005467 Bacteria 3838
37 Ga0070706_100055707 3300005467 Bacteria 3650
38 Ga0070707_100010483 3300005468 Bacteria 8633
39 Ga0070707_100019862 3300005468 Bacteria 6333
40 Ga0070707_100360958 3300005468 Bacteria 1411
41 Ga0070698_100010245 3300005471 Bacteria 10011
42 Ga0070698_100095153 3300005471 Bacteria 2957
43 Ga0070698_100140080 3300005471 Unclassified 2371
44 Ga0070698_100314143 3300005471 Bacteria 1498
45 Ga0070699_100033089 3300005518 Bacteria 4466
46 Ga0070684_100000723 3300005535 Bacteria 22865
47 Ga0070684_100002162 3300005535 Bacteria 14515
48 Ga0070697_100118366 3300005536 Bacteria 2213
49 Ga0068853_100009833 3300005539 Bacteria 7718
50 Ga0070672_100029946 3300005543 Bacteria 4086
51 Ga0070693_100075533 3300005547 Bacteria 1996
52 Ga0070665_100003627 3300005548 Bacteria 16353
53 Ga0068855_100000812 3300005563 Bacteria 38659
54 Ga0070664_100011510 3300005564 Bacteria 7180
55 Ga0068857_100000209 3300005577 Bacteria 38288
56 Ga0068857_100000455 3300005577 Bacteria 29204
57 Ga0068857_100152919 3300005577 Bacteria 2091
58 Ga0068857_100244898 3300005577 Bacteria 1642
59 Ga0068856_100000468 3300005614 Bacteria 44570
60 Ga0068852_100000009 3300005616 Bacteria 149600
61 Ga0068852_100023112 3300005616 Bacteria 4998
62 Ga0068852_100049335 3300005616 Unclassified 3601
63 Ga0068852_100059319 3300005616 Bacteria 3318
64 Ga0068859_100001114 3300005617 Bacteria 27429
65 Ga0068866_10000923 3300005718 Bacteria 12883
66 Ga0068851_10004613 3300005834 Bacteria 6218
67 Ga0068851_10015797 3300005834 Archaea 3603
68 Ga0068851_10024796 3300005834 Bacteria 2938
69 Ga0068863_100001301 3300005841 Bacteria 24904
70 Ga0068863_100208609 3300005841 Bacteria 1881
71 Ga0068858_100009072 3300005842 Bacteria 9512
72 Ga0068860_100008994 3300005843 Bacteria 9946
73 Ga0068862_100008910 3300005844 Bacteria 8307
74 Ga0081455_10004873 3300005937 Bacteria 14884
75 Ga0070717_10001203 3300006028 Bacteria 17530
76 Ga0070716_100112454 3300006173 Unclassified 1690
77 Ga0097621_100002097 3300006237 Bacteria 13662
78 Ga0097621_100036945 3300006237 Bacteria 3910
79 Ga0068871_100000778 3300006358 Bacteria 21454
80 Ga0075428_100011213 3300006844 Bacteria 9974
81 Ga0075428_100028183 3300006844 Bacteria 6212
82 Ga0075428_100036603 3300006844 Bacteria 5404
83 Ga0075431_100012030 3300006847 Bacteria 8732
84 Ga0075431_100015592 3300006847 Bacteria 7702
85 Ga0075434_100024952 3300006871 Bacteria 5847
86 Ga0075429_100041853 3300006880 Unclassified 3988
87 Ga0068865_100003760 3300006881 Bacteria 9104
88 Ga0075436_100008783 3300006914 Bacteria 6908
89 Ga0097620_100001114 3300006931 Bacteria 27429
90 Ga0099794_10016486 3300007265 Bacteria 3276
91 Ga0099795_10004532 3300007788 Unclassified 3597
92 Ga0105250_10026191 3300009092 Bacteria 2349
93 Ga0105240_10000148 3300009093 Bacteria 142265
94 Ga0105240_10000566 3300009093 Bacteria 68552
95 Ga0105240_10009006 3300009093 Bacteria 14182
96 Ga0111539_10016214 3300009094 Bacteria 9242
97 Ga0111539_10144829 3300009094 Bacteria 2781
98 Ga0105245_10001898 3300009098 Bacteria 18994
99 Ga0105245_10008479 3300009098 Bacteria 8972
100 Ga0105245_10023247 3300009098 Bacteria 5442
101 Ga0105247_10001580 3300009101 Bacteria 16166
102 Ga0114129_10001194 3300009147 Bacteria 34510
103 Ga0114129_10009403 3300009147 Bacteria 13931
104 Ga0114129_10041142 3300009147 Bacteria 6514
105 Ga0114129_10081682 3300009147 Bacteria 4492
106 Ga0114129_10235487 3300009147 Unclassified 2464
107 Ga0105241_10000183 3300009174 Bacteria 46939
108 Ga0105241_10163194 3300009174 Unclassified 1834
109 Ga0105242_10011784 3300009176 Bacteria 6729
110 Ga0105242_10016087 3300009176 Bacteria 5811
111 Ga0105237_10000792 3300009545 Bacteria 43244
112 Ga0105237_10031332 3300009545 Bacteria 5393
113 Ga0105238_10000138 3300009551 Bacteria 80733
114 Ga0105238_10070781 3300009551 Viruses 3486
115 Ga0105249_10035999 3300009553 Bacteria 4490
116 Ga0105249_10135012 3300009553 Unclassified 2360
117 Ga0105239_10024371 3300010375 Bacteria 6666
118 Ga0105246_10002101 3300011119 Bacteria 12010
119 Ga0105246_10082022 3300011119 Bacteria 2300
120 Ga0157373_10000563 3300013100 Bacteria 28917
121 Ga0157370_10000059 3300013104 Bacteria 116740
122 Ga0157369_10000035 3300013105 Bacteria 191300
123 Ga0157369_10006128 3300013105 Bacteria 13955
124 Ga0157369_10009928 3300013105 Bacteria 10878
125 Ga0157369_10123489 3300013105 Viruses 2746
126 Ga0157374_10002762 3300013296 Bacteria 14730
127 Ga0157374_10061211 3300013296 Bacteria 3525
128 Ga0157374_10211991 3300013296 Bacteria 1899
129 Ga0157378_10001011 3300013297 Bacteria 25732
130 Ga0157378_10001346 3300013297 Bacteria 22091
131 Ga0163162_10011750 3300013306 Bacteria 8540
132 Ga0163162_10027660 3300013306 Bacteria 5609
133 Ga0157372_10000049 3300013307 Bacteria 142350
134 Ga0157372_10007908 3300013307 Bacteria 11302
135 Ga0157372_10010627 3300013307 Bacteria 9794
136 Ga0157372_10057758 3300013307 Unclassified 4338
137 Ga0157375_10000865 3300013308 Bacteria 26369
138 Ga0157375_10688104 3300013308 Bacteria 1177
139 Ga0163163_10001110 3300014325 Bacteria 22870
140 Ga0163163_10002036 3300014325 Bacteria 17086
141 Ga0157380_10010632 3300014326 Bacteria 6625
142 Ga0157380_10045327 3300014326 Bacteria 3450
143 Ga0157379_10000283 3300014968 Bacteria 40188
144 Ga0157379_10117379 3300014968 Bacteria 2393
145 Ga0157376_10000185 3300014969 Bacteria 43045
146 Ga0157376_10225411 3300014969 Bacteria 1738
147 Ga0163161_10004570 3300017792 Bacteria 9635
148 Ga0213872_10041346 3300021361 Unclassified 2104
149 Ga0207656_10007864 3300025321 Bacteria 3904
150 Ga0207682_10005604 3300025893 Bacteria 5106
151 Ga0207642_10003373 3300025899 Bacteria 5035
152 Ga0207680_10015434 3300025903 Bacteria 3986
153 Ga0207680_10028809 3300025903 Bacteria 3112
154 Ga0207647_10007293 3300025904 Bacteria 8004
155 Ga0207645_10000019 3300025907 Bacteria 110182
156 Ga0207643_10000703 3300025908 Bacteria 20835
157 Ga0207684_10005610 3300025910 Bacteria 11546
158 Ga0207684_10148096 3300025910 Bacteria 2019
159 Ga0207654_10000169 3300025911 Bacteria 41423
160 Ga0207654_10000443 3300025911 Bacteria 23616
161 Ga0207695_10000105 3300025913 Bacteria 254764
162 Ga0207695_10003238 3300025913 Bacteria 23182
163 Ga0207695_10076980 3300025913 Unclassified 3390
164 Ga0207671_10000162 3300025914 Bacteria 103793
165 Ga0207663_10051217 3300025916 Unclassified 2570
166 Ga0207657_10000984 3300025919 Bacteria 30219
167 Ga0207649_10010814 3300025920 Bacteria 5017
168 Ga0207646_10000612 3300025922 Bacteria 46474
169 Ga0207646_10039801 3300025922 Bacteria 4230
170 Ga0207694_10001734 3300025924 Bacteria 18280
171 Ga0207694_10084552 3300025924 Bacteria 2496
172 Ga0207650_10000024 3300025925 Bacteria 299184
173 Ga0207659_10039230 3300025926 Bacteria 3301
174 Ga0207659_10069577 3300025926 Bacteria 2564
175 Ga0207706_10000258 3300025933 Bacteria 57913
176 Ga0207686_10025753 3300025934 Bacteria 3426
177 Ga0207665_10153749 3300025939 Bacteria 1650
178 Ga0207689_10000216 3300025942 Bacteria 51024
179 Ga0207689_10000786 3300025942 Bacteria 30447
180 Ga0207661_10005946 3300025944 Bacteria 8613
181 Ga0207661_10017421 3300025944 Bacteria 5317
182 Ga0207661_10082610 3300025944 Bacteria 2656
183 Ga0207679_10024081 3300025945 Bacteria 4171
184 Ga0207667_10011838 3300025949 Bacteria 10103
185 Ga0207651_10157233 3300025960 Unclassified 1777
186 Ga0207640_10100942 3300025981 Bacteria 2023
187 Ga0207658_10001155 3300025986 Bacteria 21133
188 Ga0207658_10009427 3300025986 Bacteria 6620
189 Ga0207658_10009654 3300025986 Bacteria 6546
190 Ga0207677_10013063 3300026023 Bacteria 4798
191 Ga0207703_10106676 3300026035 Bacteria 2383
192 Ga0207678_10001103 3300026067 Bacteria 24752
193 Ga0207678_10008016 3300026067 Bacteria 9313
194 Ga0207702_10022062 3300026078 Bacteria 5274
195 Ga0207702_10028723 3300026078 Unclassified 4624
196 Ga0207648_10000031 3300026089 Bacteria 129124
197 Ga0207648_10095274 3300026089 Bacteria 2603
198 Ga0207676_10003196 3300026095 Bacteria 11668
199 Ga0207676_10177183 3300026095 Bacteria 1863
200 Ga0207674_10000150 3300026116 Bacteria 81671
201 Ga0207674_10034370 3300026116 Bacteria 5300
202 Ga0207683_10001194 3300026121 Bacteria 23507
203 Ga0207698_10000020 3300026142 Bacteria 139630
204 Ga0207698_10044711 3300026142 Bacteria 3330
205 Ga0207698_10062468 3300026142 Unclassified 2909
206 Ga0268266_10012285 3300028379 Bacteria 7409
207 Ga0268266_10021965 3300028379 Bacteria 5439
208 Ga0268264_10004617 3300028381 Bacteria 11706
209 Ga0265319_1001542 3300028563 Bacteria 13611
210 Ga0265318_10005759 3300028577 Bacteria 5792
211 Ga0265760_10003451 3300031090 Bacteria 4587
212 Ga0265330_10009383 3300031235 Bacteria 4652
213 Ga0265325_10022457 3300031241 Unclassified 3456
214 Ga0265340_10036692 3300031247 Bacteria 2429
215 Ga0265339_10005415 3300031249 Bacteria 8503
216 Ga0265339_10017640 3300031249 Bacteria 4222
217 Ga0265327_10000700 3300031251 Bacteria 53289
218 Ga0265316_10002063 3300031344 Bacteria 21156
219 Ga0265316_10143723 3300031344 Bacteria 1790
220 Ga0265313_10001858 3300031595 Bacteria 19223
221 Ga0265313_10001967 3300031595 Bacteria 18576
222 Ga0265342_10002794 3300031712 Bacteria 14771
223 Ga0265342_10011207 3300031712 Bacteria 6153
224 Ga0395905_0031281 3300037471 Bacteria 5012
225 Ga0436364_0248631 3300037853 Unclassified 3486
226 Ga0436360_1335744 3300039438 Unclassified 3583
227 Ga0436361_1001859 3300039447 Unclassified 3527
228 Ga0436361_1153682 3300039447 Unclassified 2076
229 Ga0451577_0000869 3300042876 Bacteria 44966
230 Ga0451577_0038992 3300042876 Bacteria 4270
231 Ga0453683_0000615 3300044673 Bacteria 38982
232 Ga0466964_0023854 3300044706 Bacteria 2381
233 Ga0453684_0097062 3300044712 Bacteria 3618
234 Ga0451576_0005420 3300045051 Bacteria 16020
235 Ga0451576_0068116 3300045051 Unclassified 3704
236 Ga0451576_0180935 3300045051 Bacteria 2201
237 Ga0496104_0432804 3300048907 Bacteria 1227
238 Ga0496107_0239829 3300048910 Unclassified 1349
239 Ga0496108_0000601 3300048911 Bacteria 28241
240 Ga0496109_0000600 3300048912 Bacteria 30126
241 Ga0496110_0302459 3300048913 Bacteria 1457
242 Ga0496111_0015425 3300048914 Bacteria 5244
243 Ga0496112_0000097 3300048915 Bacteria 56970
244 Ga0496112_0078848 3300048915 Bacteria 3257
245 Ga0496115_0036641 3300048918 Bacteria 3885
246 Ga0496115_0145825 3300048918 Bacteria 1954
247 Ga0496115_0159180 3300048918 Bacteria 1866
248 Ga0501031_0005762 3300049568 Bacteria 8073
249 Ga0501033_0003717 3300049570 Bacteria 12414
250 Ga0501037_0015904 3300049573 Bacteria 5540
251 Ga0501038_0001287 3300049574 Bacteria 22817
252 Ga0501043_0024509 3300049579 Unclassified 4734
253 Ga0501046_0000979 3300049580 Bacteria 27978
254 Ga0501047_0022394 3300049581 Bacteria 6068
255 Ga0501067_0000270 3300049583 Bacteria 28338
256 Ga0501068_0000748 3300049584 Bacteria 16661
257 Ga0501072_0005199 3300049588 Bacteria 9904
258 Ga0501075_0153441 3300049591 Bacteria 1756
259 Ga0501198_000075 3300049649 Bacteria 24596
260 Ga0501222_000089 3300049662 Bacteria 24651
261 Ga0501080_0000166 3300049742 Bacteria 47741
262 Ga0501081_0065103 3300049743 Unclassified 2533
263 Ga0501044_0000471 3300049823 Bacteria 49053
264 nmdc:mga05p37_1434_c1 3300050507 Bacteria 27688
265 nmdc:mga05p37_1957_c1 3300050507 Bacteria 24012
266 nmdc:mga05p37_30873_c1 3300050507 Bacteria 6540
267 nmdc:mga05p37_97696_c1 3300050507 Bacteria 3617
268 nmdc:mga06r32_26021_c1 3300050510 Bacteria 5451
269 nmdc:mga06r32_70083_c1 3300050510 Unclassified 3390
270 nmdc:mga0n895_6048_c1 3300050512 Bacteria 10204
271 nmdc:mga0rr50_2331_c1 3300050513 Bacteria 10667
272 nmdc:mga0a205_99029_c1 3300050515 Bacteria 2814
273 Ga0501082_0000663 3300060353 Bacteria 30284
274 Ga0501037_0043141
275 MBSR1b_contig_1603956
276 JGI24752J21851_1000164
277 JGI24743J22301_10001045
278 rootH2_10288236
279 Ga0065715_10002542
280 Ga0065715_10151890
281 Ga0070676_10013306
282 Ga0070683_100000165
283 Ga0070683_100071771
284 Ga0070683_100235207
285 Ga0070690_100000609
286 Ga0070690_100008907
287 Ga0070670_100011562
288 Ga0070677_10003319
289 Ga0068869_100001978
290 Ga0070666_10017234
291 Ga0070666_10028659
292 Ga0068868_100000907
293 Ga0068868_100034675
294 Ga0070689_100055181
295 Ga0070661_100067707
296 Ga0070668_100090984
297 Ga0070675_100108515
298 Ga0070671_100029991
299 Ga0070673_100133272
300 Ga0070673_100183934
301 Ga0070688_100068298
302 Ga0070667_100000649
303 Ga0070667_100001610
304 Ga0070711_100020559
305 Ga0070663_100012725
306 Ga0068867_100005287
307 Ga0068867_100011712
308 Ga0070706_100036627
309 Ga0070706_100050500
310 Ga0070706_100055707
311 Ga0070707_100010483
312 Ga0070707_100019862
313 Ga0070707_100360958
314 Ga0070698_100010245
315 Ga0070698_100095153
316 Ga0070698_100140080
317 Ga0070698_100314143
318 Ga0070699_100033089
319 Ga0070684_100000723
320 Ga0070684_100002162
321 Ga0070697_100118366
322 Ga0068853_100009833
323 Ga0070672_100029946
324 Ga0070693_100075533
325 Ga0070665_100003627
326 Ga0068855_100000812
327 Ga0070664_100011510
328 Ga0068857_100000209
329 Ga0068857_100000455
330 Ga0068857_100152919
331 Ga0068857_100244898
332 Ga0068856_100000468
333 Ga0068852_100000009
334 Ga0068852_100023112
335 Ga0068852_100049335
336 Ga0068852_100059319
337 Ga0068859_100001114
338 Ga0068866_10000923
339 Ga0068851_10004613
340 Ga0068851_10015797
341 Ga0068851_10024796
342 Ga0068863_100001301
343 Ga0068863_100208609
344 Ga0068858_100009072
345 Ga0068860_100008994
346 Ga0068862_100008910
347 Ga0081455_10004873
348 Ga0070717_10001203
349 Ga0070716_100112454
350 Ga0097621_100002097
351 Ga0097621_100036945
352 Ga0068871_100000778
353 Ga0075428_100011213
354 Ga0075428_100028183
355 Ga0075428_100036603
356 Ga0075431_100012030
357 Ga0075431_100015592
358 Ga0075434_100024952
359 Ga0075429_100041853
360 Ga0068865_100003760
361 Ga0075436_100008783
362 Ga0097620_100001114
363 Ga0099794_10016486
364 Ga0099795_10004532
365 Ga0105250_10026191
366 Ga0105240_10000148
367 Ga0105240_10000566
368 Ga0105240_10009006
369 Ga0111539_10016214
370 Ga0111539_10144829
371 Ga0105245_10001898
372 Ga0105245_10008479
373 Ga0105245_10023247
374 Ga0105247_10001580
375 Ga0114129_10001194
376 Ga0114129_10009403
377 Ga0114129_10041142
378 Ga0114129_10081682
379 Ga0114129_10235487
380 Ga0105241_10000183
381 Ga0105241_10163194
382 Ga0105242_10011784
383 Ga0105242_10016087
384 Ga0105237_10000792
385 Ga0105237_10031332
386 Ga0105238_10000138
387 Ga0105238_10070781
388 Ga0105249_10035999
389 Ga0105249_10135012
390 Ga0105239_10024371
391 Ga0105246_10002101
392 Ga0105246_10082022
393 Ga0157373_10000563
394 Ga0157370_10000059
395 Ga0157369_10000035
396 Ga0157369_10006128
397 Ga0157369_10009928
398 Ga0157369_10123489
399 Ga0157374_10002762
400 Ga0157374_10061211
401 Ga0157374_10211991
402 Ga0157378_10001011
403 Ga0157378_10001346
404 Ga0163162_10011750
405 Ga0163162_10027660
406 Ga0157372_10000049
407 Ga0157372_10007908
408 Ga0157372_10010627
409 Ga0157372_10057758
410 Ga0157375_10000865
411 Ga0157375_10688104
412 Ga0163163_10001110
413 Ga0163163_10002036
414 Ga0157380_10010632
415 Ga0157380_10045327
416 Ga0157379_10000283
417 Ga0157379_10117379
418 Ga0157376_10000185
419 Ga0157376_10225411
420 Ga0163161_10004570
421 Ga0213872_10041346
422 Ga0207656_10007864
423 Ga0207682_10005604
424 Ga0207642_10003373
425 Ga0207680_10015434
426 Ga0207680_10028809
427 Ga0207647_10007293
428 Ga0207645_10000019
429 Ga0207643_10000703
430 Ga0207684_10005610
431 Ga0207684_10148096
432 Ga0207654_10000169
433 Ga0207654_10000443
434 Ga0207695_10000105
435 Ga0207695_10003238
436 Ga0207695_10076980
437 Ga0207671_10000162
438 Ga0207663_10051217
439 Ga0207657_10000984
440 Ga0207649_10010814
441 Ga0207646_10000612
442 Ga0207646_10039801
443 Ga0207694_10001734
444 Ga0207694_10084552
445 Ga0207650_10000024
446 Ga0207659_10039230
447 Ga0207659_10069577
448 Ga0207706_10000258
449 Ga0207686_10025753
450 Ga0207665_10153749
451 Ga0207689_10000216
452 Ga0207689_10000786
453 Ga0207661_10005946
454 Ga0207661_10017421
455 Ga0207661_10082610
456 Ga0207679_10024081
457 Ga0207667_10011838
458 Ga0207651_10157233
459 Ga0207640_10100942
460 Ga0207658_10001155
461 Ga0207658_10009427
462 Ga0207658_10009654
463 Ga0207677_10013063
464 Ga0207703_10106676
465 Ga0207678_10001103
466 Ga0207678_10008016
467 Ga0207702_10022062
468 Ga0207702_10028723
469 Ga0207648_10000031
470 Ga0207648_10095274
471 Ga0207676_10003196
472 Ga0207676_10177183
473 Ga0207674_10000150
474 Ga0207674_10034370
475 Ga0207683_10001194
476 Ga0207698_10000020
477 Ga0207698_10044711
478 Ga0207698_10062468
479 Ga0268266_10012285
480 Ga0268266_10021965
481 Ga0268264_10004617
482 Ga0265319_1001542
483 Ga0265318_10005759
484 Ga0265760_10003451
485 Ga0265330_10009383
486 Ga0265325_10022457
487 Ga0265340_10036692
488 Ga0265339_10005415
489 Ga0265339_10017640
490 Ga0265327_10000700
491 Ga0265316_10002063
492 Ga0265316_10143723
493 Ga0265313_10001858
494 Ga0265313_10001967
495 Ga0265342_10002794
496 Ga0265342_10011207
497 Ga0395905_0031281
498 Ga0436364_0248631
499 Ga0436360_1335744
500 Ga0436361_1001859
501 Ga0436361_1153682
502 Ga0451577_0000869
503 Ga0451577_0038992
504 Ga0453683_0000615
505 Ga0466964_0023854
506 Ga0453684_0097062
507 Ga0451576_0005420
508 Ga0451576_0068116
509 Ga0451576_0180935
510 Ga0496104_0432804
511 Ga0496107_0239829
512 Ga0496108_0000601
513 Ga0496109_0000600
514 Ga0496110_0302459
515 Ga0496111_0015425
516 Ga0496112_0000097
517 Ga0496112_0078848
518 Ga0496115_0036641
519 Ga0496115_0145825
520 Ga0496115_0159180
521 Ga0501031_0005762
522 Ga0501033_0003717
523 Ga0501037_0015904
524 Ga0501038_0001287
525 Ga0501043_0024509
526 Ga0501046_0000979
527 Ga0501047_0022394
528 Ga0501067_0000270
529 Ga0501068_0000748
530 Ga0501072_0005199
531 Ga0501075_0153441
532 Ga0501198_000075
533 Ga0501222_000089
534 Ga0501080_0000166
535 Ga0501081_0065103
536 Ga0501044_0000471
537 nmdc:mga05p37_1434_c1
538 nmdc:mga05p37_1957_c1
539 nmdc:mga05p37_30873_c1
540 nmdc:mga05p37_97696_c1
541 nmdc:mga06r32_26021_c1
542 nmdc:mga06r32_70083_c1
543 nmdc:mga0n895_6048_c1
544 nmdc:mga0rr50_2331_c1
545 nmdc:mga0a205_99029_c1
546 Ga0501082_0000663

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zhb-assembly1.cif.gz_A structure of cellobiose 2-epimerase from bacillus thermoamylovorans b4167 0.7486 80 403
5zhb-assembly2.cif.gz_B structure of cellobiose 2-epimerase from bacillus thermoamylovorans b4167 0.7454 80 403
6i01-assembly1.cif.gz_A structure of human d-glucuronyl c5 epimerase in complex with substrate 0.7449 104 298
7d5g-assembly1.cif.gz_A crystal structure of the csce with ligand to have a insight into the catalytic mechanism 0.7416 80 401
7nl5-assembly1.cif.gz_A structure of the catalytic domain of the bacillus circulans alpha-1,6 mannanase in complex with an alpha-1,6-alpha-manno-cyclophellitol trisaccharide inhibitor 0.7342 70 395
ID Description Score Start End Superfamily
af_Q58528_66_303_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.7409 79 291 1.50.10.10
4z4lA00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.7308 80 401 1.50.10.10
5zigD00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.7207 80 401 1.50.10.10
4mu9B00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.7201 87 400 1.50.10.20
1r76A00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.7197 213 356 1.50.10.20
ID Description Score Start End GO Terms
AF-A0A2V9SEK0-F1-model_v4 Glycoamylase-like domain-containing protein 0.9888 10 247 GO:0005975
AF-A0A2V8ZZY7-F1-model_v4 Delta-aminolevulinic acid dehydratase 0.9867 1 295 GO:0005975
AF-A0A2V9NWZ8-F1-model_v4 Uncharacterized protein 0.9855 2 188 GO:0005975
AF-A0A1Q6VER7-F1-model_v4 Delta-aminolevulinic acid dehydratase 0.9854 6 402 GO:0005975
AF-A0A2V6JAE9-F1-model_v4 Delta-aminolevulinic acid dehydratase 0.9849 4 400 GO:0005975

Map