F379286

General Info

Members Datasets Scaffolds Average Seq Length
273 176 546 197

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0484590|Ga0496112_0484590_215_865
Length 216
Sequence MTIAALCRSRDTGPAMSWRIRGTYFESCNCDAICPCRRIDGVGGGRSTHGVCTGALSWLIKEGEADGVDLAGLPVALACRYSDDEPGSPWTWVLYLDQRASAVQREALEAIYTGRLGGDAEKHFPWAWKASELVAVRSVEIDVDHTRRRQWLLIRNHASVRIRDRYAGAETVTCVIPGHDREGEELVTDELRIDDGPLAFSYRGVCGYGSTFDYAG

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
116 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
124 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
143 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
169 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 8.42
Rhizosphere 90.48
Stem 0
Stem Tuber 0
Unclassified 7.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0484590 3300048915 Bacteria 1173
2 JGI25406J46586_10003226 3300003203 Bacteria 7674
3 Ga0070683_100022478 3300005329 Bacteria 5635
4 Ga0070683_100178574 3300005329 Bacteria 2015
5 Ga0070690_100701673 3300005330 Unclassified 777
6 Ga0070680_100039685 3300005336 Bacteria 3809
7 Ga0068868_100025844 3300005338 Bacteria 4470
8 Ga0070660_100034353 3300005339 Bacteria 3831
9 Ga0070660_100354423 3300005339 Unclassified 1209
10 Ga0070689_100007094 3300005340 Bacteria 7804
11 Ga0070691_10061390 3300005341 Bacteria 1808
12 Ga0070668_100033813 3300005347 Bacteria 3895
13 Ga0070668_100084897 3300005347 Bacteria 2488
14 Ga0070668_100990768 3300005347 Bacteria 755
15 Ga0070669_100085646 3300005353 Bacteria 2353
16 Ga0070674_100009346 3300005356 Bacteria 5869
17 Ga0070674_100676381 3300005356 Bacteria 880
18 Ga0070673_100114418 3300005364 Bacteria 2242
19 Ga0070659_100012352 3300005366 Bacteria 6329
20 Ga0070667_100002017 3300005367 Bacteria 17988
21 Ga0070703_10025705 3300005406 Unclassified 1748
22 Ga0070714_100010161 3300005435 Bacteria 7429
23 Ga0070714_100102728 3300005435 Bacteria 2521
24 Ga0070714_100278343 3300005435 Bacteria 1554
25 Ga0070713_100105251 3300005436 Bacteria 2451
26 Ga0070710_10046005 3300005437 Bacteria 2428
27 Ga0070711_100014741 3300005439 Bacteria 4933
28 Ga0070711_100058770 3300005439 Bacteria 2667
29 Ga0070705_100079880 3300005440 Bacteria 2005
30 Ga0070705_100128812 3300005440 Unclassified 1647
31 Ga0070705_100405414 3300005440 Unclassified 1011
32 Ga0070700_100175189 3300005441 Unclassified 1488
33 Ga0070700_100389160 3300005441 Bacteria 1045
34 Ga0070700_100474529 3300005441 Bacteria 957
35 Ga0070663_100045336 3300005455 Bacteria 3106
36 Ga0070662_100761908 3300005457 Bacteria 821
37 Ga0070681_10028076 3300005458 Bacteria 5657
38 Ga0068867_100058728 3300005459 Bacteria 2850
39 Ga0070685_10005403 3300005466 Bacteria 6471
40 Ga0070707_100035191 3300005468 Bacteria 4777
41 Ga0070699_100023441 3300005518 Bacteria 5316
42 Ga0070679_100287259 3300005530 Bacteria 1597
43 Ga0070679_100365753 3300005530 Bacteria 1390
44 Ga0070679_100858707 3300005530 Bacteria 851
45 Ga0070684_100059358 3300005535 Bacteria 3344
46 Ga0070684_100154073 3300005535 Bacteria 2083
47 Ga0070684_100225324 3300005535 Bacteria 1711
48 Ga0070684_100628926 3300005535 Bacteria 999
49 Ga0070686_100498218 3300005544 Unclassified 945
50 Ga0070695_100544111 3300005545 Unclassified 904
51 Ga0070665_100427307 3300005548 Bacteria 1334
52 Ga0068855_100184741 3300005563 Bacteria 2355
53 Ga0070664_100054235 3300005564 Bacteria 3401
54 Ga0068857_100157493 3300005577 Bacteria 2060
55 Ga0068854_100032315 3300005578 Bacteria 3641
56 Ga0068854_100377623 3300005578 Bacteria 1167
57 Ga0068856_100669058 3300005614 Bacteria 1059
58 Ga0070702_100002672 3300005615 Bacteria 7786
59 Ga0070702_100171775 3300005615 Unclassified 1411
60 Ga0070702_100325313 3300005615 Bacteria 1073
61 Ga0070702_100460260 3300005615 Bacteria 925
62 Ga0068859_100095394 3300005617 Bacteria 3027
63 Ga0068866_10097499 3300005718 Bacteria 1615
64 Ga0068861_100002065 3300005719 Bacteria 13030
65 Ga0068861_100268477 3300005719 Bacteria 1464
66 Ga0068870_10170282 3300005840 Bacteria 1299
67 Ga0081455_10022049 3300005937 Bacteria 5962
68 Ga0081455_10499903 3300005937 Unclassified 817
69 Ga0081538_10038242 3300005981 Bacteria 3099
70 Ga0081539_10001866 3300005985 Bacteria 33101
71 Ga0070717_10004282 3300006028 Bacteria 10287
72 Ga0075365_10033066 3300006038 Bacteria 3330
73 Ga0070712_100009820 3300006175 Bacteria 6031
74 Ga0070712_100181468 3300006175 Bacteria 1640
75 Ga0097621_100147191 3300006237 Bacteria 2017
76 Ga0097621_100175443 3300006237 Unclassified 1850
77 Ga0075433_10086926 3300006852 Unclassified 2761
78 Ga0075433_10832357 3300006852 Unclassified 806
79 Ga0068865_100016724 3300006881 Bacteria 4700
80 Ga0075436_100019839 3300006914 Bacteria 4610
81 Ga0097620_100095392 3300006931 Bacteria 3027
82 Ga0075435_100206384 3300007076 Bacteria 1666
83 Ga0105240_10014787 3300009093 Bacteria 10639
84 Ga0105240_11607113 3300009093 Bacteria 680
85 Ga0111539_10208861 3300009094 Bacteria 2275
86 Ga0105245_10007259 3300009098 Bacteria 9706
87 Ga0114129_10239590 3300009147 Bacteria 2439
88 Ga0105243_10008484 3300009148 Bacteria 7889
89 Ga0105242_10108578 3300009176 Bacteria 2362
90 Ga0105248_10522747 3300009177 Bacteria 1338
91 Ga0105249_10096459 3300009553 Bacteria 2774
92 Ga0105249_10375658 3300009553 Bacteria 1446
93 Ga0105246_10027421 3300011119 Bacteria 3731
94 Ga0105246_10094463 3300011119 Bacteria 2163
95 Ga0157370_10054213 3300013104 Bacteria 3822
96 Ga0163162_10640970 3300013306 Bacteria 1187
97 Ga0157372_10139918 3300013307 Bacteria 2788
98 Ga0157375_10336825 3300013308 Unclassified 1674
99 Ga0157380_10142301 3300014326 Bacteria 2062
100 Ga0182008_10079016 3300014497 Bacteria 1618
101 Ga0157377_10165034 3300014745 Bacteria 1380
102 Ga0157377_10296572 3300014745 Bacteria 1065
103 Ga0157377_10349709 3300014745 Bacteria 991
104 Ga0163161_10104193 3300017792 Bacteria 2114
105 Ga0197907_10051968 3300020069 Bacteria 864
106 Ga0206353_11353944 3300020082 Bacteria 1745
107 Ga0207688_10029716 3300025901 Bacteria 3010
108 Ga0207688_10083438 3300025901 Bacteria 1827
109 Ga0207647_10261449 3300025904 Bacteria 991
110 Ga0207699_10064596 3300025906 Bacteria 2215
111 Ga0207705_10158280 3300025909 Bacteria 1700
112 Ga0207707_10353804 3300025912 Bacteria 1265
113 Ga0207695_10195656 3300025913 Bacteria 1938
114 Ga0207693_10000575 3300025915 Bacteria 33031
115 Ga0207663_10025676 3300025916 Bacteria 3409
116 Ga0207663_10400117 3300025916 Bacteria 1050
117 Ga0207660_10405217 3300025917 Bacteria 1099
118 Ga0207662_10161191 3300025918 Bacteria 1433
119 Ga0207657_10019140 3300025919 Bacteria 6510
120 Ga0207657_10025161 3300025919 Bacteria 5494
121 Ga0207652_10100115 3300025921 Bacteria 2558
122 Ga0207652_10314643 3300025921 Bacteria 1413
123 Ga0207687_10016145 3300025927 Bacteria 4902
124 Ga0207700_10595727 3300025928 Bacteria 983
125 Ga0207664_10237999 3300025929 Bacteria 1584
126 Ga0207664_11076430 3300025929 Bacteria 719
127 Ga0207690_10047966 3300025932 Bacteria 2837
128 Ga0207686_10019912 3300025934 Bacteria 3826
129 Ga0207709_10006303 3300025935 Bacteria 6659
130 Ga0207709_10052497 3300025935 Bacteria 2504
131 Ga0207670_10049783 3300025936 Bacteria 2804
132 Ga0207704_10063680 3300025938 Bacteria 2300
133 Ga0207711_10150208 3300025941 Bacteria 2102
134 Ga0207661_10109562 3300025944 Bacteria 2333
135 Ga0207661_10121008 3300025944 Bacteria 2228
136 Ga0207661_10340228 3300025944 Bacteria 1352
137 Ga0207679_10049099 3300025945 Bacteria 3077
138 Ga0207667_10213483 3300025949 Bacteria 1978
139 Ga0207667_10557363 3300025949 Bacteria 1159
140 Ga0207668_10055616 3300025972 Bacteria 2752
141 Ga0207668_10922535 3300025972 Bacteria 778
142 Ga0207658_10005771 3300025986 Bacteria 8468
143 Ga0207678_10063336 3300026067 Bacteria 3177
144 Ga0207678_10505696 3300026067 Bacteria 1053
145 Ga0207708_10232331 3300026075 Unclassified 1481
146 Ga0207702_10404315 3300026078 Bacteria 1317
147 Ga0207648_10072706 3300026089 Bacteria 2997
148 Ga0207676_11170313 3300026095 Unclassified 761
149 Ga0207674_10169533 3300026116 Bacteria 2137
150 Ga0207675_100007236 3300026118 Bacteria 10488
151 Ga0207683_10417848 3300026121 Bacteria 1235
152 Ga0207698_10188620 3300026142 Bacteria 1834
153 Ga0268266_10342367 3300028379 Bacteria 1404
154 Ga0307406_10242926 3300031901 Bacteria 1352
155 Ga0307416_100588619 3300032002 Bacteria 1191
156 Ga0307415_100546049 3300032126 Bacteria 1022
157 Ga0307415_100592430 3300032126 Bacteria 985
158 Ga0373928_0014370 3300035084 Unclassified 1600
159 Ga0373941_0096630 3300035115 Bacteria 1022
160 Ga0373925_0411537 3300037068 Bacteria 1104
161 Ga0395899_0159275 3300037312 Bacteria 1596
162 Ga0395900_0120147 3300037418 Bacteria 2696
163 Ga0395898_0019833 3300037466 Bacteria 6838
164 Ga0395898_0310042 3300037466 Bacteria 1505
165 Ga0395898_1214173 3300037466 Unclassified 685
166 Ga0395901_0177435 3300038443 Bacteria 2234
167 Ga0395901_0303041 3300038443 Bacteria 1656
168 Ga0395901_0358899 3300038443 Unclassified 1503
169 Ga0436360_1165532 3300039438 Bacteria 14824
170 Ga0451800_0598466 3300041459 Bacteria 1197
171 Ga0466969_0006707 3300044656 Bacteria 6121
172 Ga0466965_0128954 3300044683 Bacteria 1310
173 Ga0466966_0017356 3300044684 Bacteria 4756
174 Ga0466961_0334058 3300044693 Bacteria 923
175 Ga0466963_0012708 3300044694 Bacteria 5156
176 Ga0466963_0024295 3300044694 Bacteria 3857
177 Ga0466963_0026311 3300044694 Bacteria 3720
178 Ga0466963_0051733 3300044694 Bacteria 2724
179 Ga0466963_0054667 3300044694 Bacteria 2654
180 Ga0466963_0251968 3300044694 Bacteria 1239
181 Ga0466963_0364867 3300044694 Bacteria 1017
182 Ga0466964_0004574 3300044706 Bacteria 5117
183 Ga0466964_0005076 3300044706 Bacteria 4868
184 Ga0466964_0015883 3300044706 Bacteria 2868
185 Ga0466964_0031589 3300044706 Bacteria 2101
186 Ga0466971_0030324 3300044719 Bacteria 2420
187 Ga0466968_0001014 3300044735 Bacteria 9899
188 Ga0466968_0032709 3300044735 Bacteria 2164
189 Ga0466968_0092176 3300044735 Bacteria 1344
190 Ga0466970_0006982 3300044765 Bacteria 5655
191 Ga0466970_0156780 3300044765 Bacteria 1258
192 Ga0466957_0006303 3300044842 Bacteria 6692
193 Ga0466957_0043276 3300044842 Bacteria 2726
194 Ga0466957_0077399 3300044842 Bacteria 2066
195 Ga0466957_0088427 3300044842 Bacteria 1938
196 Ga0466957_0108139 3300044842 Bacteria 1761
197 Ga0466957_0150009 3300044842 Bacteria 1507
198 Ga0466959_0038030 3300045049 Bacteria 3556
199 Ga0466959_0219330 3300045049 Bacteria 1320
200 Ga0466959_0422115 3300045049 Bacteria 905
201 Ga0466958_0000746 3300045836 Bacteria 14259
202 Ga0466958_0009772 3300045836 Bacteria 5352
203 Ga0466958_0021424 3300045836 Bacteria 3777
204 Ga0466958_0239516 3300045836 Bacteria 1159
205 Ga0466958_0438514 3300045836 Unclassified 845
206 Ga0466967_0000751 3300045976 Bacteria 16702
207 Ga0466967_0010800 3300045976 Bacteria 6871
208 Ga0466967_0011213 3300045976 Bacteria 6775
209 Ga0466967_0020951 3300045976 Bacteria 5296
210 Ga0466967_0024293 3300045976 Bacteria 4981
211 Ga0466967_0051696 3300045976 Bacteria 3602
212 Ga0466967_0106962 3300045976 Bacteria 2565
213 Ga0466967_0188840 3300045976 Bacteria 1946
214 Ga0466967_0279345 3300045976 Bacteria 1602
215 Ga0466967_0312375 3300045976 Bacteria 1514
216 Ga0466967_0385825 3300045976 Bacteria 1361
217 Ga0466967_1074741 3300045976 Bacteria 801
218 Ga0466967_1320273 3300045976 Bacteria 718
219 Ga0495641_0043972 3300046461 Bacteria 2064
220 Ga0495641_0071025 3300046461 Bacteria 1563
221 Ga0495653_0043136 3300046463 Bacteria 3509
222 Ga0495584_0080044 3300046491 Bacteria 1644
223 Ga0495608_0222239 3300046511 Bacteria 1184
224 Ga0495630_0010457 3300046517 Bacteria 6701
225 Ga0495644_0047910 3300046523 Bacteria 1605
226 Ga0495663_0051609 3300046525 Bacteria 1275
227 Ga0495663_0140691 3300046525 Bacteria 819
228 Ga0495652_0412498 3300046529 Bacteria 953
229 Ga0495640_0008429 3300046533 Bacteria 8086
230 Ga0495634_0041449 3300046642 Bacteria 3126
231 Ga0495634_0054312 3300046642 Bacteria 2682
232 Ga0495635_0164055 3300046663 Bacteria 1512
233 Ga0495613_0034737 3300046689 Bacteria 3743
234 Ga0495624_0005650 3300046690 Bacteria 8975
235 Ga0495674_0036106 3300047319 Bacteria 4451
236 Ga0495676_0113776 3300047321 Bacteria 1981
237 Ga0496100_0221107 3300048903 Bacteria 1390
238 Ga0496101_0919224 3300048904 Bacteria 689
239 Ga0496102_0121328 3300048905 Bacteria 2441
240 Ga0496104_0035897 3300048907 Bacteria 4631
241 Ga0496105_0028395 3300048908 Bacteria 4574
242 Ga0496106_0031998 3300048909 Bacteria 3920
243 Ga0496107_0000117 3300048910 Bacteria 38826
244 Ga0496107_0038539 3300048910 Bacteria 3428
245 Ga0496107_0287902 3300048910 Bacteria 1223
246 Ga0496108_0243115 3300048911 Bacteria 1566
247 Ga0496109_0350644 3300048912 Bacteria 1394
248 Ga0496109_0609980 3300048912 Bacteria 1028
249 Ga0496110_0065109 3300048913 Bacteria 3222
250 Ga0496111_0314079 3300048914 Bacteria 1161
251 Ga0496112_0087571 3300048915 Bacteria 3081
252 Ga0496112_0186903 3300048915 Bacteria 2035
253 Ga0496112_0210983 3300048915 Bacteria 1899
254 Ga0496112_0258480 3300048915 Bacteria 1691
255 Ga0496112_0478605 3300048915 Bacteria 1182
256 Ga0496112_0775504 3300048915 Bacteria 884
257 Ga0496115_0109865 3300048918 Bacteria 2264
258 Ga0501067_0039528 3300049583 Bacteria 2619
259 Ga0501068_0284848 3300049584 Bacteria 1056
260 Ga0501069_0061989 3300049585 Bacteria 2088
261 Ga0501072_0721492 3300049588 Bacteria 783
262 nmdc:mga00v17_143826_c1 3300050491 Bacteria 1530
263 nmdc:mga0yw44_14305_c1 3300050492 Bacteria 4211
264 nmdc:mga0n895_15760_c1 3300050512 Bacteria 6909
265 nmdc:mga0rr50_21649_c1 3300050513 Bacteria 4394
266 nmdc:mga08x19_11385_c1 3300050514 Bacteria 5354
267 nmdc:mga0a205_67071_c1 3300050515 Bacteria 3466
268 Ga0495619_0024541 3300053085 Bacteria 3867
269 Ga0495619_0343571 3300053085 Bacteria 1033
270 Ga0501084_0255611 3300054114 Bacteria 1479
271 Ga0466962_0007116 3300061719 Bacteria 5360
272 Ga0466962_0122369 3300061719 Bacteria 1256
273 Ga0466962_0149656 3300061719 Bacteria 1132
274 Ga0496112_0484590
275 JGI25406J46586_10003226
276 Ga0070683_100022478
277 Ga0070683_100178574
278 Ga0070690_100701673
279 Ga0070680_100039685
280 Ga0068868_100025844
281 Ga0070660_100034353
282 Ga0070660_100354423
283 Ga0070689_100007094
284 Ga0070691_10061390
285 Ga0070668_100033813
286 Ga0070668_100084897
287 Ga0070668_100990768
288 Ga0070669_100085646
289 Ga0070674_100009346
290 Ga0070674_100676381
291 Ga0070673_100114418
292 Ga0070659_100012352
293 Ga0070667_100002017
294 Ga0070703_10025705
295 Ga0070714_100010161
296 Ga0070714_100102728
297 Ga0070714_100278343
298 Ga0070713_100105251
299 Ga0070710_10046005
300 Ga0070711_100014741
301 Ga0070711_100058770
302 Ga0070705_100079880
303 Ga0070705_100128812
304 Ga0070705_100405414
305 Ga0070700_100175189
306 Ga0070700_100389160
307 Ga0070700_100474529
308 Ga0070663_100045336
309 Ga0070662_100761908
310 Ga0070681_10028076
311 Ga0068867_100058728
312 Ga0070685_10005403
313 Ga0070707_100035191
314 Ga0070699_100023441
315 Ga0070679_100287259
316 Ga0070679_100365753
317 Ga0070679_100858707
318 Ga0070684_100059358
319 Ga0070684_100154073
320 Ga0070684_100225324
321 Ga0070684_100628926
322 Ga0070686_100498218
323 Ga0070695_100544111
324 Ga0070665_100427307
325 Ga0068855_100184741
326 Ga0070664_100054235
327 Ga0068857_100157493
328 Ga0068854_100032315
329 Ga0068854_100377623
330 Ga0068856_100669058
331 Ga0070702_100002672
332 Ga0070702_100171775
333 Ga0070702_100325313
334 Ga0070702_100460260
335 Ga0068859_100095394
336 Ga0068866_10097499
337 Ga0068861_100002065
338 Ga0068861_100268477
339 Ga0068870_10170282
340 Ga0081455_10022049
341 Ga0081455_10499903
342 Ga0081538_10038242
343 Ga0081539_10001866
344 Ga0070717_10004282
345 Ga0075365_10033066
346 Ga0070712_100009820
347 Ga0070712_100181468
348 Ga0097621_100147191
349 Ga0097621_100175443
350 Ga0075433_10086926
351 Ga0075433_10832357
352 Ga0068865_100016724
353 Ga0075436_100019839
354 Ga0097620_100095392
355 Ga0075435_100206384
356 Ga0105240_10014787
357 Ga0105240_11607113
358 Ga0111539_10208861
359 Ga0105245_10007259
360 Ga0114129_10239590
361 Ga0105243_10008484
362 Ga0105242_10108578
363 Ga0105248_10522747
364 Ga0105249_10096459
365 Ga0105249_10375658
366 Ga0105246_10027421
367 Ga0105246_10094463
368 Ga0157370_10054213
369 Ga0163162_10640970
370 Ga0157372_10139918
371 Ga0157375_10336825
372 Ga0157380_10142301
373 Ga0182008_10079016
374 Ga0157377_10165034
375 Ga0157377_10296572
376 Ga0157377_10349709
377 Ga0163161_10104193
378 Ga0197907_10051968
379 Ga0206353_11353944
380 Ga0207688_10029716
381 Ga0207688_10083438
382 Ga0207647_10261449
383 Ga0207699_10064596
384 Ga0207705_10158280
385 Ga0207707_10353804
386 Ga0207695_10195656
387 Ga0207693_10000575
388 Ga0207663_10025676
389 Ga0207663_10400117
390 Ga0207660_10405217
391 Ga0207662_10161191
392 Ga0207657_10019140
393 Ga0207657_10025161
394 Ga0207652_10100115
395 Ga0207652_10314643
396 Ga0207687_10016145
397 Ga0207700_10595727
398 Ga0207664_10237999
399 Ga0207664_11076430
400 Ga0207690_10047966
401 Ga0207686_10019912
402 Ga0207709_10006303
403 Ga0207709_10052497
404 Ga0207670_10049783
405 Ga0207704_10063680
406 Ga0207711_10150208
407 Ga0207661_10109562
408 Ga0207661_10121008
409 Ga0207661_10340228
410 Ga0207679_10049099
411 Ga0207667_10213483
412 Ga0207667_10557363
413 Ga0207668_10055616
414 Ga0207668_10922535
415 Ga0207658_10005771
416 Ga0207678_10063336
417 Ga0207678_10505696
418 Ga0207708_10232331
419 Ga0207702_10404315
420 Ga0207648_10072706
421 Ga0207676_11170313
422 Ga0207674_10169533
423 Ga0207675_100007236
424 Ga0207683_10417848
425 Ga0207698_10188620
426 Ga0268266_10342367
427 Ga0307406_10242926
428 Ga0307416_100588619
429 Ga0307415_100546049
430 Ga0307415_100592430
431 Ga0373928_0014370
432 Ga0373941_0096630
433 Ga0373925_0411537
434 Ga0395899_0159275
435 Ga0395900_0120147
436 Ga0395898_0019833
437 Ga0395898_0310042
438 Ga0395898_1214173
439 Ga0395901_0177435
440 Ga0395901_0303041
441 Ga0395901_0358899
442 Ga0436360_1165532
443 Ga0451800_0598466
444 Ga0466969_0006707
445 Ga0466965_0128954
446 Ga0466966_0017356
447 Ga0466961_0334058
448 Ga0466963_0012708
449 Ga0466963_0024295
450 Ga0466963_0026311
451 Ga0466963_0051733
452 Ga0466963_0054667
453 Ga0466963_0251968
454 Ga0466963_0364867
455 Ga0466964_0004574
456 Ga0466964_0005076
457 Ga0466964_0015883
458 Ga0466964_0031589
459 Ga0466971_0030324
460 Ga0466968_0001014
461 Ga0466968_0032709
462 Ga0466968_0092176
463 Ga0466970_0006982
464 Ga0466970_0156780
465 Ga0466957_0006303
466 Ga0466957_0043276
467 Ga0466957_0077399
468 Ga0466957_0088427
469 Ga0466957_0108139
470 Ga0466957_0150009
471 Ga0466959_0038030
472 Ga0466959_0219330
473 Ga0466959_0422115
474 Ga0466958_0000746
475 Ga0466958_0009772
476 Ga0466958_0021424
477 Ga0466958_0239516
478 Ga0466958_0438514
479 Ga0466967_0000751
480 Ga0466967_0010800
481 Ga0466967_0011213
482 Ga0466967_0020951
483 Ga0466967_0024293
484 Ga0466967_0051696
485 Ga0466967_0106962
486 Ga0466967_0188840
487 Ga0466967_0279345
488 Ga0466967_0312375
489 Ga0466967_0385825
490 Ga0466967_1074741
491 Ga0466967_1320273
492 Ga0495641_0043972
493 Ga0495641_0071025
494 Ga0495653_0043136
495 Ga0495584_0080044
496 Ga0495608_0222239
497 Ga0495630_0010457
498 Ga0495644_0047910
499 Ga0495663_0051609
500 Ga0495663_0140691
501 Ga0495652_0412498
502 Ga0495640_0008429
503 Ga0495634_0041449
504 Ga0495634_0054312
505 Ga0495635_0164055
506 Ga0495613_0034737
507 Ga0495624_0005650
508 Ga0495674_0036106
509 Ga0495676_0113776
510 Ga0496100_0221107
511 Ga0496101_0919224
512 Ga0496102_0121328
513 Ga0496104_0035897
514 Ga0496105_0028395
515 Ga0496106_0031998
516 Ga0496107_0000117
517 Ga0496107_0038539
518 Ga0496107_0287902
519 Ga0496108_0243115
520 Ga0496109_0350644
521 Ga0496109_0609980
522 Ga0496110_0065109
523 Ga0496111_0314079
524 Ga0496112_0087571
525 Ga0496112_0186903
526 Ga0496112_0210983
527 Ga0496112_0258480
528 Ga0496112_0478605
529 Ga0496112_0775504
530 Ga0496115_0109865
531 Ga0501067_0039528
532 Ga0501068_0284848
533 Ga0501069_0061989
534 Ga0501072_0721492
535 nmdc:mga00v17_143826_c1
536 nmdc:mga0yw44_14305_c1
537 nmdc:mga0n895_15760_c1
538 nmdc:mga0rr50_21649_c1
539 nmdc:mga08x19_11385_c1
540 nmdc:mga0a205_67071_c1
541 Ga0495619_0024541
542 Ga0495619_0343571
543 Ga0501084_0255611
544 Ga0466962_0007116
545 Ga0466962_0122369
546 Ga0466962_0149656

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07040

DUF1326

Protein of unknown function (DUF1326)

26

182

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v1u-assembly1.cif.gz_A heterocyclase in complex with substrate and cofactor 0.641 34 93
4v1t-assembly1.cif.gz_A heterocyclase in complex with substrate and cofactor 0.6347 34 93
4v1v-assembly1.cif.gz_B heterocyclase in complex with substrate and cofactor 0.6335 34 93
4v1v-assembly1.cif.gz_A heterocyclase in complex with substrate and cofactor 0.6315 34 93
7u58-assembly1.cif.gz_A ycao-mediated atp-dependent peptidase activity in ribosomal peptide biosynthesis 0.6203 33 93
ID Description Score Start End Superfamily
af_K7MBR4_388_502_3.40.20.10 Alpha Beta;3-Layer(aba) Sandwich;Severin;Severin 0.5647 54 121 3.40.20.10
af_P28917_100_343_3.90.350.10 Alpha Beta;Alpha-Beta Complex;Transposase Inhibitor Protein From Tn5; Chain A, domain 1;Transposase Inhibitor Protein From Tn5; Chain A, domain 1 0.557 6 79 3.90.350.10
af_Q9P7J0_1_124_3.30.230.100 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.5446 59 87 3.30.230.100
af_O81643_386_498_3.40.20.10 Alpha Beta;3-Layer(aba) Sandwich;Severin;Severin 0.5374 54 132 3.40.20.10
af_O94399_172_307_3.40.20.10 Alpha Beta;3-Layer(aba) Sandwich;Severin;Severin 0.5215 58 121 3.40.20.10
ID Description Score Start End GO Terms
AF-A0A538IRY6-F1-model_v4 DUF1326 domain-containing protein 0.9408 3 131
AF-A0A2V9UUK1-F1-model_v4 DUF1326 domain-containing protein 0.8848 3 70
AF-A0A831X6N9-F1-model_v4 DUF1326 domain-containing protein 0.867 1 103
AF-A0A7W1BJ22-F1-model_v4 DUF1326 domain-containing protein 0.8597 3 103
AF-A0A831X6N9-F1-model_v4 DUF1326 domain-containing protein 0.8513 1 103

Map