F379141

General Info

Members Datasets Scaffolds Average Seq Length
273 153 270 170

Family's Representative Sequence

Representative Sequence 3300035118|Ga0373954_0037965|Ga0373954_0037965_875_1405
Length 176
Sequence MAELTQKERLQPSLLDRLTDDRPEERQESRDKHVLSPSRLRDCVRRDLTWLLNTTNLAATEEELNDFPEVMQSVVNYGMPDLAGRVASSVDVRTMERNLLRVIASFEPRLMKASLKVKLVHNDQRMDVNAMTFDIEAELWAQPLPLRLFLRTEIDLENGGVKVTETTGQSTGLRGG

Samples

Sample ID Description Type Environment
1 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
2 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
3 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
74 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
75 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
76 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
77 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
78 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
79 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
82 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
83 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
84 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
85 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
94 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
102 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
107 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
108 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
113 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
122 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
123 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
139 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
153 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.07
Metatranscriptomes 1.83
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.2
Nodule 0
Rhizoplane 3.66
Rhizosphere 93.41
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10101322 3300003323 Bacteria 2241
2 Ga0070658_10001039 3300005327 Bacteria 23763
3 Ga0070658_10580072 3300005327 Bacteria 971
4 Ga0070683_100397067 3300005329 Unclassified 1315
5 Ga0070683_101247979 3300005329 Bacteria 714
6 Ga0070680_100018160 3300005336 Bacteria 5556
7 Ga0070682_100016300 3300005337 Bacteria 4318
8 Ga0070682_100088807 3300005337 Bacteria 2018
9 Ga0070682_100325176 3300005337 Bacteria 1137
10 Ga0070682_100875232 3300005337 Unclassified 736
11 Ga0068868_100405010 3300005338 Bacteria 1178
12 Ga0068868_101025098 3300005338 Bacteria 756
13 Ga0070689_100000124 3300005340 Bacteria 44440
14 Ga0070689_100156937 3300005340 Bacteria 1837
15 Ga0070687_100005019 3300005343 Bacteria 5331
16 Ga0070675_100120724 3300005354 Bacteria 2226
17 Ga0070674_100542774 3300005356 Bacteria 974
18 Ga0070674_100842374 3300005356 Bacteria 795
19 Ga0070688_100246039 3300005365 Bacteria 1271
20 Ga0070688_100356046 3300005365 Bacteria 1073
21 Ga0070659_100236908 3300005366 Bacteria 1509
22 Ga0070667_100551897 3300005367 Bacteria 1059
23 Ga0070710_10027445 3300005437 Bacteria 3036
24 Ga0070711_100168079 3300005439 Unclassified 1669
25 Ga0070678_101062044 3300005456 Bacteria 746
26 Ga0070681_10710321 3300005458 Bacteria 921
27 Ga0070685_10549372 3300005466 Bacteria 824
28 Ga0070707_100141091 3300005468 Bacteria 2345
29 Ga0070679_100055639 3300005530 Bacteria 3940
30 Ga0070679_100460450 3300005530 Bacteria 1216
31 Ga0068853_100011094 3300005539 Bacteria 7308
32 Ga0070686_100059304 3300005544 Bacteria 2465
33 Ga0070665_100183657 3300005548 Bacteria 2092
34 Ga0070704_101550697 3300005549 Bacteria 610
35 Ga0068855_100178102 3300005563 Bacteria 2405
36 Ga0068855_100258525 3300005563 Bacteria 1941
37 Ga0070664_101032181 3300005564 Bacteria 773
38 Ga0068857_100820086 3300005577 Unclassified 889
39 Ga0068856_100050486 3300005614 Bacteria 4100
40 Ga0068856_100343663 3300005614 Bacteria 1510
41 Ga0068856_101319202 3300005614 Unclassified 737
42 Ga0070702_100136484 3300005615 Bacteria 1557
43 Ga0068852_100223949 3300005616 Bacteria 1790
44 Ga0068852_100888674 3300005616 Bacteria 908
45 Ga0068859_100004281 3300005617 Bacteria 14574
46 Ga0068863_100146290 3300005841 Bacteria 2260
47 Ga0068860_101349738 3300005843 Unclassified 734
48 Ga0075366_10267377 3300006195 Bacteria 1044
49 Ga0075366_10449362 3300006195 Unclassified 795
50 Ga0075431_100000901 3300006847 Bacteria 26166
51 Ga0075434_101104846 3300006871 Bacteria 806
52 Ga0068865_100691506 3300006881 Unclassified 871
53 Ga0097620_100004281 3300006931 Bacteria 14574
54 Ga0105244_10002730 3300009036 Bacteria 13176
55 Ga0111539_10422704 3300009094 Bacteria 1552
56 Ga0111539_10550524 3300009094 Bacteria 1344
57 Ga0111539_10615160 3300009094 Bacteria 1265
58 Ga0105241_10685156 3300009174 Bacteria 934
59 Ga0105237_10000014 3300009545 Bacteria 293492
60 Ga0105237_10089796 3300009545 Bacteria 3062
61 Ga0105238_10000046 3300009551 Bacteria 147344
62 Ga0105238_10036494 3300009551 Bacteria 4996
63 Ga0105238_10078922 3300009551 Bacteria 3282
64 Ga0105239_10022661 3300010375 Bacteria 6924
65 Ga0105239_10103192 3300010375 Bacteria 3156
66 Ga0157378_10686526 3300013297 Bacteria 1042
67 Ga0163163_10923398 3300014325 Bacteria 936
68 Ga0163161_10002001 3300017792 Bacteria 14736
69 Ga0207705_10002580 3300025909 Bacteria 13917
70 Ga0207654_10130810 3300025911 Bacteria 1588
71 Ga0207695_10009988 3300025913 Bacteria 11661
72 Ga0207671_10000219 3300025914 Bacteria 85909
73 Ga0207671_10094605 3300025914 Bacteria 2255
74 Ga0207660_10024857 3300025917 Bacteria 4059
75 Ga0207662_10021182 3300025918 Bacteria 3712
76 Ga0207652_10002474 3300025921 Bacteria 15565
77 Ga0207652_10007653 3300025921 Bacteria 8690
78 Ga0207646_11017633 3300025922 Bacteria 732
79 Ga0207694_10001721 3300025924 Bacteria 18325
80 Ga0207694_10005260 3300025924 Bacteria 9972
81 Ga0207694_10509983 3300025924 Bacteria 1007
82 Ga0207700_10276590 3300025928 Bacteria 1443
83 Ga0207670_10000010 3300025936 Bacteria 283265
84 Ga0207670_10034638 3300025936 Bacteria 3266
85 Ga0207704_10990307 3300025938 Unclassified 710
86 Ga0207661_10881008 3300025944 Unclassified 824
87 Ga0207661_11100194 3300025944 Bacteria 732
88 Ga0207667_10012327 3300025949 Bacteria 9860
89 Ga0207667_10141902 3300025949 Bacteria 2473
90 Ga0207651_10935246 3300025960 Bacteria 773
91 Ga0207639_10034461 3300026041 Bacteria 3741
92 Ga0207702_10029920 3300026078 Bacteria 4534
93 Ga0207702_11443601 3300026078 Unclassified 682
94 Ga0207641_11444983 3300026088 Unclassified 689
95 Ga0207683_10999487 3300026121 Bacteria 776
96 Ga0207698_10232337 3300026142 Bacteria 1675
97 Ga0207698_10867253 3300026142 Bacteria 908
98 Ga0207428_10535248 3300027907 Bacteria 848
99 Ga0268266_10030184 3300028379 Bacteria 4607
100 Ga0265337_1035116 3300028556 Bacteria 1470
101 Ga0265326_10034512 3300028558 Bacteria 1439
102 Ga0265326_10063954 3300028558 Bacteria 1040
103 Ga0265319_1004505 3300028563 Bacteria 6882
104 Ga0265319_1076436 3300028563 Unclassified 1067
105 Ga0265319_1105909 3300028563 Bacteria 881
106 Ga0265334_10014106 3300028573 Bacteria 3335
107 Ga0265334_10014388 3300028573 Bacteria 3299
108 Ga0265334_10052975 3300028573 Bacteria 1551
109 Ga0265318_10000001 3300028577 Bacteria 500711
110 Ga0265318_10000192 3300028577 Bacteria 53822
111 Ga0265318_10015014 3300028577 Bacteria 3235
112 Ga0265318_10130097 3300028577 Unclassified 925
113 Ga0265318_10152243 3300028577 Unclassified 848
114 Ga0265323_10001454 3300028653 Bacteria 11624
115 Ga0265323_10006668 3300028653 Bacteria 4840
116 Ga0265323_10038894 3300028653 Bacteria 1736
117 Ga0265323_10082392 3300028653 Bacteria 1085
118 Ga0265323_10156266 3300028653 Unclassified 728
119 Ga0265322_10029493 3300028654 Bacteria 1567
120 Ga0265322_10088343 3300028654 Bacteria 880
121 Ga0265338_10005111 3300028800 Bacteria 17292
122 Ga0265338_10024264 3300028800 Bacteria 6200
123 Ga0265338_10196441 3300028800 Bacteria 1525
124 Ga0265338_10244427 3300028800 Bacteria 1327
125 Ga0265324_10000093 3300029957 Bacteria 69020
126 Ga0265330_10000002 3300031235 Bacteria 481237
127 Ga0265330_10000288 3300031235 Bacteria 36642
128 Ga0265330_10000751 3300031235 Bacteria 20404
129 Ga0265330_10002027 3300031235 Bacteria 11241
130 Ga0265330_10003314 3300031235 Bacteria 8466
131 Ga0265330_10004170 3300031235 Bacteria 7380
132 Ga0265330_10042324 3300031235 Bacteria 2018
133 Ga0265330_10056469 3300031235 Bacteria 1713
134 Ga0265332_10000498 3300031238 Bacteria 27140
135 Ga0265332_10000644 3300031238 Bacteria 22702
136 Ga0265328_10001121 3300031239 Bacteria 12361
137 Ga0265328_10003765 3300031239 Bacteria 6671
138 Ga0265328_10006701 3300031239 Bacteria 4851
139 Ga0265320_10000053 3300031240 Bacteria 112866
140 Ga0265320_10003762 3300031240 Bacteria 10098
141 Ga0265320_10007994 3300031240 Bacteria 6510
142 Ga0265325_10000861 3300031241 Bacteria 21888
143 Ga0265325_10010025 3300031241 Bacteria 5506
144 Ga0265329_10000102 3300031242 Bacteria 40580
145 Ga0265329_10000585 3300031242 Bacteria 18851
146 Ga0265329_10000902 3300031242 Bacteria 14902
147 Ga0265329_10009017 3300031242 Bacteria 3747
148 Ga0265329_10224576 3300031242 Bacteria 622
149 Ga0265340_10000413 3300031247 Bacteria 22922
150 Ga0265339_10000001 3300031249 Bacteria 613713
151 Ga0265339_10027657 3300031249 Bacteria 3233
152 Ga0265339_10037853 3300031249 Bacteria 2694
153 Ga0265339_10064961 3300031249 Bacteria 1957
154 Ga0265339_10072173 3300031249 Bacteria 1837
155 Ga0265339_10346218 3300031249 Unclassified 701
156 Ga0265339_10443093 3300031249 Bacteria 603
157 Ga0265331_10000001 3300031250 Bacteria 798836
158 Ga0265331_10000307 3300031250 Bacteria 53420
159 Ga0265331_10001971 3300031250 Bacteria 14335
160 Ga0265331_10046720 3300031250 Bacteria 2086
161 Ga0265327_10006574 3300031251 Bacteria 9243
162 Ga0265316_10000102 3300031344 Bacteria 92202
163 Ga0265316_10000185 3300031344 Bacteria 71392
164 Ga0265316_10000191 3300031344 Bacteria 71027
165 Ga0265316_10000290 3300031344 Bacteria 56689
166 Ga0265316_10003048 3300031344 Bacteria 17099
167 Ga0265316_10006860 3300031344 Bacteria 10813
168 Ga0265316_10020426 3300031344 Bacteria 5635
169 Ga0265316_10025901 3300031344 Bacteria 4887
170 Ga0265316_10047884 3300031344 Bacteria 3379
171 Ga0265316_10057640 3300031344 Bacteria 3028
172 Ga0265316_10070370 3300031344 Bacteria 2698
173 Ga0265316_10352673 3300031344 Bacteria 1065
174 Ga0265316_10465124 3300031344 Unclassified 906
175 Ga0265313_10000051 3300031595 Bacteria 111381
176 Ga0265313_10002831 3300031595 Bacteria 14586
177 Ga0265313_10017322 3300031595 Bacteria 4100
178 Ga0265313_10033317 3300031595 Bacteria 2620
179 Ga0265313_10034204 3300031595 Bacteria 2572
180 Ga0265313_10080624 3300031595 Bacteria 1478
181 Ga0316579_10045477 3300031691 Bacteria 2047
182 Ga0265314_10000006 3300031711 Bacteria 540431
183 Ga0265314_10000009 3300031711 Bacteria 476805
184 Ga0265314_10003406 3300031711 Bacteria 15402
185 Ga0265314_10013421 3300031711 Bacteria 6617
186 Ga0265314_10025045 3300031711 Bacteria 4509
187 Ga0265314_10038115 3300031711 Bacteria 3476
188 Ga0265342_10000618 3300031712 Bacteria 37365
189 Ga0265342_10000976 3300031712 Bacteria 28362
190 Ga0265342_10001274 3300031712 Bacteria 23710
191 Ga0265342_10003077 3300031712 Bacteria 13942
192 Ga0265342_10006409 3300031712 Bacteria 8768
193 Ga0265342_10014670 3300031712 Bacteria 5193
194 Ga0265342_10015833 3300031712 Bacteria 4948
195 Ga0265342_10018728 3300031712 Unclassified 4475
196 Ga0265342_10061584 3300031712 Unclassified 2210
197 Ga0265342_10133378 3300031712 Bacteria 1390
198 Ga0265342_10261920 3300031712 Bacteria 920
199 Ga0316576_10054689 3300031727 Bacteria 2911
200 Ga0316576_10074571 3300031727 Bacteria 2509
201 Ga0316576_10084692 3300031727 Bacteria 2356
202 Ga0316576_10196938 3300031727 Unclassified 1518
203 Ga0316576_10597162 3300031727 Bacteria 806
204 Ga0307405_10255133 3300031731 Bacteria 1307
205 Ga0307410_11851342 3300031852 Unclassified 537
206 Ga0307415_100510162 3300032126 Bacteria 1053
207 Ga0316580_10033803 3300032139 Bacteria 1582
208 Ga0316593_10142096 3300032168 Bacteria 870
209 Ga0316592_1062424 3300033524 Unclassified 837
210 Ga0316588_1056258 3300033528 Bacteria 957
211 Ga0316588_1069232 3300033528 Unclassified 865
212 Ga0316587_1033114 3300033529 Bacteria 918
213 Ga0373945_0177272 3300035116 Bacteria 876
214 Ga0373954_0037965 3300035118 Bacteria 2239
215 Ga0373956_0136408 3300035119 Bacteria 1151
216 Ga0373955_0140179 3300035172 Bacteria 1417
217 Ga0316574_0014571 3300035398 Bacteria 4545
218 Ga0373937_0190393 3300036401 Bacteria 1928
219 Ga0316582_0279905 3300036647 Bacteria 1145
220 Ga0316584_0395164 3300036712 Bacteria 986
221 Ga0436361_0845233 3300039447 Bacteria 4626
222 Ga0451807_0457115 3300041486 Bacteria 1260
223 Ga0451807_1498304 3300041486 Bacteria 1096
224 Ga0451577_0190245 3300042876 Unclassified 1851
225 Ga0453683_0008174 3300044673 Bacteria 7039
226 Ga0453684_0000230 3300044712 Bacteria 241327
227 Ga0453684_0058447 3300044712 Bacteria 4981
228 Ga0453684_1507271 3300044712 Bacteria 693
229 Ga0466971_0373396 3300044719 Unclassified 692
230 Ga0466967_0135379 3300045976 Bacteria 2291
231 Ga0466967_0426237 3300045976 Bacteria 1294
232 Ga0495627_004507 3300046453 Bacteria 5809
233 Ga0495591_000771 3300046458 Bacteria 23136
234 Ga0495650_0019590 3300046471 Bacteria 3323
235 Ga0495664_0096804 3300046477 Bacteria 1776
236 Ga0495607_0015910 3300046501 Bacteria 4863
237 Ga0495628_0246729 3300046516 Bacteria 1334
238 Ga0495630_0009760 3300046517 Bacteria 6907
239 Ga0495632_0001068 3300046519 Bacteria 23479
240 Ga0495586_0009694 3300046535 Bacteria 5129
241 Ga0495667_0302110 3300046559 Bacteria 1014
242 Ga0495634_0009095 3300046642 Bacteria 7342
243 Ga0495661_0000628 3300046665 Bacteria 35864
244 Ga0495599_0592503 3300046678 Unclassified 646
245 Ga0495600_0109579 3300046809 Bacteria 1798
246 Ga0495581_0710295 3300047315 Bacteria 579
247 Ga0495674_0019227 3300047319 Bacteria 6344
248 Ga0495680_0533554 3300047322 Bacteria 793
249 Ga0495673_0038561 3300047469 Bacteria 2173
250 Ga0495681_0001452 3300047470 Bacteria 17752
251 Ga0495684_0061302 3300047471 Bacteria 2862
252 Ga0496101_0230973 3300048904 Bacteria 1438
253 Ga0496105_0321494 3300048908 Bacteria 1240
254 Ga0496106_0424587 3300048909 Bacteria 1068
255 Ga0496110_0360364 3300048913 Bacteria 1325
256 Ga0496110_0841956 3300048913 Bacteria 822
257 Ga0496114_0009502 3300048917 Bacteria 7718
258 Ga0496114_0184061 3300048917 Bacteria 1825
259 Ga0496115_0271139 3300048918 Bacteria 1394
260 Ga0496124_0148328 3300048927 Bacteria 1843
261 Ga0501077_0103502 3300049593 Bacteria 1804
262 nmdc:mga0k408_223303_c1 3300050493 Bacteria 1124
263 nmdc:mga0k408_270879_c1 3300050493 Bacteria 1014
264 nmdc:mga0k408_459940_c1 3300050493 Bacteria 755
265 nmdc:mga06r32_69081_c1 3300050510 Bacteria 3414
266 nmdc:mga08y16_365194_c1 3300050511 Bacteria 1481
267 nmdc:mga08y16_715849_c1 3300050511 Bacteria 1000
268 Ga0495601_0065978 3300053077 Bacteria 2304
269 Ga0495601_0310134 3300053077 Bacteria 1028
270 Ga0500555_014726 3300053103 Bacteria 2254

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_0184061 Ga0496114_0184061_504_1016 162
2 3300048918 Ga0496115_0271139 Ga0496115_0271139_583_1095 162
3 iso_pu_bacteria 2808606384 2808969077 163
4 iso_pu_bacteria 2808606390 2809003908 163
5 iso_pu_bacteria 2808606391 2809011185 163
6 3300005356 Ga0070674_100842374 Ga0070674_1008423742 165
7 3300005337 Ga0070682_100875232 Ga0070682_1008752321 166
8 3300006195 Ga0075366_10267377 Ga0075366_102673772 166
9 3300006195 Ga0075366_10449362 Ga0075366_104493621 166
10 3300031731 Ga0307405_10255133 Ga0307405_102551332 166
11 3300031852 Ga0307410_11851342 Ga0307410_118513421 166
12 3300032126 Ga0307415_100510162 Ga0307415_1005101622 166
13 3300049593 Ga0501077_0103502 Ga0501077_0103502_734_1234 166
14 3300050493 nmdc:mga0k408_223303_c1 nmdc:mga0k408_223303_c1_113_613 166
15 3300050493 nmdc:mga0k408_270879_c1 nmdc:mga0k408_270879_c1_237_737 166
16 3300050493 nmdc:mga0k408_459940_c1 nmdc:mga0k408_459940_c1_21_521 166
17 3300053103 Ga0500555_014726 Ga0500555_014726_1413_1913 166
18 3300005468 Ga0070707_100141091 Ga0070707_1001410914 167
19 3300006847 Ga0075431_100000901 Ga0075431_1000009013 167
20 3300009551 Ga0105238_10000046 Ga0105238_1000004673 167
21 3300025922 Ga0207646_11017633 Ga0207646_110176332 167
22 3300025924 Ga0207694_10001721 Ga0207694_100017218 167
23 3300031251 Ga0265327_10006574 Ga0265327_100065745 167
24 3300045976 Ga0466967_0135379 Ga0466967_0135379_751_1254 167
25 3300046471 Ga0495650_0019590 Ga0495650_0019590_2357_2860 167
26 3300050510 nmdc:mga06r32_69081_c1 nmdc:mga06r32_69081_c1_2724_3230 167
27 3300005338 Ga0068868_101025098 Ga0068868_1010250982 168
28 3300005354 Ga0070675_100120724 Ga0070675_1001207242 168
29 3300005365 Ga0070688_100356046 Ga0070688_1003560462 168
30 3300005367 Ga0070667_100551897 Ga0070667_1005518972 168
31 3300005456 Ga0070678_101062044 Ga0070678_1010620441 168
32 3300005466 Ga0070685_10549372 Ga0070685_105493722 168
33 3300005564 Ga0070664_101032181 Ga0070664_1010321812 168
34 3300005577 Ga0068857_100820086 Ga0068857_1008200862 168
35 3300009094 Ga0111539_10422704 Ga0111539_104227043 168
36 3300025944 Ga0207661_11100194 Ga0207661_111001942 168
37 3300025960 Ga0207651_10935246 Ga0207651_109352461 168
38 3300026121 Ga0207683_10999487 Ga0207683_109994871 168
39 3300035116 Ga0373945_0177272 Ga0373945_0177272_178_684 168
40 3300044673 Ga0453683_0008174 Ga0453683_0008174_2809_3315 168
41 3300046453 Ga0495627_004507 Ga0495627_004507_1228_1737 168
42 3300046458 Ga0495591_000771 Ga0495591_000771_18462_18971 168
43 3300046477 Ga0495664_0096804 Ga0495664_0096804_1251_1757 168
44 3300046501 Ga0495607_0015910 Ga0495607_0015910_280_789 168
45 3300046516 Ga0495628_0246729 Ga0495628_0246729_114_620 168
46 3300046517 Ga0495630_0009760 Ga0495630_0009760_1251_1757 168
47 3300046519 Ga0495632_0001068 Ga0495632_0001068_18852_19361 168
48 3300046535 Ga0495586_0009694 Ga0495586_0009694_1252_1758 168
49 3300046642 Ga0495634_0009095 Ga0495634_0009095_5783_6289 168
50 3300046665 Ga0495661_0000628 Ga0495661_0000628_4166_4675 168
51 3300046678 Ga0495599_0592503 Ga0495599_0592503_55_561 168
52 3300047319 Ga0495674_0019227 Ga0495674_0019227_761_1267 168
53 3300047469 Ga0495673_0038561 Ga0495673_0038561_313_822 168
54 3300047470 Ga0495681_0001452 Ga0495681_0001452_1043_1552 168
55 3300050511 nmdc:mga08y16_365194_c1 nmdc:mga08y16_365194_c1_218_724 168
56 3300053077 Ga0495601_0065978 Ga0495601_0065978_902_1408 168
57 3300005329 Ga0070683_100397067 Ga0070683_1003970672 169
58 3300005337 Ga0070682_100088807 Ga0070682_1000888072 169
59 3300005338 Ga0068868_100405010 Ga0068868_1004050102 169
60 3300005340 Ga0070689_100156937 Ga0070689_1001569372 169
61 3300005437 Ga0070710_10027445 Ga0070710_100274452 169
62 3300005439 Ga0070711_100168079 Ga0070711_1001680792 169
63 3300005539 Ga0068853_100011094 Ga0068853_1000110944 169
64 3300005544 Ga0070686_100059304 Ga0070686_1000593042 169
65 3300005548 Ga0070665_100183657 Ga0070665_1001836572 169
66 3300005563 Ga0068855_100258525 Ga0068855_1002585251 169
67 3300005614 Ga0068856_100050486 Ga0068856_1000504862 169
68 3300005614 Ga0068856_100343663 Ga0068856_1003436632 169
69 3300005616 Ga0068852_100223949 Ga0068852_1002239492 169
70 3300005616 Ga0068852_100888674 Ga0068852_1008886742 169
71 3300005617 Ga0068859_100004281 Ga0068859_1000042814 169
72 3300005841 Ga0068863_100146290 Ga0068863_1001462902 169
73 3300006871 Ga0075434_101104846 Ga0075434_1011048462 169
74 3300006881 Ga0068865_100691506 Ga0068865_1006915062 169
75 3300006931 Ga0097620_100004281 Ga0097620_10000428111 169
76 3300009174 Ga0105241_10685156 Ga0105241_106851562 169
77 3300009545 Ga0105237_10089796 Ga0105237_100897962 169
78 3300009551 Ga0105238_10078922 Ga0105238_100789222 169
79 3300013297 Ga0157378_10686526 Ga0157378_106865261 169
80 3300014325 Ga0163163_10923398 Ga0163163_109233982 169
81 3300025911 Ga0207654_10130810 Ga0207654_101308102 169
82 3300025914 Ga0207671_10094605 Ga0207671_100946052 169
83 3300025924 Ga0207694_10509983 Ga0207694_105099832 169
84 3300025928 Ga0207700_10276590 Ga0207700_102765902 169
85 3300025936 Ga0207670_10034638 Ga0207670_100346384 169
86 3300025938 Ga0207704_10990307 Ga0207704_109903071 169
87 3300025944 Ga0207661_10881008 Ga0207661_108810082 169
88 3300025949 Ga0207667_10012327 Ga0207667_100123279 169
89 3300025949 Ga0207667_10141902 Ga0207667_101419022 169
90 3300026041 Ga0207639_10034461 Ga0207639_100344611 169
91 3300026078 Ga0207702_10029920 Ga0207702_100299202 169
92 3300026088 Ga0207641_11444983 Ga0207641_114449831 169
93 3300026142 Ga0207698_10232337 Ga0207698_102323372 169
94 3300026142 Ga0207698_10867253 Ga0207698_108672531 169
95 3300028379 Ga0268266_10030184 Ga0268266_100301841 169
96 3300031595 Ga0265313_10017322 Ga0265313_100173223 169
97 3300031595 Ga0265313_10033317 Ga0265313_100333172 169
98 3300036401 Ga0373937_0190393 Ga0373937_0190393_762_1271 169
99 3300041486 Ga0451807_0457115 Ga0451807_0457115_657_1166 169
100 3300041486 Ga0451807_1498304 Ga0451807_1498304_570_1079 169
101 3300044719 Ga0466971_0373396 Ga0466971_0373396_102_611 169
102 3300045976 Ga0466967_0426237 Ga0466967_0426237_406_915 169
103 3300046559 Ga0495667_0302110 Ga0495667_0302110_461_970 169
104 3300047322 Ga0495680_0533554 Ga0495680_0533554_94_606 169
105 3300047471 Ga0495684_0061302 Ga0495684_0061302_984_1493 169
106 3300048904 Ga0496101_0230973 Ga0496101_0230973_345_854 169
107 3300048908 Ga0496105_0321494 Ga0496105_0321494_335_844 169
108 3300048909 Ga0496106_0424587 Ga0496106_0424587_93_602 169
109 3300048913 Ga0496110_0360364 Ga0496110_0360364_645_1154 169
110 3300048913 Ga0496110_0841956 Ga0496110_0841956_66_575 169
111 3300048917 Ga0496114_0009502 Ga0496114_0009502_2140_2649 169
112 3300053077 Ga0495601_0310134 Ga0495601_0310134_110_619 169
113 3300003323 rootH1_10101322 rootH1_101013221 170
114 3300005327 Ga0070658_10001039 Ga0070658_1000103916 170
115 3300005327 Ga0070658_10580072 Ga0070658_105800722 170
116 3300005329 Ga0070683_101247979 Ga0070683_1012479792 170
117 3300005336 Ga0070680_100018160 Ga0070680_1000181603 170
118 3300005337 Ga0070682_100016300 Ga0070682_1000163003 170
119 3300005337 Ga0070682_100325176 Ga0070682_1003251762 170
120 3300005340 Ga0070689_100000124 Ga0070689_10000012411 170
121 3300005343 Ga0070687_100005019 Ga0070687_1000050193 170
122 3300005356 Ga0070674_100542774 Ga0070674_1005427742 170
123 3300005365 Ga0070688_100246039 Ga0070688_1002460392 170
124 3300005366 Ga0070659_100236908 Ga0070659_1002369082 170
125 3300005458 Ga0070681_10710321 Ga0070681_107103211 170
126 3300005530 Ga0070679_100055639 Ga0070679_1000556393 170
127 3300005530 Ga0070679_100460450 Ga0070679_1004604502 170
128 3300005549 Ga0070704_101550697 Ga0070704_1015506971 170
129 3300005563 Ga0068855_100178102 Ga0068855_1001781022 170
130 3300005614 Ga0068856_101319202 Ga0068856_1013192021 170
131 3300005615 Ga0070702_100136484 Ga0070702_1001364842 170
132 3300005843 Ga0068860_101349738 Ga0068860_1013497382 170
133 3300009036 Ga0105244_10002730 Ga0105244_100027303 170
134 3300009094 Ga0111539_10550524 Ga0111539_105505242 170
135 3300009094 Ga0111539_10615160 Ga0111539_106151602 170
136 3300009545 Ga0105237_10000014 Ga0105237_10000014173 170
137 3300009551 Ga0105238_10036494 Ga0105238_100364942 170
138 3300010375 Ga0105239_10022661 Ga0105239_100226614 170
139 3300010375 Ga0105239_10103192 Ga0105239_101031923 170
140 3300017792 Ga0163161_10002001 Ga0163161_100020016 170
141 3300025909 Ga0207705_10002580 Ga0207705_100025807 170
142 3300025913 Ga0207695_10009988 Ga0207695_100099886 170
143 3300025914 Ga0207671_10000219 Ga0207671_1000021930 170
144 3300025917 Ga0207660_10024857 Ga0207660_100248573 170
145 3300025918 Ga0207662_10021182 Ga0207662_100211824 170
146 3300025921 Ga0207652_10002474 Ga0207652_100024747 170
147 3300025921 Ga0207652_10007653 Ga0207652_100076535 170
148 3300025924 Ga0207694_10005260 Ga0207694_100052604 170
149 3300025936 Ga0207670_10000010 Ga0207670_100000109 170
150 3300026078 Ga0207702_11443601 Ga0207702_114436012 170
151 3300027907 Ga0207428_10535248 Ga0207428_105352482 170
152 3300028556 Ga0265337_1035116 Ga0265337_10351162 170
153 3300028558 Ga0265326_10034512 Ga0265326_100345122 170
154 3300028558 Ga0265326_10063954 Ga0265326_100639542 170
155 3300028563 Ga0265319_1004505 Ga0265319_10045054 170
156 3300028563 Ga0265319_1076436 Ga0265319_10764362 170
157 3300028563 Ga0265319_1105909 Ga0265319_11059092 170
158 3300028573 Ga0265334_10014106 Ga0265334_100141062 170
159 3300028573 Ga0265334_10014388 Ga0265334_100143883 170
160 3300028573 Ga0265334_10052975 Ga0265334_100529752 170
161 3300028577 Ga0265318_10000001 Ga0265318_10000001139 170
162 3300028577 Ga0265318_10000192 Ga0265318_1000019233 170
163 3300028577 Ga0265318_10015014 Ga0265318_100150142 170
164 3300028577 Ga0265318_10130097 Ga0265318_101300972 170
165 3300028577 Ga0265318_10152243 Ga0265318_101522432 170
166 3300028653 Ga0265323_10001454 Ga0265323_100014544 170
167 3300028653 Ga0265323_10006668 Ga0265323_100066683 170
168 3300028653 Ga0265323_10038894 Ga0265323_100388942 170
169 3300028653 Ga0265323_10082392 Ga0265323_100823922 170
170 3300028653 Ga0265323_10156266 Ga0265323_101562661 170
171 3300028654 Ga0265322_10029493 Ga0265322_100294932 170
172 3300028654 Ga0265322_10088343 Ga0265322_100883432 170
173 3300028800 Ga0265338_10005111 Ga0265338_100051115 170
174 3300028800 Ga0265338_10024264 Ga0265338_100242646 170
175 3300028800 Ga0265338_10196441 Ga0265338_101964412 170
176 3300028800 Ga0265338_10244427 Ga0265338_102444272 170
177 3300029957 Ga0265324_10000093 Ga0265324_1000009312 170
178 3300031235 Ga0265330_10000002 Ga0265330_10000002234 170
179 3300031235 Ga0265330_10000288 Ga0265330_1000028817 170
180 3300031235 Ga0265330_10000751 Ga0265330_100007516 170
181 3300031235 Ga0265330_10002027 Ga0265330_100020276 170
182 3300031235 Ga0265330_10003314 Ga0265330_100033143 170
183 3300031235 Ga0265330_10004170 Ga0265330_100041704 170
184 3300031235 Ga0265330_10042324 Ga0265330_100423242 170
185 3300031235 Ga0265330_10056469 Ga0265330_100564692 170
186 3300031238 Ga0265332_10000498 Ga0265332_1000049815 170
187 3300031238 Ga0265332_10000644 Ga0265332_1000064414 170
188 3300031239 Ga0265328_10001121 Ga0265328_100011215 170
189 3300031239 Ga0265328_10003765 Ga0265328_100037657 170
190 3300031239 Ga0265328_10006701 Ga0265328_100067012 170
191 3300031240 Ga0265320_10000053 Ga0265320_1000005327 170
192 3300031240 Ga0265320_10003762 Ga0265320_100037626 170
193 3300031240 Ga0265320_10007994 Ga0265320_100079946 170
194 3300031241 Ga0265325_10000861 Ga0265325_100008613 170
195 3300031241 Ga0265325_10010025 Ga0265325_100100252 170
196 3300031242 Ga0265329_10000102 Ga0265329_100001024 170
197 3300031242 Ga0265329_10000585 Ga0265329_100005857 170
198 3300031242 Ga0265329_10000902 Ga0265329_100009023 170
199 3300031242 Ga0265329_10009017 Ga0265329_100090172 170
200 3300031242 Ga0265329_10224576 Ga0265329_102245761 170
201 3300031247 Ga0265340_10000413 Ga0265340_100004136 170
202 3300031249 Ga0265339_10000001 Ga0265339_10000001191 170
203 3300031249 Ga0265339_10027657 Ga0265339_100276574 170
204 3300031249 Ga0265339_10037853 Ga0265339_100378533 170
205 3300031249 Ga0265339_10064961 Ga0265339_100649612 170
206 3300031249 Ga0265339_10072173 Ga0265339_100721732 170
207 3300031249 Ga0265339_10346218 Ga0265339_103462181 170
208 3300031249 Ga0265339_10443093 Ga0265339_104430931 170
209 3300031250 Ga0265331_10000001 Ga0265331_10000001221 170
210 3300031250 Ga0265331_10000307 Ga0265331_100003076 170
211 3300031250 Ga0265331_10001971 Ga0265331_100019718 170
212 3300031250 Ga0265331_10046720 Ga0265331_100467203 170
213 3300031344 Ga0265316_10000102 Ga0265316_1000010234 170
214 3300031344 Ga0265316_10000185 Ga0265316_1000018515 170
215 3300031344 Ga0265316_10000191 Ga0265316_1000019121 170
216 3300031344 Ga0265316_10000290 Ga0265316_1000029021 170
217 3300031344 Ga0265316_10003048 Ga0265316_100030487 170
218 3300031344 Ga0265316_10006860 Ga0265316_100068603 170
219 3300031344 Ga0265316_10020426 Ga0265316_100204264 170
220 3300031344 Ga0265316_10025901 Ga0265316_100259015 170
221 3300031344 Ga0265316_10047884 Ga0265316_100478843 170
222 3300031344 Ga0265316_10057640 Ga0265316_100576404 170
223 3300031344 Ga0265316_10070370 Ga0265316_100703702 170
224 3300031344 Ga0265316_10352673 Ga0265316_103526732 170
225 3300031344 Ga0265316_10465124 Ga0265316_104651242 170
226 3300031595 Ga0265313_10000051 Ga0265313_1000005138 170
227 3300031595 Ga0265313_10002831 Ga0265313_100028312 170
228 3300031595 Ga0265313_10034204 Ga0265313_100342042 170
229 3300031595 Ga0265313_10080624 Ga0265313_100806242 170
230 3300031691 Ga0316579_10045477 Ga0316579_100454772 170
231 3300031711 Ga0265314_10000006 Ga0265314_10000006423 170
232 3300031711 Ga0265314_10000009 Ga0265314_10000009203 170
233 3300031711 Ga0265314_10003406 Ga0265314_100034066 170
234 3300031711 Ga0265314_10013421 Ga0265314_100134214 170
235 3300031711 Ga0265314_10025045 Ga0265314_100250454 170
236 3300031711 Ga0265314_10038115 Ga0265314_100381153 170
237 3300031712 Ga0265342_10000618 Ga0265342_100006184 170
238 3300031712 Ga0265342_10000976 Ga0265342_100009766 170
239 3300031712 Ga0265342_10001274 Ga0265342_100012746 170
240 3300031712 Ga0265342_10003077 Ga0265342_100030772 170
241 3300031712 Ga0265342_10006409 Ga0265342_100064097 170
242 3300031712 Ga0265342_10014670 Ga0265342_100146704 170
243 3300031712 Ga0265342_10015833 Ga0265342_100158332 170
244 3300031712 Ga0265342_10018728 Ga0265342_100187283 170
245 3300031712 Ga0265342_10061584 Ga0265342_100615842 170
246 3300031712 Ga0265342_10133378 Ga0265342_101333782 170
247 3300031712 Ga0265342_10261920 Ga0265342_102619202 170
248 3300031727 Ga0316576_10054689 Ga0316576_100546892 170
249 3300031727 Ga0316576_10074571 Ga0316576_100745712 170
250 3300031727 Ga0316576_10084692 Ga0316576_100846923 170
251 3300031727 Ga0316576_10196938 Ga0316576_101969382 170
252 3300031727 Ga0316576_10597162 Ga0316576_105971622 170
253 3300032139 Ga0316580_10033803 Ga0316580_100338032 170
254 3300032168 Ga0316593_10142096 Ga0316593_101420962 170
255 3300033524 Ga0316592_1062424 Ga0316592_10624241 170
256 3300033528 Ga0316588_1056258 Ga0316588_10562582 170
257 3300033528 Ga0316588_1069232 Ga0316588_10692322 170
258 3300033529 Ga0316587_1033114 Ga0316587_10331142 170
259 3300035118 Ga0373954_0037965 Ga0373954_0037965_875_1405 170
260 3300035119 Ga0373956_0136408 Ga0373956_0136408_25_555 170
261 3300035172 Ga0373955_0140179 Ga0373955_0140179_362_892 170
262 3300035398 Ga0316574_0014571 Ga0316574_0014571_1912_2424 170
263 3300036647 Ga0316582_0279905 Ga0316582_0279905_158_670 170
264 3300036712 Ga0316584_0395164 Ga0316584_0395164_108_620 170
265 3300039447 Ga0436361_0845233 Ga0436361_0845233_24_539 170
266 3300042876 Ga0451577_0190245 Ga0451577_0190245_793_1308 170
267 3300044712 Ga0453684_0000230 Ga0453684_0000230_186318_186833 170
268 3300044712 Ga0453684_0058447 Ga0453684_0058447_2545_3060 170
269 3300044712 Ga0453684_1507271 Ga0453684_1507271_161_676 170
270 3300046809 Ga0495600_0109579 Ga0495600_0109579_419_934 170
271 3300047315 Ga0495581_0710295 Ga0495581_0710295_38_553 170
272 3300048927 Ga0496124_0148328 Ga0496124_0148328_786_1304 170
273 3300050511 nmdc:mga08y16_715849_c1 nmdc:mga08y16_715849_c1_198_713 170

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04965

GPW_gp25

Baseplate wedge protein gp25

38

144

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hxg-assembly2.cif.gz_G pyrococcus horikoshii acylaminoacyl peptidase (orthorhombic crystal form) 0.7749 124 164
6yhm-assembly1.cif.gz_A crystal structure of the c-terminal domain of cnfy from yersinia pseudotuberculosis 0.7389 129 164
4hxe-assembly1.cif.gz_B pyrococcus horikoshii acylaminoacyl peptidase (uncomplexed) 0.6966 112 164
4hxg-assembly2.cif.gz_K pyrococcus horikoshii acylaminoacyl peptidase (orthorhombic crystal form) 0.6916 113 164
6yhn-assembly1.cif.gz_A crystal structure of domains 4-5 of cnfy from yersinia pseudotuberculosis 0.6811 123 164
ID Description Score Start End Superfamily
af_Q9FVU4_49_288_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7789 106 161 2.120.10.80
af_Q4DIT7_4_179_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.7775 128 164 3.90.950.10
af_A0A1D6KMJ3_66_168_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7611 129 152 2.60.40.10
af_I1M6D4_109_209_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7494 129 152 2.60.40.10
af_F1QAR0_233_339_2.60.40.3210 Mainly Beta;Sandwich;Immunoglobulin-like;Zona pellucida, ZP-N domain 0.7492 129 168 2.60.40.3210
ID Description Score Start End GO Terms
AF-A0A7L6AYY2-F1-model_v4 Type VI secretion system baseplate subunit TssE 0.9283 38 163
AF-A0A2M8VZZ6-F1-model_v4 Type VI secretion system protein ImpF 0.9278 36 163
AF-A0A530M9Z5-F1-model_v4 deleted 0.9176 40 168
AF-A0A246DL98-F1-model_v4 IraD/Gp25-like domain-containing protein 0.9171 38 166
AF-A0A2K9EHX2-F1-model_v4 Type VI secretion system baseplate subunit TssE 0.912 36 169

Feature Viewer

pLDDT pTM Quality
79.82 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map