F379108

General Info

Members Datasets Scaffolds Average Seq Length
273 200 546 118

Family's Representative Sequence

Representative Sequence 3300031242|Ga0265329_10008128|Ga0265329_100081283
Length 134
Sequence MDAGVPFVGRRVEKPWGFEVIWAETARYVGKTLHIERGQQLSYQYHQVKDETIYVLAGIVELDVAPAAGPRRRLRLCAGESVHIPPGLRHRMSAVETSDVLETSTPELNDVVRLEDRYGRVDVGGVAPPPAGGP

Samples

Sample ID Description Type Environment
1 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
96 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
97 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
117 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
133 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
139 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
140 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
141 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
145 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
146 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
156 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
157 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
158 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
159 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
160 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
161 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
162 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
173 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
174 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
175 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
176 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
177 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
178 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
179 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
180 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
181 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
182 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
183 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
184 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
185 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
186 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
187 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
188 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
189 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
190 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
191 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
192 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
193 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
194 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
195 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
196 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
197 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.65
Nodule 0
Rhizoplane 1.47
Rhizosphere 78.75
Stem 0
Stem Tuber 0
Unclassified 12.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265329_10008128 3300031242 Bacteria 4003
2 Ga0070658_10190782 3300005327 Bacteria 1727
3 Ga0068869_100149570 3300005334 Bacteria 1810
4 Ga0070660_100613417 3300005339 Bacteria 910
5 Ga0070689_100942204 3300005340 Unclassified 766
6 Ga0070687_100515448 3300005343 Bacteria 807
7 Ga0070671_101410942 3300005355 Bacteria 615
8 Ga0070667_100560967 3300005367 Bacteria 1050
9 Ga0070713_100860308 3300005436 Bacteria 871
10 Ga0070701_10521544 3300005438 Bacteria 775
11 Ga0070711_100616324 3300005439 Bacteria 907
12 Ga0070711_101398259 3300005439 Bacteria 609
13 Ga0070705_100293121 3300005440 Bacteria 1162
14 Ga0070694_100489503 3300005444 Bacteria 977
15 Ga0070708_100166246 3300005445 Bacteria 2058
16 Ga0070708_100705974 3300005445 Bacteria 949
17 Ga0070662_100555470 3300005457 Bacteria 962
18 Ga0070685_11264534 3300005466 Bacteria 563
19 Ga0070706_100306793 3300005467 Bacteria 1481
20 Ga0070707_100002155 3300005468 Bacteria 18855
21 Ga0070707_100082051 3300005468 Bacteria 3113
22 Ga0070698_100004430 3300005471 Bacteria 15431
23 Ga0070698_101319569 3300005471 Bacteria 672
24 Ga0070699_100000533 3300005518 Bacteria 36015
25 Ga0070679_100300194 3300005530 Bacteria 1557
26 Ga0070684_100209388 3300005535 Bacteria 1777
27 Ga0070697_100155513 3300005536 Bacteria 1930
28 Ga0070697_100291082 3300005536 Bacteria 1403
29 Ga0070697_100540649 3300005536 Bacteria 1021
30 Ga0070697_100588786 3300005536 Bacteria 977
31 Ga0070696_100138680 3300005546 Bacteria 1775
32 Ga0070696_100734869 3300005546 Bacteria 807
33 Ga0070696_101440488 3300005546 Bacteria 588
34 Ga0070665_100005897 3300005548 Bacteria 12552
35 Ga0070704_100070699 3300005549 Bacteria 2533
36 Ga0070704_101109260 3300005549 Bacteria 719
37 Ga0068857_100414030 3300005577 Bacteria 1256
38 Ga0068856_100273463 3300005614 Unclassified 1705
39 Ga0070702_101284006 3300005615 Bacteria 594
40 Ga0068859_100111141 3300005617 Bacteria 2802
41 Ga0068864_100151477 3300005618 Bacteria 2101
42 Ga0068864_100398606 3300005618 Bacteria 1307
43 Ga0068864_101334886 3300005618 Bacteria 718
44 Ga0068870_10311685 3300005840 Bacteria 997
45 Ga0068863_100709963 3300005841 Bacteria 1000
46 Ga0068860_100390998 3300005843 Bacteria 1374
47 Ga0068860_100881098 3300005843 Bacteria 911
48 Ga0068862_100380790 3300005844 Bacteria 1316
49 Ga0068862_100933773 3300005844 Bacteria 855
50 Ga0081455_10025241 3300005937 Bacteria 5490
51 Ga0070717_10067446 3300006028 Bacteria 2977
52 Ga0075363_100628090 3300006048 Bacteria 645
53 Ga0075366_10000266 3300006195 Bacteria 23138
54 Ga0097621_100510674 3300006237 Bacteria 1090
55 Ga0097621_100788157 3300006237 Bacteria 880
56 Ga0068871_101709311 3300006358 Bacteria 597
57 Ga0075428_100223018 3300006844 Bacteria 2035
58 Ga0075428_101594344 3300006844 Bacteria 683
59 Ga0075433_10308070 3300006852 Bacteria 1402
60 Ga0075433_11042089 3300006852 Unclassified 712
61 Ga0075434_100018068 3300006871 Bacteria 6804
62 Ga0075434_101053609 3300006871 Bacteria 827
63 Ga0075429_100083370 3300006880 Unclassified 2787
64 Ga0068865_100050698 3300006881 Bacteria 2869
65 Ga0075436_100307047 3300006914 Bacteria 1138
66 Ga0075436_101470560 3300006914 Bacteria 517
67 Ga0097620_100111153 3300006931 Bacteria 2802
68 Ga0099794_10243621 3300007265 Bacteria 926
69 Ga0105245_10000081 3300009098 Bacteria 96155
70 Ga0105245_10051423 3300009098 Bacteria 3694
71 Ga0105247_10000026 3300009101 Bacteria 204846
72 Ga0114129_10221713 3300009147 Bacteria 2550
73 Ga0114129_11086922 3300009147 Bacteria 1002
74 Ga0114129_12668891 3300009147 Bacteria 595
75 Ga0105243_10080160 3300009148 Bacteria 2662
76 Ga0105243_12317927 3300009148 Bacteria 574
77 Ga0105242_10523068 3300009176 Bacteria 1132
78 Ga0105242_13054531 3300009176 Bacteria 518
79 Ga0105248_10013085 3300009177 Bacteria 9136
80 Ga0105238_10490019 3300009551 Bacteria 1229
81 Ga0105249_10325954 3300009553 Bacteria 1548
82 Ga0105249_10425899 3300009553 Bacteria 1362
83 Ga0105239_10630304 3300010375 Bacteria 1224
84 Ga0157374_10394467 3300013296 Bacteria 1380
85 Ga0157378_12446393 3300013297 Bacteria 574
86 Ga0163162_10000022 3300013306 Bacteria 201725
87 Ga0163162_12755879 3300013306 Unclassified 566
88 Ga0163163_12222502 3300014325 Bacteria 608
89 Ga0157380_11267043 3300014326 Bacteria 783
90 Ga0157379_10077005 3300014968 Bacteria 2986
91 Ga0157376_10000268 3300014969 Bacteria 35439
92 Ga0157376_10002736 3300014969 Bacteria 12024
93 Ga0157376_10205978 3300014969 Bacteria 1813
94 Ga0157376_10219179 3300014969 Bacteria 1761
95 Ga0157376_10828987 3300014969 Unclassified 939
96 Ga0157376_11688692 3300014969 Bacteria 668
97 Ga0207710_10000039 3300025900 Bacteria 231296
98 Ga0207643_10094866 3300025908 Bacteria 1743
99 Ga0207684_10350822 3300025910 Bacteria 1270
100 Ga0207663_10498934 3300025916 Bacteria 945
101 Ga0207660_10558022 3300025917 Unclassified 932
102 Ga0207662_10790791 3300025918 Bacteria 668
103 Ga0207657_10527406 3300025919 Bacteria 924
104 Ga0207652_10816758 3300025921 Unclassified 827
105 Ga0207646_10001754 3300025922 Bacteria 26299
106 Ga0207646_10453835 3300025922 Unclassified 1156
107 Ga0207694_10081585 3300025924 Bacteria 2541
108 Ga0207650_10257296 3300025925 Bacteria 1415
109 Ga0207687_10001036 3300025927 Bacteria 18879
110 Ga0207687_10106232 3300025927 Bacteria 2075
111 Ga0207700_11942606 3300025928 Bacteria 515
112 Ga0207686_11041077 3300025934 Bacteria 665
113 Ga0207686_11689857 3300025934 Unclassified 523
114 Ga0207670_10781191 3300025936 Unclassified 795
115 Ga0207670_11246509 3300025936 Unclassified 630
116 Ga0207704_10036823 3300025938 Bacteria 2819
117 Ga0207711_10088416 3300025941 Bacteria 2720
118 Ga0207689_10596668 3300025942 Bacteria 929
119 Ga0207712_10497912 3300025961 Bacteria 1041
120 Ga0207668_10741430 3300025972 Bacteria 866
121 Ga0207677_11521175 3300026023 Unclassified 618
122 Ga0207703_10613928 3300026035 Bacteria 1029
123 Ga0207703_12306085 3300026035 Bacteria 514
124 Ga0207708_11446120 3300026075 Bacteria 604
125 Ga0207641_10027485 3300026088 Bacteria 4699
126 Ga0207676_10952157 3300026095 Bacteria 844
127 Ga0207428_10050986 3300027907 Bacteria 3309
128 Ga0268266_10516640 3300028379 Bacteria 1141
129 Ga0268265_11002750 3300028380 Bacteria 825
130 Ga0268264_10238860 3300028381 Bacteria 1682
131 Ga0268264_10787249 3300028381 Bacteria 949
132 Ga0265334_10035533 3300028573 Bacteria 1972
133 Ga0265322_10123064 3300028654 Unclassified 739
134 Ga0307517_10040433 3300028786 Bacteria 5076
135 Ga0307515_10049222 3300028794 Bacteria 6349
136 Ga0265338_10001777 3300028800 Bacteria 34017
137 Ga0265338_10012619 3300028800 Bacteria 9622
138 Ga0265338_10048530 3300028800 Bacteria 3861
139 Ga0265330_10017659 3300031235 Bacteria 3283
140 Ga0265330_10025669 3300031235 Bacteria 2670
141 Ga0265332_10011387 3300031238 Bacteria 3953
142 Ga0265332_10067319 3300031238 Bacteria 1527
143 Ga0265328_10077929 3300031239 Bacteria 1221
144 Ga0265325_10000811 3300031241 Bacteria 22621
145 Ga0265329_10008724 3300031242 Bacteria 3827
146 Ga0265329_10062768 3300031242 Bacteria 1176
147 Ga0265340_10089098 3300031247 Bacteria 1444
148 Ga0265339_10001763 3300031249 Bacteria 15951
149 Ga0265339_10186383 3300031249 Bacteria 1031
150 Ga0265331_10003812 3300031250 Bacteria 9558
151 Ga0265331_10014343 3300031250 Bacteria 4224
152 Ga0265316_10000001 3300031344 Bacteria 461400
153 Ga0307513_10006935 3300031456 Bacteria 14743
154 Ga0307509_10003565 3300031507 Bacteria 23428
155 Ga0307509_10472130 3300031507 Bacteria 944
156 Ga0307509_10485818 3300031507 Bacteria 922
157 Ga0307509_10554330 3300031507 Bacteria 827
158 Ga0265313_10000209 3300031595 Bacteria 62806
159 Ga0265313_10063845 3300031595 Unclassified 1715
160 Ga0265313_10082932 3300031595 Bacteria 1452
161 Ga0307508_10020283 3300031616 Bacteria 6036
162 Ga0307508_10711695 3300031616 Bacteria 614
163 Ga0265314_10002106 3300031711 Bacteria 20917
164 Ga0265314_10481396 3300031711 Bacteria 656
165 Ga0265342_10017922 3300031712 Bacteria 4598
166 Ga0265342_10032870 3300031712 Bacteria 3196
167 Ga0316576_10001725 3300031727 Bacteria 12032
168 Ga0307516_10265825 3300031730 Bacteria 1403
169 Ga0307516_10511605 3300031730 Bacteria 854
170 Ga0373940_0031466 3300035088 Bacteria 1417
171 Ga0373949_0000357 3300035090 Bacteria 16120
172 Ga0373949_0216671 3300035090 Bacteria 580
173 Ga0373936_0000016 3300035113 Bacteria 198547
174 Ga0373936_0018502 3300035113 Bacteria 2691
175 Ga0373941_0014786 3300035115 Bacteria 2093
176 Ga0373941_0262956 3300035115 Bacteria 677
177 Ga0373954_0123459 3300035118 Unclassified 1258
178 Ga0373943_0006793 3300035170 Bacteria 5136
179 Ga0373961_0000110 3300035241 Bacteria 42581
180 Ga0373931_0263082 3300035691 Bacteria 1053
181 Ga0373935_0175274 3300035692 Bacteria 1469
182 Ga0373933_0155034 3300035724 Bacteria 1452
183 Ga0373947_0294035 3300035725 Unclassified 1082
184 Ga0373937_0059834 3300036401 Bacteria 3501
185 Ga0373925_0862713 3300037068 Bacteria 746
186 Ga0395905_0087052 3300037471 Bacteria 2929
187 Ga0395905_0161045 3300037471 Bacteria 2109
188 Ga0436365_0499309 3300039437 Unclassified 1170
189 Ga0436363_1164933 3300039450 Bacteria 594
190 Ga0451789_0985561 3300041443 Bacteria 931
191 Ga0451807_0257923 3300041486 Unclassified 546
192 Ga0451853_0278034 3300041512 Bacteria 574
193 Ga0451577_0367617 3300042876 Bacteria 1305
194 Ga0451577_1717824 3300042876 Unclassified 552
195 Ga0495590_0068823 3300046457 Bacteria 1241
196 Ga0495630_0639000 3300046517 Bacteria 815
197 Ga0495643_0123396 3300046522 Bacteria 1307
198 Ga0495622_0075187 3300046557 Bacteria 1557
199 Ga0495611_0178337 3300046648 Bacteria 993
200 Ga0495649_0323902 3300046694 Bacteria 782
201 Ga0496101_0549602 3300048904 Bacteria 913
202 Ga0496108_0687717 3300048911 Bacteria 888
203 Ga0501292_017831 3300049515 Bacteria 1125
204 Ga0501297_030894 3300049520 Unclassified 713
205 Ga0501299_011245 3300049522 Unclassified 1508
206 Ga0501034_0064811 3300049571 Bacteria 3667
207 Ga0501037_0586475 3300049573 Bacteria 750
208 Ga0501040_0554252 3300049576 Bacteria 830
209 Ga0501047_0258972 3300049581 Bacteria 1587
210 Ga0501070_0240573 3300049586 Bacteria 1482
211 Ga0501070_1310006 3300049586 Bacteria 553
212 Ga0501071_0924946 3300049587 Bacteria 673
213 Ga0501073_0962415 3300049589 Bacteria 587
214 Ga0501074_0050157 3300049590 Bacteria 3013
215 Ga0501202_143394 3300049652 Unclassified 619
216 Ga0501216_037309 3300049660 Unclassified 919
217 Ga0501217_078283 3300049661 Unclassified 911
218 Ga0501227_000168 3300049665 Bacteria 12607
219 Ga0501230_002090 3300049667 Bacteria 2507
220 Ga0501230_012399 3300049667 Bacteria 1364
221 Ga0501233_124405 3300049668 Unclassified 699
222 Ga0501221_102413 3300049704 Unclassified 712
223 Ga0501225_0002888 3300049705 Bacteria 5277
224 Ga0501044_0390104 3300049823 Bacteria 1306
225 nmdc:mga0k408_327_c1 3300050493 Unclassified 25957
226 nmdc:mga05p37_1186945_c1 3300050507 Bacteria 790
227 nmdc:mga09592_358886_c1 3300050508 Bacteria 1261
228 nmdc:mga0qj67_1120772_c1 3300050509 Unclassified 614
229 nmdc:mga08y16_737238_c1 3300050511 Bacteria 982
230 nmdc:mga0n895_274975_c1 3300050512 Bacteria 1708
231 nmdc:mga0n895_5862_c1 3300050512 Bacteria 10325
232 nmdc:mga0rr50_723629_c1 3300050513 Bacteria 849
233 nmdc:mga0a205_137423_c1 3300050515 Bacteria 1509
234 nmdc:mga0a205_832794_c1 3300050515 Unclassified 770
235 Ga0500635_0000068 3300053080 Bacteria 68865
236 Ga0500578_0031878 3300053086 Bacteria 3388
237 Ga0500646_0010586 3300053090 Bacteria 2366
238 Ga0500647_0017922 3300053091 Bacteria 3274
239 Ga0500647_0410689 3300053091 Bacteria 546
240 Ga0500583_0047195 3300053092 Bacteria 1984
241 Ga0500583_0605628 3300053092 Bacteria 503
242 Ga0500566_0002288 3300053094 Bacteria 11330
243 Ga0500640_001874 3300053095 Bacteria 6676
244 Ga0500654_046348 3300053099 Bacteria 2399
245 Ga0500554_000304 3300053102 Bacteria 10654
246 Ga0500556_0338894 3300053104 Bacteria 584
247 Ga0500572_001855 3300053111 Bacteria 5356
248 Ga0500591_158235 3300053115 Bacteria 862
249 Ga0500595_000140 3300053119 Bacteria 47339
250 Ga0500595_002001 3300053119 Bacteria 10444
251 Ga0500597_034114 3300053120 Bacteria 2110
252 Ga0500607_062074 3300053121 Bacteria 1954
253 Ga0500559_0038241 3300053136 Bacteria 2083
254 Ga0500568_0040640 3300053139 Bacteria 1871
255 Ga0500588_0333196 3300053146 Bacteria 576
256 Ga0500603_004312 3300053150 Unclassified 3044
257 Ga0500603_025244 3300053150 Bacteria 1493
258 Ga0500619_000245 3300053154 Bacteria 11792
259 Ga0500619_110428 3300053154 Bacteria 936
260 Ga0500630_275617 3300053159 Unclassified 569
261 Ga0500638_000008 3300053162 Bacteria 116543
262 Ga0500638_120690 3300053162 Bacteria 1200
263 Ga0500639_000756 3300053163 Bacteria 16446
264 Ga0500636_0000043 3300053177 Bacteria 68842
265 Ga0500636_0073390 3300053177 Bacteria 1982
266 Ga0500637_0000001 3300053178 Bacteria 410006
267 Ga0500637_0459841 3300053178 Bacteria 643
268 Ga0500637_0597940 3300053178 Bacteria 523
269 Ga0500601_000004 3300053737 Bacteria 69018
270 Ga0500601_002895 3300053737 Bacteria 1852
271 Ga0501084_1565851 3300054114 Bacteria 551
272 Ga0500661_034111 3300055283 Bacteria 899
273 Ga0530510_0901074 3300061734 Unclassified 676
274 Ga0265329_10008128
275 Ga0070658_10190782
276 Ga0068869_100149570
277 Ga0070660_100613417
278 Ga0070689_100942204
279 Ga0070687_100515448
280 Ga0070671_101410942
281 Ga0070667_100560967
282 Ga0070713_100860308
283 Ga0070701_10521544
284 Ga0070711_100616324
285 Ga0070711_101398259
286 Ga0070705_100293121
287 Ga0070694_100489503
288 Ga0070708_100166246
289 Ga0070708_100705974
290 Ga0070662_100555470
291 Ga0070685_11264534
292 Ga0070706_100306793
293 Ga0070707_100002155
294 Ga0070707_100082051
295 Ga0070698_100004430
296 Ga0070698_101319569
297 Ga0070699_100000533
298 Ga0070679_100300194
299 Ga0070684_100209388
300 Ga0070697_100155513
301 Ga0070697_100291082
302 Ga0070697_100540649
303 Ga0070697_100588786
304 Ga0070696_100138680
305 Ga0070696_100734869
306 Ga0070696_101440488
307 Ga0070665_100005897
308 Ga0070704_100070699
309 Ga0070704_101109260
310 Ga0068857_100414030
311 Ga0068856_100273463
312 Ga0070702_101284006
313 Ga0068859_100111141
314 Ga0068864_100151477
315 Ga0068864_100398606
316 Ga0068864_101334886
317 Ga0068870_10311685
318 Ga0068863_100709963
319 Ga0068860_100390998
320 Ga0068860_100881098
321 Ga0068862_100380790
322 Ga0068862_100933773
323 Ga0081455_10025241
324 Ga0070717_10067446
325 Ga0075363_100628090
326 Ga0075366_10000266
327 Ga0097621_100510674
328 Ga0097621_100788157
329 Ga0068871_101709311
330 Ga0075428_100223018
331 Ga0075428_101594344
332 Ga0075433_10308070
333 Ga0075433_11042089
334 Ga0075434_100018068
335 Ga0075434_101053609
336 Ga0075429_100083370
337 Ga0068865_100050698
338 Ga0075436_100307047
339 Ga0075436_101470560
340 Ga0097620_100111153
341 Ga0099794_10243621
342 Ga0105245_10000081
343 Ga0105245_10051423
344 Ga0105247_10000026
345 Ga0114129_10221713
346 Ga0114129_11086922
347 Ga0114129_12668891
348 Ga0105243_10080160
349 Ga0105243_12317927
350 Ga0105242_10523068
351 Ga0105242_13054531
352 Ga0105248_10013085
353 Ga0105238_10490019
354 Ga0105249_10325954
355 Ga0105249_10425899
356 Ga0105239_10630304
357 Ga0157374_10394467
358 Ga0157378_12446393
359 Ga0163162_10000022
360 Ga0163162_12755879
361 Ga0163163_12222502
362 Ga0157380_11267043
363 Ga0157379_10077005
364 Ga0157376_10000268
365 Ga0157376_10002736
366 Ga0157376_10205978
367 Ga0157376_10219179
368 Ga0157376_10828987
369 Ga0157376_11688692
370 Ga0207710_10000039
371 Ga0207643_10094866
372 Ga0207684_10350822
373 Ga0207663_10498934
374 Ga0207660_10558022
375 Ga0207662_10790791
376 Ga0207657_10527406
377 Ga0207652_10816758
378 Ga0207646_10001754
379 Ga0207646_10453835
380 Ga0207694_10081585
381 Ga0207650_10257296
382 Ga0207687_10001036
383 Ga0207687_10106232
384 Ga0207700_11942606
385 Ga0207686_11041077
386 Ga0207686_11689857
387 Ga0207670_10781191
388 Ga0207670_11246509
389 Ga0207704_10036823
390 Ga0207711_10088416
391 Ga0207689_10596668
392 Ga0207712_10497912
393 Ga0207668_10741430
394 Ga0207677_11521175
395 Ga0207703_10613928
396 Ga0207703_12306085
397 Ga0207708_11446120
398 Ga0207641_10027485
399 Ga0207676_10952157
400 Ga0207428_10050986
401 Ga0268266_10516640
402 Ga0268265_11002750
403 Ga0268264_10238860
404 Ga0268264_10787249
405 Ga0265334_10035533
406 Ga0265322_10123064
407 Ga0307517_10040433
408 Ga0307515_10049222
409 Ga0265338_10001777
410 Ga0265338_10012619
411 Ga0265338_10048530
412 Ga0265330_10017659
413 Ga0265330_10025669
414 Ga0265332_10011387
415 Ga0265332_10067319
416 Ga0265328_10077929
417 Ga0265325_10000811
418 Ga0265329_10008724
419 Ga0265329_10062768
420 Ga0265340_10089098
421 Ga0265339_10001763
422 Ga0265339_10186383
423 Ga0265331_10003812
424 Ga0265331_10014343
425 Ga0265316_10000001
426 Ga0307513_10006935
427 Ga0307509_10003565
428 Ga0307509_10472130
429 Ga0307509_10485818
430 Ga0307509_10554330
431 Ga0265313_10000209
432 Ga0265313_10063845
433 Ga0265313_10082932
434 Ga0307508_10020283
435 Ga0307508_10711695
436 Ga0265314_10002106
437 Ga0265314_10481396
438 Ga0265342_10017922
439 Ga0265342_10032870
440 Ga0316576_10001725
441 Ga0307516_10265825
442 Ga0307516_10511605
443 Ga0373940_0031466
444 Ga0373949_0000357
445 Ga0373949_0216671
446 Ga0373936_0000016
447 Ga0373936_0018502
448 Ga0373941_0014786
449 Ga0373941_0262956
450 Ga0373954_0123459
451 Ga0373943_0006793
452 Ga0373961_0000110
453 Ga0373931_0263082
454 Ga0373935_0175274
455 Ga0373933_0155034
456 Ga0373947_0294035
457 Ga0373937_0059834
458 Ga0373925_0862713
459 Ga0395905_0087052
460 Ga0395905_0161045
461 Ga0436365_0499309
462 Ga0436363_1164933
463 Ga0451789_0985561
464 Ga0451807_0257923
465 Ga0451853_0278034
466 Ga0451577_0367617
467 Ga0451577_1717824
468 Ga0495590_0068823
469 Ga0495630_0639000
470 Ga0495643_0123396
471 Ga0495622_0075187
472 Ga0495611_0178337
473 Ga0495649_0323902
474 Ga0496101_0549602
475 Ga0496108_0687717
476 Ga0501292_017831
477 Ga0501297_030894
478 Ga0501299_011245
479 Ga0501034_0064811
480 Ga0501037_0586475
481 Ga0501040_0554252
482 Ga0501047_0258972
483 Ga0501070_0240573
484 Ga0501070_1310006
485 Ga0501071_0924946
486 Ga0501073_0962415
487 Ga0501074_0050157
488 Ga0501202_143394
489 Ga0501216_037309
490 Ga0501217_078283
491 Ga0501227_000168
492 Ga0501230_002090
493 Ga0501230_012399
494 Ga0501233_124405
495 Ga0501221_102413
496 Ga0501225_0002888
497 Ga0501044_0390104
498 nmdc:mga0k408_327_c1
499 nmdc:mga05p37_1186945_c1
500 nmdc:mga09592_358886_c1
501 nmdc:mga0qj67_1120772_c1
502 nmdc:mga08y16_737238_c1
503 nmdc:mga0n895_274975_c1
504 nmdc:mga0n895_5862_c1
505 nmdc:mga0rr50_723629_c1
506 nmdc:mga0a205_137423_c1
507 nmdc:mga0a205_832794_c1
508 Ga0500635_0000068
509 Ga0500578_0031878
510 Ga0500646_0010586
511 Ga0500647_0017922
512 Ga0500647_0410689
513 Ga0500583_0047195
514 Ga0500583_0605628
515 Ga0500566_0002288
516 Ga0500640_001874
517 Ga0500654_046348
518 Ga0500554_000304
519 Ga0500556_0338894
520 Ga0500572_001855
521 Ga0500591_158235
522 Ga0500595_000140
523 Ga0500595_002001
524 Ga0500597_034114
525 Ga0500607_062074
526 Ga0500559_0038241
527 Ga0500568_0040640
528 Ga0500588_0333196
529 Ga0500603_004312
530 Ga0500603_025244
531 Ga0500619_000245
532 Ga0500619_110428
533 Ga0500630_275617
534 Ga0500638_000008
535 Ga0500638_120690
536 Ga0500639_000756
537 Ga0500636_0000043
538 Ga0500636_0073390
539 Ga0500637_0000001
540 Ga0500637_0459841
541 Ga0500637_0597940
542 Ga0500601_000004
543 Ga0500601_002895
544 Ga0501084_1565851
545 Ga0500661_034111
546 Ga0530510_0901074

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

31

103

0.88

PF01050

MannoseP_isomer

Mannose-6-phosphate isomerase C-terminal

5

116

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fli-assembly1.cif.gz_K enzyme-substrate complex of ni-quercetinase 0.9285 3 96
6v7j-assembly1.cif.gz_A the c2221 crystal form of canavalin at 173 k 0.9212 20 96
2cav-assembly1.cif.gz_A canavalin from jack bean 0.9182 20 98
1uik-assembly1.cif.gz_B crystal structure of soybean beta-conglycinin alpha prime homotrimer 0.9163 20 98
1ipj-assembly1.cif.gz_B crystal structures of recombinant and native soybean beta-conglycinin beta homotrimers complexes with n-acetyl-d-glucosamine 0.916 20 98
ID Description Score Start End Superfamily
af_Q9S772_37_227_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9188 20 96 2.60.120.10
5wxuB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9031 16 97 2.60.120.10
af_I1KSR6_198_361_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8954 20 96 2.60.120.10
5fljL00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8951 3 97 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8942 1 98 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A535L673-F1-model_v4 Cupin domain-containing protein 0.9963 3 114 GO:0005976
GO:0016779
AF-A0A535GNZ4-F1-model_v4 Cupin domain-containing protein 0.9942 3 113
AF-A0A536R2W2-F1-model_v4 Cupin domain-containing protein 0.9936 17 113
AF-A0A535DAM6-F1-model_v4 Cupin domain-containing protein 0.9926 2 114
AF-A0A7V9P3J9-F1-model_v4 Cupin domain-containing protein 0.9918 2 114

Map