F379283

General Info

Members Datasets Scaffolds Average Seq Length
273 153 546 92

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0434085|Ga0496108_0434085_453_761
Length 102
Sequence MKRLGGIVLMAKDQDRIQRGILGDINPEPSGRAKNESEHRDDVDVDVEPSMVGGSRHDRTKHSGSRDVTEGVTGGLGTETGGSRNYRSGTGATGGDIGNRPE

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.87
Metatranscriptomes 5.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 2.2
Rhizosphere 97.44
Stem 0
Stem Tuber 0
Unclassified 21.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0434085 3300048911 Bacteria 1147
2 Ga0006778J45830_1030752 3300003162 Bacteria 543
3 Ga0006777J48905_1025804 3300003308 Bacteria 672
4 Ga0007429J51699_1049849 3300003579 Unclassified 574
5 Ga0058862_10142550 3300004803 Unclassified 911
6 Ga0065704_10182576 3300005289 Unclassified 1229
7 Ga0065715_10078760 3300005293 Bacteria 664
8 Ga0065715_10147637 3300005293 Bacteria 1768
9 Ga0065707_10258039 3300005295 Bacteria 1105
10 Ga0070658_10131283 3300005327 Bacteria 2088
11 Ga0068869_100486664 3300005334 Bacteria 1028
12 Ga0068869_101641457 3300005334 Bacteria 573
13 Ga0070666_10786811 3300005335 Bacteria 700
14 Ga0068868_101056793 3300005338 Unclassified 745
15 Ga0070660_100074380 3300005339 Bacteria 2658
16 Ga0070689_100157344 3300005340 Bacteria 1835
17 Ga0070689_101635804 3300005340 Unclassified 585
18 Ga0070687_100052017 3300005343 Bacteria 2124
19 Ga0070687_100848454 3300005343 Unclassified 651
20 Ga0070692_10569007 3300005345 Bacteria 745
21 Ga0070668_100687786 3300005347 Bacteria 901
22 Ga0070669_100380416 3300005353 Bacteria 1151
23 Ga0070675_100244978 3300005354 Bacteria 1567
24 Ga0070675_101404693 3300005354 Unclassified 644
25 Ga0070671_100004617 3300005355 Bacteria 10923
26 Ga0070674_101251229 3300005356 Unclassified 660
27 Ga0070674_102073674 3300005356 Unclassified 518
28 Ga0070673_100167389 3300005364 Bacteria 1874
29 Ga0070688_100111310 3300005365 Bacteria 1821
30 Ga0070688_100555886 3300005365 Bacteria 873
31 Ga0070667_100006335 3300005367 Bacteria 9836
32 Ga0070700_101590191 3300005441 Bacteria 558
33 Ga0070662_100688251 3300005457 Bacteria 864
34 Ga0070681_11766654 3300005458 Unclassified 545
35 Ga0068867_100767758 3300005459 Unclassified 857
36 Ga0070685_10528450 3300005466 Bacteria 839
37 Ga0070706_100311807 3300005467 Bacteria 1468
38 Ga0070706_101104838 3300005467 Unclassified 730
39 Ga0070707_100246666 3300005468 Bacteria 1738
40 Ga0070707_100276702 3300005468 Bacteria 1632
41 Ga0070707_100726592 3300005468 Unclassified 956
42 Ga0070698_100249256 3300005471 Bacteria 1709
43 Ga0070699_100002362 3300005518 Bacteria 16930
44 Ga0070699_100228813 3300005518 Bacteria 1658
45 Ga0070699_101114064 3300005518 Unclassified 724
46 Ga0070679_100096019 3300005530 Bacteria 2952
47 Ga0070679_100431618 3300005530 Bacteria 1263
48 Ga0070684_101101448 3300005535 Unclassified 746
49 Ga0070697_100111981 3300005536 Bacteria 2275
50 Ga0070697_100157120 3300005536 Bacteria 1920
51 Ga0068853_101774999 3300005539 Bacteria 598
52 Ga0070672_100054213 3300005543 Bacteria 3138
53 Ga0070686_100001890 3300005544 Bacteria 11666
54 Ga0070686_100179585 3300005544 Bacteria 1503
55 Ga0070695_100006178 3300005545 Bacteria 7080
56 Ga0070695_100181696 3300005545 Bacteria 1491
57 Ga0070695_100886636 3300005545 Bacteria 720
58 Ga0070696_101767122 3300005546 Bacteria 534
59 Ga0070704_100000854 3300005549 Bacteria 15212
60 Ga0070704_100747990 3300005549 Bacteria 870
61 Ga0068855_100855149 3300005563 Bacteria 964
62 Ga0068855_101818129 3300005563 Unclassified 619
63 Ga0068857_101750364 3300005577 Bacteria 608
64 Ga0068854_100014216 3300005578 Bacteria 5242
65 Ga0070702_101305782 3300005615 Unclassified 589
66 Ga0068859_100919481 3300005617 Bacteria 959
67 Ga0068859_101622391 3300005617 Bacteria 714
68 Ga0068859_101624752 3300005617 Bacteria 714
69 Ga0068861_100128873 3300005719 Bacteria 2051
70 Ga0068861_101537537 3300005719 Unclassified 654
71 Ga0068861_102488667 3300005719 Unclassified 521
72 Ga0068863_100381322 3300005841 Bacteria 1376
73 Ga0068858_100160446 3300005842 Bacteria 2117
74 Ga0068858_101745271 3300005842 Unclassified 615
75 Ga0068860_100018116 3300005843 Bacteria 6856
76 Ga0068860_100771465 3300005843 Bacteria 974
77 Ga0068860_101368141 3300005843 Bacteria 729
78 Ga0068862_100105189 3300005844 Bacteria 2474
79 Ga0068862_100276255 3300005844 Unclassified 1538
80 Ga0068862_100414879 3300005844 Bacteria 1262
81 Ga0068862_101053730 3300005844 Unclassified 806
82 Ga0081539_10011679 3300005985 Bacteria 6903
83 Ga0075432_10016264 3300006058 Unclassified 2539
84 Ga0070715_10643373 3300006163 Bacteria 627
85 Ga0070716_100121985 3300006173 Bacteria 1633
86 Ga0075366_11079492 3300006195 Unclassified 501
87 Ga0068871_101153793 3300006358 Bacteria 726
88 Ga0075428_100046779 3300006844 Bacteria 4752
89 Ga0075428_102124938 3300006844 Bacteria 580
90 Ga0075430_100593171 3300006846 Bacteria 914
91 Ga0075433_10055434 3300006852 Bacteria 3460
92 Ga0075433_10176621 3300006852 Bacteria 1900
93 Ga0075433_10707599 3300006852 Bacteria 882
94 Ga0075433_11203341 3300006852 Bacteria 657
95 Ga0075433_11665662 3300006852 Bacteria 550
96 Ga0075434_100007000 3300006871 Bacteria 10400
97 Ga0075434_100007006 3300006871 Bacteria 10396
98 Ga0075434_100025979 3300006871 Bacteria 5734
99 Ga0075434_100102882 3300006871 Bacteria 2864
100 Ga0075434_100258738 3300006871 Bacteria 1759
101 Ga0075434_100359503 3300006871 Bacteria 1477
102 Ga0075434_100938348 3300006871 Bacteria 880
103 Ga0075434_101089888 3300006871 Bacteria 812
104 Ga0075434_101631507 3300006871 Unclassified 653
105 Ga0075429_100686931 3300006880 Bacteria 897
106 Ga0075436_100002450 3300006914 Bacteria 12775
107 Ga0075436_100006279 3300006914 Bacteria 8143
108 Ga0075436_100007079 3300006914 Bacteria 7677
109 Ga0075436_100016995 3300006914 Bacteria 4979
110 Ga0075436_100045660 3300006914 Bacteria 3022
111 Ga0075436_100079047 3300006914 Bacteria 2278
112 Ga0075436_100294652 3300006914 Bacteria 1162
113 Ga0075436_100487126 3300006914 Bacteria 901
114 Ga0075436_100607289 3300006914 Bacteria 806
115 Ga0075436_101185947 3300006914 Unclassified 576
116 Ga0097620_100919344 3300006931 Bacteria 959
117 Ga0097620_101622522 3300006931 Bacteria 714
118 Ga0097620_101624854 3300006931 Bacteria 714
119 Ga0075435_100000028 3300007076 Bacteria 82360
120 Ga0075435_100059066 3300007076 Unclassified 3108
121 Ga0075435_101339205 3300007076 Unclassified 627
122 Ga0075435_101379600 3300007076 Bacteria 617
123 Ga0105240_11495645 3300009093 Bacteria 708
124 Ga0111539_10067577 3300009094 Bacteria 4221
125 Ga0111539_10468651 3300009094 Bacteria 1467
126 Ga0105245_12775125 3300009098 Bacteria 543
127 Ga0114129_10001269 3300009147 Bacteria 33716
128 Ga0114129_10006081 3300009147 Bacteria 17110
129 Ga0114129_10016566 3300009147 Bacteria 10497
130 Ga0114129_10247164 3300009147 Bacteria 2396
131 Ga0114129_10353043 3300009147 Bacteria 1947
132 Ga0114129_10369951 3300009147 Bacteria 1895
133 Ga0114129_10430716 3300009147 Bacteria 1733
134 Ga0105243_11247823 3300009148 Unclassified 758
135 Ga0105241_10135917 3300009174 Bacteria 1996
136 Ga0105242_10090823 3300009176 Bacteria 2570
137 Ga0105248_10006769 3300009177 Bacteria 12567
138 Ga0105248_11402386 3300009177 Bacteria 790
139 Ga0105248_11688914 3300009177 Unclassified 718
140 Ga0105238_11013894 3300009551 Bacteria 851
141 Ga0105249_10211730 3300009553 Bacteria 1902
142 Ga0105249_12521970 3300009553 Unclassified 586
143 Ga0157329_1033792 3300012491 Bacteria 544
144 Ga0157374_11028467 3300013296 Bacteria 843
145 Ga0163162_10103004 3300013306 Bacteria 2948
146 Ga0157375_10030934 3300013308 Bacteria 5053
147 Ga0157375_12833141 3300013308 Unclassified 580
148 Ga0157375_13764114 3300013308 Unclassified 504
149 Ga0157380_10370338 3300014326 Bacteria 1348
150 Ga0157380_10457922 3300014326 Bacteria 1227
151 Ga0157377_10129933 3300014745 Bacteria 1537
152 Ga0157379_10064602 3300014968 Bacteria 3271
153 Ga0157376_10062110 3300014969 Bacteria 3143
154 Ga0157376_11051047 3300014969 Unclassified 839
155 Ga0163161_11080792 3300017792 Bacteria 689
156 Ga0197907_10837880 3300020069 Bacteria 655
157 Ga0206356_10106356 3300020070 Bacteria 1045
158 Ga0206350_10439005 3300020080 Bacteria 880
159 Ga0206350_10727755 3300020080 Bacteria 623
160 Ga0224712_10121912 3300022467 Bacteria 1130
161 Ga0224712_10528503 3300022467 Unclassified 572
162 Ga0207710_10055137 3300025900 Bacteria 1791
163 Ga0207680_10045431 3300025903 Bacteria 2590
164 Ga0207680_10348858 3300025903 Bacteria 1039
165 Ga0207680_10475654 3300025903 Bacteria 888
166 Ga0207685_10136185 3300025905 Bacteria 1096
167 Ga0207643_10597398 3300025908 Bacteria 710
168 Ga0207705_10851128 3300025909 Bacteria 707
169 Ga0207707_10300493 3300025912 Bacteria 1388
170 Ga0207662_10233161 3300025918 Bacteria 1203
171 Ga0207652_10337680 3300025921 Bacteria 1360
172 Ga0207646_10081362 3300025922 Bacteria 2896
173 Ga0207646_10322579 3300025922 Bacteria 1396
174 Ga0207646_10624022 3300025922 Unclassified 967
175 Ga0207681_10075711 3300025923 Bacteria 2361
176 Ga0207659_10472378 3300025926 Unclassified 1059
177 Ga0207659_11777257 3300025926 Unclassified 524
178 Ga0207687_11647619 3300025927 Bacteria 550
179 Ga0207644_10058274 3300025931 Bacteria 2791
180 Ga0207686_10091561 3300025934 Bacteria 2009
181 Ga0207670_10524152 3300025936 Bacteria 965
182 Ga0207669_11008312 3300025937 Bacteria 700
183 Ga0207665_10148820 3300025939 Bacteria 1675
184 Ga0207691_10064579 3300025940 Bacteria 3316
185 Ga0207711_10010846 3300025941 Bacteria 7574
186 Ga0207711_10078748 3300025941 Bacteria 2876
187 Ga0207689_10283408 3300025942 Bacteria 1372
188 Ga0207689_10531148 3300025942 Bacteria 987
189 Ga0207667_10174972 3300025949 Bacteria 2206
190 Ga0207651_10071006 3300025960 Bacteria 2466
191 Ga0207651_10149658 3300025960 Bacteria 1815
192 Ga0207651_10898808 3300025960 Bacteria 789
193 Ga0207712_10205019 3300025961 Bacteria 1566
194 Ga0207668_10609062 3300025972 Bacteria 952
195 Ga0207640_12168423 3300025981 Bacteria 504
196 Ga0207658_10034437 3300025986 Bacteria 3620
197 Ga0207703_10294401 3300026035 Bacteria 1478
198 Ga0207703_10314331 3300026035 Bacteria 1433
199 Ga0207708_10365379 3300026075 Bacteria 1187
200 Ga0207641_10001284 3300026088 Bacteria 25006
201 Ga0207648_11660318 3300026089 Bacteria 600
202 Ga0207675_100119181 3300026118 Bacteria 2496
203 Ga0207675_102331021 3300026118 Unclassified 549
204 Ga0207675_102453339 3300026118 Unclassified 533
205 Ga0207683_10197476 3300026121 Bacteria 1828
206 Ga0207698_11506084 3300026142 Unclassified 688
207 Ga0207428_10058572 3300027907 Bacteria 3056
208 Ga0207428_10694107 3300027907 Bacteria 728
209 Ga0268266_10189554 3300028379 Unclassified 1877
210 Ga0268265_10085281 3300028380 Bacteria 2506
211 Ga0268265_10847045 3300028380 Unclassified 894
212 Ga0268265_11362366 3300028380 Unclassified 711
213 Ga0268264_10836827 3300028381 Bacteria 921
214 Ga0373941_0039741 3300035115 Bacteria 1447
215 Ga0373931_0100382 3300035691 Bacteria 1627
216 Ga0373937_0619408 3300036401 Bacteria 1027
217 Ga0395901_0960415 3300038443 Bacteria 833
218 Ga0451793_1866023 3300041452 Archaea 826
219 Ga0466963_0024261 3300044694 Bacteria 3860
220 Ga0466971_0330158 3300044719 Bacteria 736
221 Ga0451576_1074336 3300045051 Bacteria 843
222 Ga0451576_2192343 3300045051 Unclassified 567
223 Ga0495580_0368223 3300046472 Bacteria 972
224 Ga0495674_1161857 3300047319 Unclassified 585
225 Ga0495676_0762788 3300047321 Unclassified 624
226 Ga0496102_0457371 3300048905 Bacteria 1197
227 Ga0496106_0351947 3300048909 Bacteria 1183
228 Ga0496106_0370939 3300048909 Bacteria 1150
229 Ga0496107_0220239 3300048910 Bacteria 1412
230 Ga0501034_1044921 3300049571 Bacteria 699
231 Ga0501047_0168258 3300049581 Bacteria 2062
232 nmdc:mga05p37_166297_c1 3300050507 Bacteria 2692
233 nmdc:mga05p37_1762192_c1 3300050507 Unclassified 600
234 nmdc:mga05p37_251171_c1 3300050507 Bacteria 2121
235 nmdc:mga05p37_2670_c1 3300050507 Bacteria 20778
236 nmdc:mga05p37_28127_c1 3300050507 Bacteria 6852
237 nmdc:mga05p37_563788_c1 3300050507 Bacteria 1293
238 nmdc:mga09592_1235845_c1 3300050508 Bacteria 616
239 nmdc:mga08y16_320725_c1 3300050511 Bacteria 1595
240 nmdc:mga08y16_5175_c1 3300050511 Bacteria 13619
241 nmdc:mga0n895_1070239_c1 3300050512 Bacteria 785
242 nmdc:mga0n895_155_c1 3300050512 Bacteria 42337
243 nmdc:mga0n895_1609230_c1 3300050512 Unclassified 614
244 nmdc:mga0n895_168343_c1 3300050512 Bacteria 2223
245 nmdc:mga0n895_484197_c1 3300050512 Unclassified 1247
246 nmdc:mga0n895_489009_c1 3300050512 Bacteria 1241
247 nmdc:mga0n895_50101_c1 3300050512 Bacteria 4094
248 nmdc:mga0n895_776907_c1 3300050512 Bacteria 949
249 nmdc:mga0n895_7944_c1 3300050512 Bacteria 9149
250 nmdc:mga0rr50_1762793_c1 3300050513 Unclassified 521
251 nmdc:mga0rr50_32241_c1 3300050513 Bacteria 3732
252 nmdc:mga0rr50_383377_c1 3300050513 Bacteria 1186
253 nmdc:mga0rr50_455355_c1 3300050513 Bacteria 1085
254 nmdc:mga0rr50_553490_c1 3300050513 Bacteria 979
255 nmdc:mga0rr50_753891_c1 3300050513 Bacteria 831
256 nmdc:mga0rr50_8_c1 3300050513 Bacteria 271775
257 nmdc:mga08x19_1056_c1 3300050514 Bacteria 17215
258 nmdc:mga08x19_1076758_c1 3300050514 Unclassified 571
259 nmdc:mga08x19_222124_c1 3300050514 Bacteria 1298
260 nmdc:mga08x19_310791_c1 3300050514 Bacteria 1096
261 nmdc:mga08x19_38853_c1 3300050514 Bacteria 3024
262 nmdc:mga08x19_486149_c1 3300050514 Bacteria 871
263 nmdc:mga08x19_55895_c1 3300050514 Bacteria 2546
264 nmdc:mga08x19_72128_c1 3300050514 Bacteria 2252
265 nmdc:mga0a205_1003288_c1 3300050515 Unclassified 682
266 nmdc:mga0a205_1063058_c1 3300050515 Bacteria 657
267 nmdc:mga0a205_1438126_c1 3300050515 Unclassified 537
268 nmdc:mga0a205_25793_c1 3300050515 Bacteria 5600
269 nmdc:mga0a205_73656_c1 3300050515 Bacteria 3299
270 Ga0587073_0186045 3300059492 Unclassified 613
271 Ga0587082_130191 3300059504 Unclassified 577
272 Ga0587088_160431 3300059508 Unclassified 550
273 Ga0587075_108089 3300059644 Unclassified 563
274 Ga0496108_0434085
275 Ga0006778J45830_1030752
276 Ga0006777J48905_1025804
277 Ga0007429J51699_1049849
278 Ga0058862_10142550
279 Ga0065704_10182576
280 Ga0065715_10078760
281 Ga0065715_10147637
282 Ga0065707_10258039
283 Ga0070658_10131283
284 Ga0068869_100486664
285 Ga0068869_101641457
286 Ga0070666_10786811
287 Ga0068868_101056793
288 Ga0070660_100074380
289 Ga0070689_100157344
290 Ga0070689_101635804
291 Ga0070687_100052017
292 Ga0070687_100848454
293 Ga0070692_10569007
294 Ga0070668_100687786
295 Ga0070669_100380416
296 Ga0070675_100244978
297 Ga0070675_101404693
298 Ga0070671_100004617
299 Ga0070674_101251229
300 Ga0070674_102073674
301 Ga0070673_100167389
302 Ga0070688_100111310
303 Ga0070688_100555886
304 Ga0070667_100006335
305 Ga0070700_101590191
306 Ga0070662_100688251
307 Ga0070681_11766654
308 Ga0068867_100767758
309 Ga0070685_10528450
310 Ga0070706_100311807
311 Ga0070706_101104838
312 Ga0070707_100246666
313 Ga0070707_100276702
314 Ga0070707_100726592
315 Ga0070698_100249256
316 Ga0070699_100002362
317 Ga0070699_100228813
318 Ga0070699_101114064
319 Ga0070679_100096019
320 Ga0070679_100431618
321 Ga0070684_101101448
322 Ga0070697_100111981
323 Ga0070697_100157120
324 Ga0068853_101774999
325 Ga0070672_100054213
326 Ga0070686_100001890
327 Ga0070686_100179585
328 Ga0070695_100006178
329 Ga0070695_100181696
330 Ga0070695_100886636
331 Ga0070696_101767122
332 Ga0070704_100000854
333 Ga0070704_100747990
334 Ga0068855_100855149
335 Ga0068855_101818129
336 Ga0068857_101750364
337 Ga0068854_100014216
338 Ga0070702_101305782
339 Ga0068859_100919481
340 Ga0068859_101622391
341 Ga0068859_101624752
342 Ga0068861_100128873
343 Ga0068861_101537537
344 Ga0068861_102488667
345 Ga0068863_100381322
346 Ga0068858_100160446
347 Ga0068858_101745271
348 Ga0068860_100018116
349 Ga0068860_100771465
350 Ga0068860_101368141
351 Ga0068862_100105189
352 Ga0068862_100276255
353 Ga0068862_100414879
354 Ga0068862_101053730
355 Ga0081539_10011679
356 Ga0075432_10016264
357 Ga0070715_10643373
358 Ga0070716_100121985
359 Ga0075366_11079492
360 Ga0068871_101153793
361 Ga0075428_100046779
362 Ga0075428_102124938
363 Ga0075430_100593171
364 Ga0075433_10055434
365 Ga0075433_10176621
366 Ga0075433_10707599
367 Ga0075433_11203341
368 Ga0075433_11665662
369 Ga0075434_100007000
370 Ga0075434_100007006
371 Ga0075434_100025979
372 Ga0075434_100102882
373 Ga0075434_100258738
374 Ga0075434_100359503
375 Ga0075434_100938348
376 Ga0075434_101089888
377 Ga0075434_101631507
378 Ga0075429_100686931
379 Ga0075436_100002450
380 Ga0075436_100006279
381 Ga0075436_100007079
382 Ga0075436_100016995
383 Ga0075436_100045660
384 Ga0075436_100079047
385 Ga0075436_100294652
386 Ga0075436_100487126
387 Ga0075436_100607289
388 Ga0075436_101185947
389 Ga0097620_100919344
390 Ga0097620_101622522
391 Ga0097620_101624854
392 Ga0075435_100000028
393 Ga0075435_100059066
394 Ga0075435_101339205
395 Ga0075435_101379600
396 Ga0105240_11495645
397 Ga0111539_10067577
398 Ga0111539_10468651
399 Ga0105245_12775125
400 Ga0114129_10001269
401 Ga0114129_10006081
402 Ga0114129_10016566
403 Ga0114129_10247164
404 Ga0114129_10353043
405 Ga0114129_10369951
406 Ga0114129_10430716
407 Ga0105243_11247823
408 Ga0105241_10135917
409 Ga0105242_10090823
410 Ga0105248_10006769
411 Ga0105248_11402386
412 Ga0105248_11688914
413 Ga0105238_11013894
414 Ga0105249_10211730
415 Ga0105249_12521970
416 Ga0157329_1033792
417 Ga0157374_11028467
418 Ga0163162_10103004
419 Ga0157375_10030934
420 Ga0157375_12833141
421 Ga0157375_13764114
422 Ga0157380_10370338
423 Ga0157380_10457922
424 Ga0157377_10129933
425 Ga0157379_10064602
426 Ga0157376_10062110
427 Ga0157376_11051047
428 Ga0163161_11080792
429 Ga0197907_10837880
430 Ga0206356_10106356
431 Ga0206350_10439005
432 Ga0206350_10727755
433 Ga0224712_10121912
434 Ga0224712_10528503
435 Ga0207710_10055137
436 Ga0207680_10045431
437 Ga0207680_10348858
438 Ga0207680_10475654
439 Ga0207685_10136185
440 Ga0207643_10597398
441 Ga0207705_10851128
442 Ga0207707_10300493
443 Ga0207662_10233161
444 Ga0207652_10337680
445 Ga0207646_10081362
446 Ga0207646_10322579
447 Ga0207646_10624022
448 Ga0207681_10075711
449 Ga0207659_10472378
450 Ga0207659_11777257
451 Ga0207687_11647619
452 Ga0207644_10058274
453 Ga0207686_10091561
454 Ga0207670_10524152
455 Ga0207669_11008312
456 Ga0207665_10148820
457 Ga0207691_10064579
458 Ga0207711_10010846
459 Ga0207711_10078748
460 Ga0207689_10283408
461 Ga0207689_10531148
462 Ga0207667_10174972
463 Ga0207651_10071006
464 Ga0207651_10149658
465 Ga0207651_10898808
466 Ga0207712_10205019
467 Ga0207668_10609062
468 Ga0207640_12168423
469 Ga0207658_10034437
470 Ga0207703_10294401
471 Ga0207703_10314331
472 Ga0207708_10365379
473 Ga0207641_10001284
474 Ga0207648_11660318
475 Ga0207675_100119181
476 Ga0207675_102331021
477 Ga0207675_102453339
478 Ga0207683_10197476
479 Ga0207698_11506084
480 Ga0207428_10058572
481 Ga0207428_10694107
482 Ga0268266_10189554
483 Ga0268265_10085281
484 Ga0268265_10847045
485 Ga0268265_11362366
486 Ga0268264_10836827
487 Ga0373941_0039741
488 Ga0373931_0100382
489 Ga0373937_0619408
490 Ga0395901_0960415
491 Ga0451793_1866023
492 Ga0466963_0024261
493 Ga0466971_0330158
494 Ga0451576_1074336
495 Ga0451576_2192343
496 Ga0495580_0368223
497 Ga0495674_1161857
498 Ga0495676_0762788
499 Ga0496102_0457371
500 Ga0496106_0351947
501 Ga0496106_0370939
502 Ga0496107_0220239
503 Ga0501034_1044921
504 Ga0501047_0168258
505 nmdc:mga05p37_166297_c1
506 nmdc:mga05p37_1762192_c1
507 nmdc:mga05p37_251171_c1
508 nmdc:mga05p37_2670_c1
509 nmdc:mga05p37_28127_c1
510 nmdc:mga05p37_563788_c1
511 nmdc:mga09592_1235845_c1
512 nmdc:mga08y16_320725_c1
513 nmdc:mga08y16_5175_c1
514 nmdc:mga0n895_1070239_c1
515 nmdc:mga0n895_155_c1
516 nmdc:mga0n895_1609230_c1
517 nmdc:mga0n895_168343_c1
518 nmdc:mga0n895_484197_c1
519 nmdc:mga0n895_489009_c1
520 nmdc:mga0n895_50101_c1
521 nmdc:mga0n895_776907_c1
522 nmdc:mga0n895_7944_c1
523 nmdc:mga0rr50_1762793_c1
524 nmdc:mga0rr50_32241_c1
525 nmdc:mga0rr50_383377_c1
526 nmdc:mga0rr50_455355_c1
527 nmdc:mga0rr50_553490_c1
528 nmdc:mga0rr50_753891_c1
529 nmdc:mga0rr50_8_c1
530 nmdc:mga08x19_1056_c1
531 nmdc:mga08x19_1076758_c1
532 nmdc:mga08x19_222124_c1
533 nmdc:mga08x19_310791_c1
534 nmdc:mga08x19_38853_c1
535 nmdc:mga08x19_486149_c1
536 nmdc:mga08x19_55895_c1
537 nmdc:mga08x19_72128_c1
538 nmdc:mga0a205_1003288_c1
539 nmdc:mga0a205_1063058_c1
540 nmdc:mga0a205_1438126_c1
541 nmdc:mga0a205_25793_c1
542 nmdc:mga0a205_73656_c1
543 Ga0587073_0186045
544 Ga0587082_130191
545 Ga0587088_160431
546 Ga0587075_108089

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map