F379265

General Info

Members Datasets Scaffolds Average Seq Length
273 154 546 140

Family's Representative Sequence

Representative Sequence 3300048088|Ga0495602_0319390|Ga0495602_0319390_379_876
Length 165
Sequence MAKEIAMTLVYRKPATTAGIYSNAGMQIISHRLQVATRGKGLYEITGQIGAWLTAARVRAGLLTVFVQHTSASLTIQENADPDVVHDLNTFFDRLVPEDSRLYRHTVEGPDDMPAHIRAALTLTQLSIPVEGGRMALGTWQGVYLFEHRAAPHRRSVLLHLIGEA

Samples

Sample ID Description Type Environment
1 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
89 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
91 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
96 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
107 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
154 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0.73
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.73
Rhizosphere 94.87
Stem 0
Stem Tuber 0
Unclassified 6.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495602_0319390 3300048088 Bacteria 1130
2 Ga0070683_101805085 3300005329 Bacteria 588
3 Ga0068869_101237131 3300005334 Bacteria 657
4 Ga0070682_100584507 3300005337 Bacteria 879
5 Ga0070689_100196715 3300005340 Bacteria 1644
6 Ga0070689_100279684 3300005340 Bacteria 1384
7 Ga0070689_101608102 3300005340 Bacteria 590
8 Ga0070674_100497271 3300005356 Bacteria 1015
9 Ga0070673_100305929 3300005364 Bacteria 1401
10 Ga0070688_100622562 3300005365 Bacteria 828
11 Ga0070667_100790280 3300005367 Bacteria 881
12 Ga0070713_100066491 3300005436 Bacteria 3032
13 Ga0070713_101072828 3300005436 Bacteria 778
14 Ga0070711_101383399 3300005439 Bacteria 612
15 Ga0070678_100393742 3300005456 Bacteria 1202
16 Ga0070681_10021181 3300005458 Bacteria 6514
17 Ga0070681_10049254 3300005458 Bacteria 4209
18 Ga0070698_101265252 3300005471 Bacteria 688
19 Ga0070679_100135328 3300005530 Bacteria 2446
20 Ga0070679_100350353 3300005530 Bacteria 1424
21 Ga0070684_100066139 3300005535 Bacteria 3173
22 Ga0070684_100162559 3300005535 Bacteria 2026
23 Ga0070697_100128709 3300005536 Bacteria 2122
24 Ga0070697_100384525 3300005536 Bacteria 1216
25 Ga0070686_100389656 3300005544 Bacteria 1057
26 Ga0070665_100124881 3300005548 Unclassified 2576
27 Ga0070665_100500498 3300005548 Bacteria 1226
28 Ga0070664_101036094 3300005564 Bacteria 772
29 Ga0068859_101914393 3300005617 Unclassified 655
30 Ga0068863_100349181 3300005841 Bacteria 1440
31 Ga0068863_100370780 3300005841 Bacteria 1397
32 Ga0068863_100898718 3300005841 Bacteria 886
33 Ga0068863_101202294 3300005841 Bacteria 764
34 Ga0068858_101216414 3300005842 Bacteria 741
35 Ga0068860_100499877 3300005843 Bacteria 1214
36 Ga0068860_101009980 3300005843 Bacteria 850
37 Ga0081455_10059377 3300005937 Bacteria 3230
38 Ga0070717_10085406 3300006028 Bacteria 2656
39 Ga0070717_10213528 3300006028 Bacteria 1694
40 Ga0070715_10313655 3300006163 Bacteria 844
41 Ga0070715_10467440 3300006163 Bacteria 715
42 Ga0070716_101375839 3300006173 Bacteria 573
43 Ga0097621_100199373 3300006237 Unclassified 1737
44 Ga0097621_100847141 3300006237 Bacteria 849
45 Ga0068871_100167244 3300006358 Bacteria 1883
46 Ga0068871_100232084 3300006358 Bacteria 1602
47 Ga0075428_101480762 3300006844 Bacteria 711
48 Ga0075430_100049893 3300006846 Bacteria 3531
49 Ga0075431_100007793 3300006847 Bacteria 10665
50 Ga0075429_101517856 3300006880 Bacteria 583
51 Ga0097620_101914473 3300006931 Unclassified 655
52 Ga0105240_10001021 3300009093 Bacteria 49928
53 Ga0105240_10096723 3300009093 Bacteria 3598
54 Ga0105240_11592720 3300009093 Bacteria 683
55 Ga0105245_10094396 3300009098 Bacteria 2757
56 Ga0105245_10515267 3300009098 Bacteria 1214
57 Ga0105247_10893938 3300009101 Bacteria 685
58 Ga0114129_10131779 3300009147 Bacteria 3432
59 Ga0114129_12614830 3300009147 Bacteria 602
60 Ga0105243_10463185 3300009148 Bacteria 1192
61 Ga0105241_10267226 3300009174 Bacteria 1456
62 Ga0105242_11420923 3300009176 Bacteria 722
63 Ga0105248_10067300 3300009177 Bacteria 4022
64 Ga0105248_10539250 3300009177 Bacteria 1316
65 Ga0105248_10656809 3300009177 Bacteria 1183
66 Ga0105248_12408510 3300009177 Bacteria 600
67 Ga0105248_12661923 3300009177 Unclassified 570
68 Ga0105237_10012547 3300009545 Bacteria 8926
69 Ga0105237_11091988 3300009545 Unclassified 805
70 Ga0105238_11123453 3300009551 Unclassified 809
71 Ga0105246_10167839 3300011119 Bacteria 1678
72 Ga0157374_10300404 3300013296 Bacteria 1588
73 Ga0157374_10999702 3300013296 Bacteria 856
74 Ga0157378_10275511 3300013297 Bacteria 1620
75 Ga0157378_11062397 3300013297 Bacteria 846
76 Ga0157378_11817891 3300013297 Bacteria 657
77 Ga0163162_10294264 3300013306 Unclassified 1755
78 Ga0163162_10303736 3300013306 Bacteria 1728
79 Ga0163162_10620958 3300013306 Bacteria 1206
80 Ga0163162_12137784 3300013306 Bacteria 642
81 Ga0163162_12935414 3300013306 Bacteria 548
82 Ga0157372_10040954 3300013307 Bacteria 5120
83 Ga0157372_12679680 3300013307 Bacteria 572
84 Ga0157375_10347888 3300013308 Unclassified 1648
85 Ga0157375_13303873 3300013308 Bacteria 538
86 Ga0163163_10031575 3300014325 Bacteria 5113
87 Ga0163163_10100537 3300014325 Bacteria 2914
88 Ga0163163_10141717 3300014325 Bacteria 2446
89 Ga0163163_10442749 3300014325 Bacteria 1359
90 Ga0163163_11994353 3300014325 Bacteria 640
91 Ga0157380_13000727 3300014326 Unclassified 538
92 Ga0157376_10149257 3300014969 Bacteria 2106
93 Ga0157376_10185699 3300014969 Bacteria 1903
94 Ga0206350_10106468 3300020080 Bacteria 648
95 Ga0154015_1294724 3300020610 Bacteria 641
96 Ga0213876_10003846 3300021384 Bacteria 8503
97 Ga0213876_10117995 3300021384 Bacteria 1408
98 Ga0213875_10000829 3300021388 Bacteria 22978
99 Ga0213871_10026064 3300021441 Unclassified 1493
100 Ga0207682_10071768 3300025893 Bacteria 1468
101 Ga0207707_10016125 3300025912 Bacteria 6515
102 Ga0207707_10437968 3300025912 Bacteria 1119
103 Ga0207695_10006207 3300025913 Bacteria 15569
104 Ga0207695_10023968 3300025913 Bacteria 6882
105 Ga0207695_10046866 3300025913 Bacteria 4579
106 Ga0207671_10075977 3300025914 Bacteria 2513
107 Ga0207663_10080886 3300025916 Bacteria 2126
108 Ga0207663_10330009 3300025916 Bacteria 1149
109 Ga0207663_10601609 3300025916 Bacteria 864
110 Ga0207652_10349730 3300025921 Bacteria 1334
111 Ga0207652_10510411 3300025921 Bacteria 1082
112 Ga0207694_10626142 3300025924 Unclassified 906
113 Ga0207700_10077151 3300025928 Bacteria 2587
114 Ga0207700_11612085 3300025928 Bacteria 574
115 Ga0207686_10525039 3300025934 Bacteria 922
116 Ga0207709_10502804 3300025935 Bacteria 946
117 Ga0207670_10168888 3300025936 Unclassified 1638
118 Ga0207669_10983952 3300025937 Bacteria 708
119 Ga0207711_10192400 3300025941 Bacteria 1860
120 Ga0207711_11469759 3300025941 Bacteria 624
121 Ga0207661_11640161 3300025944 Bacteria 588
122 Ga0207679_10310844 3300025945 Bacteria 1361
123 Ga0207679_10535088 3300025945 Bacteria 1049
124 Ga0207651_10208989 3300025960 Bacteria 1570
125 Ga0207651_10252429 3300025960 Bacteria 1444
126 Ga0207658_10858128 3300025986 Bacteria 826
127 Ga0207677_10682711 3300026023 Bacteria 909
128 Ga0207703_10080648 3300026035 Bacteria 2711
129 Ga0207703_10464286 3300026035 Bacteria 1184
130 Ga0207641_10172523 3300026088 Bacteria 1975
131 Ga0207641_10450414 3300026088 Bacteria 1244
132 Ga0207641_10747518 3300026088 Bacteria 965
133 Ga0207641_11260210 3300026088 Bacteria 739
134 Ga0207641_11445256 3300026088 Bacteria 689
135 Ga0207676_11771061 3300026095 Bacteria 616
136 Ga0207683_10974116 3300026121 Bacteria 787
137 Ga0268266_10541237 3300028379 Unclassified 1115
138 Ga0268266_10567919 3300028379 Bacteria 1088
139 Ga0268264_10634690 3300028381 Bacteria 1056
140 Ga0265331_10057067 3300031250 Bacteria 1853
141 Ga0265316_10064991 3300031344 Bacteria 2825
142 Ga0316576_10033663 3300031727 Bacteria 3649
143 Ga0307414_11008738 3300032004 Bacteria 766
144 Ga0373934_0184913 3300035086 Bacteria 857
145 Ga0373934_0301080 3300035086 Bacteria 665
146 Ga0373923_0186751 3300035111 Bacteria 954
147 Ga0373954_0525260 3300035118 Bacteria 586
148 Ga0373954_0611681 3300035118 Bacteria 540
149 Ga0373956_0207699 3300035119 Bacteria 929
150 Ga0373943_0043050 3300035170 Bacteria 2191
151 Ga0373943_0518946 3300035170 Unclassified 697
152 Ga0373946_0370290 3300035171 Bacteria 719
153 Ga0373946_0538206 3300035171 Bacteria 602
154 Ga0373955_0020501 3300035172 Bacteria 3325
155 Ga0373955_0197964 3300035172 Bacteria 1196
156 Ga0316574_0000038 3300035398 Bacteria 31980
157 Ga0373924_0293070 3300035410 Bacteria 722
158 Ga0373935_0059421 3300035692 Bacteria 2444
159 Ga0373927_0001823 3300035695 Bacteria 15836
160 Ga0373927_0007222 3300035695 Bacteria 7537
161 Ga0373927_0110727 3300035695 Bacteria 1789
162 Ga0373927_0330704 3300035695 Unclassified 1004
163 Ga0373927_0616723 3300035695 Bacteria 717
164 Ga0373947_0003264 3300035725 Bacteria 9613
165 Ga0373947_0336685 3300035725 Bacteria 1011
166 Ga0373947_0955478 3300035725 Bacteria 585
167 Ga0373937_0022095 3300036401 Bacteria 5716
168 Ga0373937_0122159 3300036401 Bacteria 2428
169 Ga0373937_0300249 3300036401 Bacteria 1518
170 Ga0373937_0684196 3300036401 Bacteria 972
171 Ga0373937_0722642 3300036401 Bacteria 943
172 Ga0373925_0000082 3300037068 Bacteria 101345
173 Ga0373925_0155044 3300037068 Bacteria 1801
174 Ga0373925_0158242 3300037068 Bacteria 1783
175 Ga0436364_0340443 3300037853 Bacteria 1810
176 Ga0436364_0655737 3300037853 Bacteria 10624
177 Ga0436364_0923167 3300037853 Bacteria 1194
178 Ga0436364_1434100 3300037853 Bacteria 30091
179 Ga0436365_0465356 3300039437 Bacteria 6982
180 Ga0436365_0593823 3300039437 Bacteria 1371
181 Ga0436365_1375269 3300039437 Bacteria 3325
182 Ga0436365_1774757 3300039437 Bacteria 2426
183 Ga0436360_0457882 3300039438 Bacteria 1754
184 Ga0436360_1096152 3300039438 Unclassified 1957
185 Ga0436363_0995273 3300039450 Bacteria 1317
186 Ga0436362_0733687 3300039453 Bacteria 7379
187 Ga0451800_1635487 3300041459 Bacteria 747
188 Ga0451577_0382866 3300042876 Bacteria 1277
189 Ga0451577_1845395 3300042876 Bacteria 530
190 Ga0453684_0164573 3300044712 Bacteria 2620
191 Ga0451576_0266914 3300045051 Bacteria 1789
192 Ga0451576_0283233 3300045051 Bacteria 1733
193 Ga0495603_0460753 3300046455 Bacteria 728
194 Ga0495651_0018491 3300046462 Bacteria 5398
195 Ga0495651_0531036 3300046462 Bacteria 750
196 Ga0495580_0000494 3300046472 Bacteria 32970
197 Ga0495580_0200302 3300046472 Bacteria 1376
198 Ga0495580_0561694 3300046472 Bacteria 757
199 Ga0495662_0029538 3300046476 Bacteria 2647
200 Ga0495664_0006630 3300046477 Bacteria 6402
201 Ga0495664_0273847 3300046477 Bacteria 1020
202 Ga0495594_0064620 3300046499 Bacteria 2029
203 Ga0495594_0403128 3300046499 Bacteria 778
204 Ga0495628_0007109 3300046516 Bacteria 9696
205 Ga0495630_0081938 3300046517 Bacteria 2435
206 Ga0495630_0587482 3300046517 Bacteria 854
207 Ga0495666_0113811 3300046526 Bacteria 1270
208 Ga0495652_0078094 3300046529 Bacteria 2741
209 Ga0495652_0108659 3300046529 Bacteria 2235
210 Ga0495665_0364553 3300046531 Bacteria 735
211 Ga0495665_0428069 3300046531 Bacteria 670
212 Ga0495640_0082864 3300046533 Bacteria 2129
213 Ga0495640_0136194 3300046533 Bacteria 1586
214 Ga0495640_0547389 3300046533 Bacteria 702
215 Ga0495586_0206724 3300046535 Bacteria 1114
216 Ga0495586_0269561 3300046535 Bacteria 973
217 Ga0495587_0044278 3300046536 Bacteria 2648
218 Ga0495587_0057389 3300046536 Bacteria 2289
219 Ga0495587_0810969 3300046536 Bacteria 511
220 Ga0495645_0003362 3300046543 Bacteria 10842
221 Ga0495645_0873507 3300046543 Bacteria 535
222 Ga0495667_0014183 3300046559 Bacteria 5380
223 Ga0495667_0048689 3300046559 Bacteria 2798
224 Ga0495667_0336617 3300046559 Bacteria 954
225 Ga0495634_0105028 3300046642 Bacteria 1821
226 Ga0495635_0012202 3300046663 Bacteria 6023
227 Ga0495635_0404948 3300046663 Bacteria 906
228 Ga0495599_0007192 3300046678 Bacteria 6743
229 Ga0495623_0012036 3300046679 Bacteria 5604
230 Ga0495623_0192078 3300046679 Bacteria 1179
231 Ga0495646_0041759 3300046680 Bacteria 2817
232 Ga0495613_0054989 3300046689 Bacteria 2926
233 Ga0495613_0160921 3300046689 Bacteria 1597
234 Ga0495624_0114517 3300046690 Bacteria 1657
235 Ga0495604_0082162 3300047317 Bacteria 2410
236 Ga0495604_0147136 3300047317 Bacteria 1678
237 Ga0495604_0824949 3300047317 Bacteria 583
238 Ga0495674_0020363 3300047319 Bacteria 6142
239 Ga0495674_0027784 3300047319 Bacteria 5167
240 Ga0495674_0105508 3300047319 Bacteria 2394
241 Ga0495674_0126049 3300047319 Bacteria 2160
242 Ga0495674_0197740 3300047319 Bacteria 1669
243 Ga0495680_0114576 3300047322 Bacteria 1995
244 Ga0495680_0358307 3300047322 Bacteria 1014
245 Ga0495680_0402799 3300047322 Bacteria 944
246 Ga0495675_0027516 3300047444 Bacteria 3624
247 Ga0495675_0156357 3300047444 Bacteria 1406
248 Ga0495675_0207731 3300047444 Bacteria 1190
249 Ga0495675_0500602 3300047444 Bacteria 698
250 Ga0495684_0003838 3300047471 Bacteria 11706
251 Ga0495684_0141982 3300047471 Bacteria 1800
252 Ga0495684_0188801 3300047471 Bacteria 1524
253 Ga0495684_0491137 3300047471 Bacteria 846
254 Ga0495684_0582711 3300047471 Bacteria 757
255 Ga0495593_0519591 3300047673 Bacteria 597
256 Ga0495602_0035014 3300048088 Bacteria 4687
257 Ga0495602_0208260 3300048088 Bacteria 1487
258 Ga0495602_0537099 3300048088 Bacteria 812
259 Ga0496113_0665993 3300048916 Bacteria 832
260 Ga0501040_1140597 3300049576 Bacteria 565
261 Ga0501041_0904822 3300049577 Bacteria 567
262 Ga0501042_0940768 3300049578 Bacteria 629
263 Ga0501048_0529851 3300049582 Bacteria 845
264 Ga0501067_0618202 3300049583 Bacteria 608
265 Ga0501071_0817138 3300049587 Bacteria 719
266 Ga0501074_0357959 3300049590 Bacteria 1036
267 Ga0501080_1497370 3300049742 Bacteria 574
268 nmdc:mga05p37_1754975_c1 3300050507 Bacteria 602
269 nmdc:mga09592_1576864_c1 3300050508 Bacteria 532
270 nmdc:mga0qj67_410090_c1 3300050509 Unclassified 1093
271 nmdc:mga06r32_5346_c1 3300050510 Bacteria 11562
272 Ga0530510_0225746 3300061734 Bacteria 1393
273 2830076671 2830075706 Bacteria 3855215
274 Ga0495602_0319390
275 Ga0070683_101805085
276 Ga0068869_101237131
277 Ga0070682_100584507
278 Ga0070689_100196715
279 Ga0070689_100279684
280 Ga0070689_101608102
281 Ga0070674_100497271
282 Ga0070673_100305929
283 Ga0070688_100622562
284 Ga0070667_100790280
285 Ga0070713_100066491
286 Ga0070713_101072828
287 Ga0070711_101383399
288 Ga0070678_100393742
289 Ga0070681_10021181
290 Ga0070681_10049254
291 Ga0070698_101265252
292 Ga0070679_100135328
293 Ga0070679_100350353
294 Ga0070684_100066139
295 Ga0070684_100162559
296 Ga0070697_100128709
297 Ga0070697_100384525
298 Ga0070686_100389656
299 Ga0070665_100124881
300 Ga0070665_100500498
301 Ga0070664_101036094
302 Ga0068859_101914393
303 Ga0068863_100349181
304 Ga0068863_100370780
305 Ga0068863_100898718
306 Ga0068863_101202294
307 Ga0068858_101216414
308 Ga0068860_100499877
309 Ga0068860_101009980
310 Ga0081455_10059377
311 Ga0070717_10085406
312 Ga0070717_10213528
313 Ga0070715_10313655
314 Ga0070715_10467440
315 Ga0070716_101375839
316 Ga0097621_100199373
317 Ga0097621_100847141
318 Ga0068871_100167244
319 Ga0068871_100232084
320 Ga0075428_101480762
321 Ga0075430_100049893
322 Ga0075431_100007793
323 Ga0075429_101517856
324 Ga0097620_101914473
325 Ga0105240_10001021
326 Ga0105240_10096723
327 Ga0105240_11592720
328 Ga0105245_10094396
329 Ga0105245_10515267
330 Ga0105247_10893938
331 Ga0114129_10131779
332 Ga0114129_12614830
333 Ga0105243_10463185
334 Ga0105241_10267226
335 Ga0105242_11420923
336 Ga0105248_10067300
337 Ga0105248_10539250
338 Ga0105248_10656809
339 Ga0105248_12408510
340 Ga0105248_12661923
341 Ga0105237_10012547
342 Ga0105237_11091988
343 Ga0105238_11123453
344 Ga0105246_10167839
345 Ga0157374_10300404
346 Ga0157374_10999702
347 Ga0157378_10275511
348 Ga0157378_11062397
349 Ga0157378_11817891
350 Ga0163162_10294264
351 Ga0163162_10303736
352 Ga0163162_10620958
353 Ga0163162_12137784
354 Ga0163162_12935414
355 Ga0157372_10040954
356 Ga0157372_12679680
357 Ga0157375_10347888
358 Ga0157375_13303873
359 Ga0163163_10031575
360 Ga0163163_10100537
361 Ga0163163_10141717
362 Ga0163163_10442749
363 Ga0163163_11994353
364 Ga0157380_13000727
365 Ga0157376_10149257
366 Ga0157376_10185699
367 Ga0206350_10106468
368 Ga0154015_1294724
369 Ga0213876_10003846
370 Ga0213876_10117995
371 Ga0213875_10000829
372 Ga0213871_10026064
373 Ga0207682_10071768
374 Ga0207707_10016125
375 Ga0207707_10437968
376 Ga0207695_10006207
377 Ga0207695_10023968
378 Ga0207695_10046866
379 Ga0207671_10075977
380 Ga0207663_10080886
381 Ga0207663_10330009
382 Ga0207663_10601609
383 Ga0207652_10349730
384 Ga0207652_10510411
385 Ga0207694_10626142
386 Ga0207700_10077151
387 Ga0207700_11612085
388 Ga0207686_10525039
389 Ga0207709_10502804
390 Ga0207670_10168888
391 Ga0207669_10983952
392 Ga0207711_10192400
393 Ga0207711_11469759
394 Ga0207661_11640161
395 Ga0207679_10310844
396 Ga0207679_10535088
397 Ga0207651_10208989
398 Ga0207651_10252429
399 Ga0207658_10858128
400 Ga0207677_10682711
401 Ga0207703_10080648
402 Ga0207703_10464286
403 Ga0207641_10172523
404 Ga0207641_10450414
405 Ga0207641_10747518
406 Ga0207641_11260210
407 Ga0207641_11445256
408 Ga0207676_11771061
409 Ga0207683_10974116
410 Ga0268266_10541237
411 Ga0268266_10567919
412 Ga0268264_10634690
413 Ga0265331_10057067
414 Ga0265316_10064991
415 Ga0316576_10033663
416 Ga0307414_11008738
417 Ga0373934_0184913
418 Ga0373934_0301080
419 Ga0373923_0186751
420 Ga0373954_0525260
421 Ga0373954_0611681
422 Ga0373956_0207699
423 Ga0373943_0043050
424 Ga0373943_0518946
425 Ga0373946_0370290
426 Ga0373946_0538206
427 Ga0373955_0020501
428 Ga0373955_0197964
429 Ga0316574_0000038
430 Ga0373924_0293070
431 Ga0373935_0059421
432 Ga0373927_0001823
433 Ga0373927_0007222
434 Ga0373927_0110727
435 Ga0373927_0330704
436 Ga0373927_0616723
437 Ga0373947_0003264
438 Ga0373947_0336685
439 Ga0373947_0955478
440 Ga0373937_0022095
441 Ga0373937_0122159
442 Ga0373937_0300249
443 Ga0373937_0684196
444 Ga0373937_0722642
445 Ga0373925_0000082
446 Ga0373925_0155044
447 Ga0373925_0158242
448 Ga0436364_0340443
449 Ga0436364_0655737
450 Ga0436364_0923167
451 Ga0436364_1434100
452 Ga0436365_0465356
453 Ga0436365_0593823
454 Ga0436365_1375269
455 Ga0436365_1774757
456 Ga0436360_0457882
457 Ga0436360_1096152
458 Ga0436363_0995273
459 Ga0436362_0733687
460 Ga0451800_1635487
461 Ga0451577_0382866
462 Ga0451577_1845395
463 Ga0453684_0164573
464 Ga0451576_0266914
465 Ga0451576_0283233
466 Ga0495603_0460753
467 Ga0495651_0018491
468 Ga0495651_0531036
469 Ga0495580_0000494
470 Ga0495580_0200302
471 Ga0495580_0561694
472 Ga0495662_0029538
473 Ga0495664_0006630
474 Ga0495664_0273847
475 Ga0495594_0064620
476 Ga0495594_0403128
477 Ga0495628_0007109
478 Ga0495630_0081938
479 Ga0495630_0587482
480 Ga0495666_0113811
481 Ga0495652_0078094
482 Ga0495652_0108659
483 Ga0495665_0364553
484 Ga0495665_0428069
485 Ga0495640_0082864
486 Ga0495640_0136194
487 Ga0495640_0547389
488 Ga0495586_0206724
489 Ga0495586_0269561
490 Ga0495587_0044278
491 Ga0495587_0057389
492 Ga0495587_0810969
493 Ga0495645_0003362
494 Ga0495645_0873507
495 Ga0495667_0014183
496 Ga0495667_0048689
497 Ga0495667_0336617
498 Ga0495634_0105028
499 Ga0495635_0012202
500 Ga0495635_0404948
501 Ga0495599_0007192
502 Ga0495623_0012036
503 Ga0495623_0192078
504 Ga0495646_0041759
505 Ga0495613_0054989
506 Ga0495613_0160921
507 Ga0495624_0114517
508 Ga0495604_0082162
509 Ga0495604_0147136
510 Ga0495604_0824949
511 Ga0495674_0020363
512 Ga0495674_0027784
513 Ga0495674_0105508
514 Ga0495674_0126049
515 Ga0495674_0197740
516 Ga0495680_0114576
517 Ga0495680_0358307
518 Ga0495680_0402799
519 Ga0495675_0027516
520 Ga0495675_0156357
521 Ga0495675_0207731
522 Ga0495675_0500602
523 Ga0495684_0003838
524 Ga0495684_0141982
525 Ga0495684_0188801
526 Ga0495684_0491137
527 Ga0495684_0582711
528 Ga0495593_0519591
529 Ga0495602_0035014
530 Ga0495602_0208260
531 Ga0495602_0537099
532 Ga0496113_0665993
533 Ga0501040_1140597
534 Ga0501041_0904822
535 Ga0501042_0940768
536 Ga0501048_0529851
537 Ga0501067_0618202
538 Ga0501071_0817138
539 Ga0501074_0357959
540 Ga0501080_1497370
541 nmdc:mga05p37_1754975_c1
542 nmdc:mga09592_1576864_c1
543 nmdc:mga0qj67_410090_c1
544 nmdc:mga06r32_5346_c1
545 Ga0530510_0225746
546 2830076671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

44

161

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cu5-assembly1.cif.gz_C crystal structure of the conserved hypothetical protein tt1486 from thermus thermophilus hb8 0.9206 6 137
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.9109 1 139
1ve0-assembly1.cif.gz_A crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii 0.9095 1 139
2cu5-assembly1.cif.gz_C crystal structure of the conserved hypothetical protein tt1486 from thermus thermophilus hb8 0.9068 6 137
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.9047 1 139
ID Description Score Start End Superfamily
2cu5A00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.927 5 137 2.60.120.460
af_P0AF48_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9247 2 139 2.60.120.460
af_O14155_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9227 1 138 2.60.120.460
af_P0AF48_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9183 2 139 2.60.120.460
af_P9WFP9_1_132_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.917 5 137 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A0T0PYK0-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.991 1 139 GO:0016020
AF-A0A097EE18-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9888 1 139
AF-A0A424NAU3-F1-model_v4 YjbQ family protein 0.9888 2 137 GO:0016020
AF-A0A1U9RI80-F1-model_v4 deleted 0.9878 1 139
AF-A0A245ZH36-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9873 1 139

Map