F379045

General Info

Members Datasets Scaffolds Average Seq Length
273 197 546 110

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10603265|Ga0157380_106032651
Length 133
Sequence MWDDSVVLHTAHSANHPTKKEHTPMAEGMSTLTDSTFDEEIGSATEAVVVDFWAEWCGPCKMITPILEEIASEHAGKVKIAKVNVDDNPNVTRRFEVMSIPTLIVFQDGQPVRRMIGAKGKGQLLQELSEFIA

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300019176 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
49 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
70 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
71 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
80 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
81 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
82 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
83 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
84 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
92 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
93 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
94 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
95 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
96 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
97 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
98 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
99 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
100 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
101 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
102 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
103 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
104 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
105 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
106 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
119 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
175 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
190 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
191 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
192 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.91
Metatranscriptomes 12.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.62
Nodule 0
Rhizoplane 3.66
Rhizosphere 82.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10603265 3300014326 Bacteria 1087
2 Ga0070670_101135697 3300005331 Bacteria 713
3 Ga0070666_10562462 3300005335 Bacteria 830
4 Ga0070666_11053662 3300005335 Bacteria 604
5 Ga0068868_101011035 3300005338 Bacteria 761
6 Ga0070669_100887472 3300005353 Bacteria 761
7 Ga0070675_101877266 3300005354 Bacteria 553
8 Ga0070671_100231087 3300005355 Bacteria 1569
9 Ga0070674_100530051 3300005356 Bacteria 985
10 Ga0070673_100264089 3300005364 Bacteria 1505
11 Ga0070673_101118454 3300005364 Bacteria 736
12 Ga0070659_100868918 3300005366 Bacteria 787
13 Ga0070705_101208925 3300005440 Bacteria 623
14 Ga0070708_101295608 3300005445 Bacteria 681
15 Ga0070678_102379270 3300005456 Bacteria 503
16 Ga0068867_101985185 3300005459 Bacteria 550
17 Ga0070706_100164154 3300005467 Bacteria 2074
18 Ga0070699_101021574 3300005518 Bacteria 758
19 Ga0070679_100393008 3300005530 Bacteria 1333
20 Ga0070697_100435986 3300005536 Bacteria 1140
21 Ga0070664_101873839 3300005564 Bacteria 569
22 Ga0068860_101499378 3300005843 Bacteria 696
23 Ga0081455_10003776 3300005937 Bacteria 17291
24 Ga0081455_10167778 3300005937 Bacteria 1675
25 Ga0081538_10000904 3300005981 Bacteria 32062
26 Ga0081538_10003160 3300005981 Bacteria 15663
27 Ga0075365_10008046 3300006038 Bacteria 5953
28 Ga0075365_10051162 3300006038 Bacteria 2727
29 Ga0075365_10154794 3300006038 Bacteria 1595
30 Ga0075365_10316288 3300006038 Bacteria 1099
31 Ga0075365_10425810 3300006038 Bacteria 937
32 Ga0075365_10520130 3300006038 Bacteria 841
33 Ga0075365_10905897 3300006038 Bacteria 622
34 Ga0075368_10085802 3300006042 Bacteria 1284
35 Ga0075367_10064224 3300006178 Bacteria 2196
36 Ga0075367_10125059 3300006178 Bacteria 1586
37 Ga0075367_10441336 3300006178 Bacteria 825
38 Ga0097621_100606486 3300006237 Bacteria 1001
39 Ga0075370_10304639 3300006353 Bacteria 948
40 Ga0075428_100401725 3300006844 Bacteria 1468
41 Ga0075430_100123904 3300006846 Bacteria 2154
42 Ga0075430_100132350 3300006846 Bacteria 2078
43 Ga0075430_101564147 3300006846 Bacteria 542
44 Ga0075431_100139688 3300006847 Bacteria 2497
45 Ga0075431_100270946 3300006847 Bacteria 1720
46 Ga0075431_100364167 3300006847 Bacteria 1452
47 Ga0075429_100558087 3300006880 Bacteria 1004
48 Ga0068865_100377117 3300006881 Bacteria 1156
49 Ga0111539_10436781 3300009094 Bacteria 1524
50 Ga0111539_11924873 3300009094 Bacteria 686
51 Ga0105245_10001607 3300009098 Bacteria 20549
52 Ga0105245_10681221 3300009098 Bacteria 1060
53 Ga0105245_11958517 3300009098 Bacteria 639
54 Ga0105247_11056516 3300009101 Bacteria 638
55 Ga0114129_10297220 3300009147 Bacteria 2153
56 Ga0105242_10030930 3300009176 Bacteria 4275
57 Ga0105238_11004750 3300009551 Bacteria 855
58 Ga0105239_10947082 3300010375 Bacteria 989
59 Ga0157371_10340466 3300013102 Bacteria 1091
60 Ga0157378_10032687 3300013297 Bacteria 4597
61 Ga0157378_10583775 3300013297 Bacteria 1127
62 Ga0157378_11111240 3300013297 Bacteria 828
63 Ga0163162_10370867 3300013306 Bacteria 1564
64 Ga0157375_10654353 3300013308 Bacteria 1207
65 Ga0157379_10177643 3300014968 Bacteria 1923
66 Ga0157376_10140646 3300014969 Bacteria 2165
67 Ga0157376_10639710 3300014969 Bacteria 1063
68 Ga0184596_107048 3300019176 Bacteria 634
69 Ga0197907_11248575 3300020069 Bacteria 564
70 Ga0206355_1661685 3300020076 Bacteria 949
71 Ga0206352_10172138 3300020078 Bacteria 837
72 Ga0206350_10217539 3300020080 Bacteria 1019
73 Ga0206354_10097616 3300020081 Bacteria 554
74 Ga0206353_11681997 3300020082 Bacteria 660
75 Ga0154015_1156867 3300020610 Bacteria 628
76 Ga0207680_10695520 3300025903 Bacteria 728
77 Ga0207684_10902971 3300025910 Bacteria 743
78 Ga0207652_10385374 3300025921 Bacteria 1265
79 Ga0207694_10964388 3300025924 Bacteria 721
80 Ga0207650_10968004 3300025925 Bacteria 723
81 Ga0207659_10188658 3300025926 Bacteria 1639
82 Ga0207687_10147542 3300025927 Bacteria 1791
83 Ga0207644_10028950 3300025931 Bacteria 3839
84 Ga0207686_10705631 3300025934 Bacteria 802
85 Ga0207704_10516657 3300025938 Bacteria 965
86 Ga0207691_11285021 3300025940 Bacteria 605
87 Ga0207651_10352389 3300025960 Bacteria 1240
88 Ga0207677_10885774 3300026023 Bacteria 804
89 Ga0207677_11514142 3300026023 Bacteria 620
90 Ga0207703_10009267 3300026035 Bacteria 7740
91 Ga0207648_11661693 3300026089 Bacteria 600
92 Ga0209813_10037814 3300027866 Bacteria 1456
93 Ga0310981_1015789 3300029285 Bacteria 549
94 Ga0316579_10432443 3300031691 Bacteria 637
95 Ga0316576_10054204 3300031727 Bacteria 2924
96 Ga0316578_10037044 3300031728 Bacteria 2809
97 Ga0316578_10242424 3300031728 Bacteria 1082
98 Ga0307416_103751181 3300032002 Bacteria 509
99 Ga0316593_10159269 3300032168 Bacteria 824
100 Ga0316588_1095711 3300033528 Bacteria 742
101 Ga0316587_1114330 3300033529 Bacteria 526
102 Ga0316596_1024074 3300033541 Bacteria 1562
103 Ga0373930_0013201 3300034816 Bacteria 1519
104 Ga0373948_0004252 3300034817 Bacteria 2253
105 Ga0373928_0006588 3300035084 Bacteria 2233
106 Ga0373929_0005559 3300035085 Bacteria 2271
107 Ga0373932_0000332 3300035112 Bacteria 14409
108 Ga0373932_0022102 3300035112 Bacteria 1686
109 Ga0316574_0090789 3300035398 Bacteria 1947
110 Ga0373931_0000006 3300035691 Bacteria 437006
111 Ga0373931_0000014 3300035691 Bacteria 251374
112 Ga0373947_0483501 3300035725 Bacteria 840
113 Ga0373937_0291369 3300036401 Bacteria 1542
114 Ga0316584_0001989 3300036712 Bacteria 12754
115 Ga0373925_0834083 3300037068 Bacteria 760
116 Ga0373925_0878300 3300037068 Bacteria 739
117 Ga0436365_0456756 3300039437 Bacteria 999
118 Ga0436365_1369187 3300039437 Bacteria 571
119 Ga0436365_1518193 3300039437 Bacteria 528
120 Ga0436365_1582673 3300039437 Bacteria 559
121 Ga0436365_1937088 3300039437 Bacteria 6674
122 Ga0451793_1816774 3300041452 Bacteria 582
123 Ga0451797_0277535 3300041453 Bacteria 1571
124 Ga0451797_1389359 3300041453 Bacteria 571
125 Ga0451797_1528848 3300041453 Bacteria 592
126 Ga0451798_0661493 3300041458 Bacteria 615
127 Ga0451807_1885723 3300041486 Bacteria 619
128 Ga0451837_1149716 3300041494 Bacteria 1111
129 Ga0451837_1674216 3300041494 Bacteria 525
130 Ga0451843_0603292 3300041509 Bacteria 582
131 Ga0451853_2272293 3300041512 Bacteria 546
132 Ga0439443_014328 3300042003 Bacteria 1193
133 Ga0439448_0006729 3300042005 Bacteria 3312
134 Ga0439449_0211342 3300042007 Bacteria 727
135 Ga0439450_003956 3300042008 Bacteria 2493
136 Ga0439463_002560 3300042016 Bacteria 4614
137 Ga0439446_0184177 3300042156 Bacteria 699
138 Ga0439435_0090130 3300042436 Bacteria 931
139 Ga0439464_0010462 3300042439 Bacteria 2449
140 Ga0439460_0002657 3300042461 Bacteria 4320
141 Ga0451577_0085709 3300042876 Bacteria 2810
142 Ga0439440_0002739 3300042993 Bacteria 3343
143 Ga0453683_1158978 3300044673 Bacteria 516
144 Ga0453684_0101486 3300044712 Bacteria 3520
145 Ga0451576_0699735 3300045051 Bacteria 1065
146 Ga0495592_0117397 3300046454 Bacteria 1876
147 Ga0495629_0365650 3300046459 Bacteria 983
148 Ga0495629_0388700 3300046459 Bacteria 949
149 Ga0495639_0121083 3300046475 Bacteria 1248
150 Ga0495583_0082774 3300046506 Bacteria 1392
151 Ga0495628_0936652 3300046516 Bacteria 599
152 Ga0495630_0046744 3300046517 Bacteria 3236
153 Ga0495666_0173980 3300046526 Bacteria 995
154 Ga0495621_0019236 3300046539 Bacteria 2229
155 Ga0495667_0017607 3300046559 Bacteria 4826
156 Ga0495634_0157477 3300046642 Bacteria 1434
157 Ga0495647_0039628 3300046681 Bacteria 1787
158 Ga0495647_0454987 3300046681 Bacteria 593
159 Ga0495658_0107859 3300046683 Bacteria 1671
160 Ga0495658_0588617 3300046683 Bacteria 713
161 Ga0495669_0276828 3300046684 Bacteria 807
162 Ga0495613_0004046 3300046689 Bacteria 10965
163 Ga0495613_0065170 3300046689 Bacteria 2663
164 Ga0495613_0228095 3300046689 Bacteria 1306
165 Ga0495581_0412709 3300047315 Bacteria 787
166 Ga0495581_0762296 3300047315 Bacteria 556
167 Ga0495676_0255869 3300047321 Bacteria 1193
168 Ga0495602_0855495 3300048088 Bacteria 608
169 Ga0495614_0029217 3300048089 Bacteria 2373
170 Ga0495614_0394647 3300048089 Bacteria 649
171 Ga0495614_0469327 3300048089 Bacteria 597
172 Ga0496101_0219645 3300048904 Bacteria 1475
173 Ga0496102_1663786 3300048905 Bacteria 556
174 Ga0496104_0677123 3300048907 Bacteria 940
175 Ga0496114_0791318 3300048917 Bacteria 827
176 Ga0501306_019699 3300049127 Bacteria 932
177 Ga0501306_029865 3300049127 Bacteria 805
178 Ga0501306_091501 3300049127 Bacteria 535
179 Ga0501309_029979 3300049129 Bacteria 799
180 Ga0501309_047816 3300049129 Bacteria 666
181 Ga0501310_003494 3300049130 Bacteria 1536
182 Ga0501305_052340 3300049161 Bacteria 688
183 Ga0501307_081715 3300049162 Bacteria 529
184 Ga0501312_032152 3300049528 Bacteria 827
185 Ga0501313_067638 3300049529 Bacteria 514
186 Ga0501315_027485 3300049531 Bacteria 803
187 Ga0501316_047926 3300049532 Bacteria 609
188 Ga0501316_060691 3300049532 Bacteria 559
189 Ga0501317_039992 3300049533 Bacteria 713
190 Ga0501318_074898 3300049534 Bacteria 540
191 Ga0501321_047376 3300049537 Bacteria 620
192 Ga0501321_086671 3300049537 Bacteria 506
193 Ga0501323_043033 3300049539 Bacteria 667
194 Ga0501031_0673075 3300049568 Bacteria 665
195 Ga0501032_0633523 3300049569 Bacteria 679
196 Ga0501034_0001006 3300049571 Bacteria 40430
197 Ga0501036_0388897 3300049572 Bacteria 1164
198 Ga0501037_0006714 3300049573 Bacteria 8418
199 Ga0501039_0256273 3300049575 Bacteria 1375
200 Ga0501039_0474271 3300049575 Bacteria 983
201 Ga0501039_1262933 3300049575 Bacteria 570
202 Ga0501040_0043845 3300049576 Bacteria 3049
203 Ga0501040_1143908 3300049576 Bacteria 565
204 Ga0501041_0081071 3300049577 Bacteria 1998
205 Ga0501041_0595615 3300049577 Bacteria 705
206 Ga0501042_0275828 3300049578 Bacteria 1214
207 Ga0501048_0042735 3300049582 Bacteria 3244
208 Ga0501048_0153028 3300049582 Bacteria 1632
209 Ga0501067_0065712 3300049583 Bacteria 2008
210 Ga0501067_0347129 3300049583 Bacteria 827
211 Ga0501068_0000013 3300049584 Bacteria 62800
212 Ga0501068_0039625 3300049584 Bacteria 2826
213 Ga0501070_1004538 3300049586 Bacteria 647
214 Ga0501071_0134701 3300049587 Bacteria 1837
215 Ga0501071_0150026 3300049587 Bacteria 1739
216 Ga0501071_0490229 3300049587 Bacteria 942
217 Ga0501072_0000895 3300049588 Bacteria 21852
218 Ga0501072_0042983 3300049588 Bacteria 3551
219 Ga0501072_0151410 3300049588 Bacteria 1849
220 Ga0501073_0000120 3300049589 Bacteria 50628
221 Ga0501073_1022861 3300049589 Bacteria 568
222 Ga0501074_0000469 3300049590 Bacteria 24394
223 Ga0501074_0740186 3300049590 Bacteria 693
224 Ga0501075_0043320 3300049591 Bacteria 3376
225 Ga0501075_0957402 3300049591 Bacteria 650
226 Ga0501075_0991911 3300049591 Bacteria 638
227 Ga0501076_0047245 3300049592 Bacteria 3403
228 Ga0501077_0677256 3300049593 Bacteria 663
229 Ga0501217_276745 3300049661 Bacteria 548
230 Ga0501079_0012402 3300049741 Bacteria 6504
231 Ga0501079_0122669 3300049741 Bacteria 2021
232 Ga0501080_0129121 3300049742 Bacteria 2340
233 Ga0501081_0065478 3300049743 Bacteria 2526
234 Ga0501083_0874202 3300049744 Bacteria 585
235 Ga0501083_0949783 3300049744 Bacteria 559
236 Ga0501035_0383906 3300049822 Bacteria 1171
237 Ga0501045_0029831 3300049824 Bacteria 3944
238 Ga0501045_0861204 3300049824 Bacteria 666
239 nmdc:mga03683_195586_c1 3300050489 Bacteria 926
240 nmdc:mga03n38_364995_c1 3300050490 Bacteria 788
241 nmdc:mga00v17_799505_c1 3300050491 Bacteria 601
242 nmdc:mga0yw44_18906_c1 3300050492 Bacteria 3786
243 nmdc:mga0yw44_267_c1 3300050492 Bacteria 15520
244 nmdc:mga0yw44_397972_c1 3300050492 Bacteria 931
245 nmdc:mga06z11_368398_c1 3300050494 Bacteria 862
246 nmdc:mga06z11_95593_c1 3300050494 Bacteria 1621
247 nmdc:mga04h51_22297_c1 3300050495 Bacteria 1914
248 nmdc:mga07m45_621949_c1 3300050496 Bacteria 623
249 nmdc:mga05p37_163463_c1 3300050507 Bacteria 2718
250 nmdc:mga05p37_164602_c1 3300050507 Bacteria 2707
251 nmdc:mga09592_116489_c1 3300050508 Bacteria 2293
252 nmdc:mga0qj67_110766_c1 3300050509 Bacteria 2216
253 nmdc:mga06r32_101601_c1 3300050510 Bacteria 2822
254 nmdc:mga06r32_146250_c1 3300050510 Bacteria 2341
255 nmdc:mga06r32_321203_c1 3300050510 Bacteria 1534
256 nmdc:mga08y16_158964_c1 3300050511 Bacteria 2348
257 nmdc:mga08y16_627144_c1 3300050511 Bacteria 1081
258 Ga0500635_0019494 3300053080 Bacteria 2062
259 Ga0495595_0136678 3300053084 Bacteria 1201
260 Ga0495619_0032460 3300053085 Bacteria 3389
261 Ga0500646_0066778 3300053090 Bacteria 1071
262 Ga0500566_0370724 3300053094 Bacteria 650
263 Ga0500555_123896 3300053103 Bacteria 644
264 Ga0500616_0001367 3300053153 Bacteria 23706
265 Ga0500616_0377291 3300053153 Bacteria 571
266 Ga0501084_0015632 3300054114 Bacteria 6294
267 Ga0501084_0117963 3300054114 Bacteria 2231
268 Ga0587082_124832 3300059504 Bacteria 585
269 Ga0587114_078976 3300059655 Bacteria 609
270 Ga0501082_0107119 3300060353 Bacteria 2418
271 Ga0501082_0811587 3300060353 Bacteria 818
272 Ga0530510_0001559 3300061734 Bacteria 15477
273 Ga0530510_0029265 3300061734 Bacteria 3953
274 Ga0157380_10603265
275 Ga0070670_101135697
276 Ga0070666_10562462
277 Ga0070666_11053662
278 Ga0068868_101011035
279 Ga0070669_100887472
280 Ga0070675_101877266
281 Ga0070671_100231087
282 Ga0070674_100530051
283 Ga0070673_100264089
284 Ga0070673_101118454
285 Ga0070659_100868918
286 Ga0070705_101208925
287 Ga0070708_101295608
288 Ga0070678_102379270
289 Ga0068867_101985185
290 Ga0070706_100164154
291 Ga0070699_101021574
292 Ga0070679_100393008
293 Ga0070697_100435986
294 Ga0070664_101873839
295 Ga0068860_101499378
296 Ga0081455_10003776
297 Ga0081455_10167778
298 Ga0081538_10000904
299 Ga0081538_10003160
300 Ga0075365_10008046
301 Ga0075365_10051162
302 Ga0075365_10154794
303 Ga0075365_10316288
304 Ga0075365_10425810
305 Ga0075365_10520130
306 Ga0075365_10905897
307 Ga0075368_10085802
308 Ga0075367_10064224
309 Ga0075367_10125059
310 Ga0075367_10441336
311 Ga0097621_100606486
312 Ga0075370_10304639
313 Ga0075428_100401725
314 Ga0075430_100123904
315 Ga0075430_100132350
316 Ga0075430_101564147
317 Ga0075431_100139688
318 Ga0075431_100270946
319 Ga0075431_100364167
320 Ga0075429_100558087
321 Ga0068865_100377117
322 Ga0111539_10436781
323 Ga0111539_11924873
324 Ga0105245_10001607
325 Ga0105245_10681221
326 Ga0105245_11958517
327 Ga0105247_11056516
328 Ga0114129_10297220
329 Ga0105242_10030930
330 Ga0105238_11004750
331 Ga0105239_10947082
332 Ga0157371_10340466
333 Ga0157378_10032687
334 Ga0157378_10583775
335 Ga0157378_11111240
336 Ga0163162_10370867
337 Ga0157375_10654353
338 Ga0157379_10177643
339 Ga0157376_10140646
340 Ga0157376_10639710
341 Ga0184596_107048
342 Ga0197907_11248575
343 Ga0206355_1661685
344 Ga0206352_10172138
345 Ga0206350_10217539
346 Ga0206354_10097616
347 Ga0206353_11681997
348 Ga0154015_1156867
349 Ga0207680_10695520
350 Ga0207684_10902971
351 Ga0207652_10385374
352 Ga0207694_10964388
353 Ga0207650_10968004
354 Ga0207659_10188658
355 Ga0207687_10147542
356 Ga0207644_10028950
357 Ga0207686_10705631
358 Ga0207704_10516657
359 Ga0207691_11285021
360 Ga0207651_10352389
361 Ga0207677_10885774
362 Ga0207677_11514142
363 Ga0207703_10009267
364 Ga0207648_11661693
365 Ga0209813_10037814
366 Ga0310981_1015789
367 Ga0316579_10432443
368 Ga0316576_10054204
369 Ga0316578_10037044
370 Ga0316578_10242424
371 Ga0307416_103751181
372 Ga0316593_10159269
373 Ga0316588_1095711
374 Ga0316587_1114330
375 Ga0316596_1024074
376 Ga0373930_0013201
377 Ga0373948_0004252
378 Ga0373928_0006588
379 Ga0373929_0005559
380 Ga0373932_0000332
381 Ga0373932_0022102
382 Ga0316574_0090789
383 Ga0373931_0000006
384 Ga0373931_0000014
385 Ga0373947_0483501
386 Ga0373937_0291369
387 Ga0316584_0001989
388 Ga0373925_0834083
389 Ga0373925_0878300
390 Ga0436365_0456756
391 Ga0436365_1369187
392 Ga0436365_1518193
393 Ga0436365_1582673
394 Ga0436365_1937088
395 Ga0451793_1816774
396 Ga0451797_0277535
397 Ga0451797_1389359
398 Ga0451797_1528848
399 Ga0451798_0661493
400 Ga0451807_1885723
401 Ga0451837_1149716
402 Ga0451837_1674216
403 Ga0451843_0603292
404 Ga0451853_2272293
405 Ga0439443_014328
406 Ga0439448_0006729
407 Ga0439449_0211342
408 Ga0439450_003956
409 Ga0439463_002560
410 Ga0439446_0184177
411 Ga0439435_0090130
412 Ga0439464_0010462
413 Ga0439460_0002657
414 Ga0451577_0085709
415 Ga0439440_0002739
416 Ga0453683_1158978
417 Ga0453684_0101486
418 Ga0451576_0699735
419 Ga0495592_0117397
420 Ga0495629_0365650
421 Ga0495629_0388700
422 Ga0495639_0121083
423 Ga0495583_0082774
424 Ga0495628_0936652
425 Ga0495630_0046744
426 Ga0495666_0173980
427 Ga0495621_0019236
428 Ga0495667_0017607
429 Ga0495634_0157477
430 Ga0495647_0039628
431 Ga0495647_0454987
432 Ga0495658_0107859
433 Ga0495658_0588617
434 Ga0495669_0276828
435 Ga0495613_0004046
436 Ga0495613_0065170
437 Ga0495613_0228095
438 Ga0495581_0412709
439 Ga0495581_0762296
440 Ga0495676_0255869
441 Ga0495602_0855495
442 Ga0495614_0029217
443 Ga0495614_0394647
444 Ga0495614_0469327
445 Ga0496101_0219645
446 Ga0496102_1663786
447 Ga0496104_0677123
448 Ga0496114_0791318
449 Ga0501306_019699
450 Ga0501306_029865
451 Ga0501306_091501
452 Ga0501309_029979
453 Ga0501309_047816
454 Ga0501310_003494
455 Ga0501305_052340
456 Ga0501307_081715
457 Ga0501312_032152
458 Ga0501313_067638
459 Ga0501315_027485
460 Ga0501316_047926
461 Ga0501316_060691
462 Ga0501317_039992
463 Ga0501318_074898
464 Ga0501321_047376
465 Ga0501321_086671
466 Ga0501323_043033
467 Ga0501031_0673075
468 Ga0501032_0633523
469 Ga0501034_0001006
470 Ga0501036_0388897
471 Ga0501037_0006714
472 Ga0501039_0256273
473 Ga0501039_0474271
474 Ga0501039_1262933
475 Ga0501040_0043845
476 Ga0501040_1143908
477 Ga0501041_0081071
478 Ga0501041_0595615
479 Ga0501042_0275828
480 Ga0501048_0042735
481 Ga0501048_0153028
482 Ga0501067_0065712
483 Ga0501067_0347129
484 Ga0501068_0000013
485 Ga0501068_0039625
486 Ga0501070_1004538
487 Ga0501071_0134701
488 Ga0501071_0150026
489 Ga0501071_0490229
490 Ga0501072_0000895
491 Ga0501072_0042983
492 Ga0501072_0151410
493 Ga0501073_0000120
494 Ga0501073_1022861
495 Ga0501074_0000469
496 Ga0501074_0740186
497 Ga0501075_0043320
498 Ga0501075_0957402
499 Ga0501075_0991911
500 Ga0501076_0047245
501 Ga0501077_0677256
502 Ga0501217_276745
503 Ga0501079_0012402
504 Ga0501079_0122669
505 Ga0501080_0129121
506 Ga0501081_0065478
507 Ga0501083_0874202
508 Ga0501083_0949783
509 Ga0501035_0383906
510 Ga0501045_0029831
511 Ga0501045_0861204
512 nmdc:mga03683_195586_c1
513 nmdc:mga03n38_364995_c1
514 nmdc:mga00v17_799505_c1
515 nmdc:mga0yw44_18906_c1
516 nmdc:mga0yw44_267_c1
517 nmdc:mga0yw44_397972_c1
518 nmdc:mga06z11_368398_c1
519 nmdc:mga06z11_95593_c1
520 nmdc:mga04h51_22297_c1
521 nmdc:mga07m45_621949_c1
522 nmdc:mga05p37_163463_c1
523 nmdc:mga05p37_164602_c1
524 nmdc:mga09592_116489_c1
525 nmdc:mga0qj67_110766_c1
526 nmdc:mga06r32_101601_c1
527 nmdc:mga06r32_146250_c1
528 nmdc:mga06r32_321203_c1
529 nmdc:mga08y16_158964_c1
530 nmdc:mga08y16_627144_c1
531 Ga0500635_0019494
532 Ga0495595_0136678
533 Ga0495619_0032460
534 Ga0500646_0066778
535 Ga0500566_0370724
536 Ga0500555_123896
537 Ga0500616_0001367
538 Ga0500616_0377291
539 Ga0501084_0015632
540 Ga0501084_0117963
541 Ga0587082_124832
542 Ga0587114_078976
543 Ga0501082_0107119
544 Ga0501082_0811587
545 Ga0530510_0001559
546 Ga0530510_0029265

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00085

Thioredoxin

Thioredoxin

28

130

0.97

PF13905

Thioredoxin_8

Thioredoxin-like

45

95

0.91

PF00578

AhpC-TSA

AhpC/TSA family

28

133

0.89

PF08534

Redoxin

Redoxin

24

131

0.86

PF13098

Thioredoxin_2

Thioredoxin-like domain

41

128

0.81

PF14595

Thioredoxin_9

Thioredoxin

9

121

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hr1-assembly7.cif.gz_G crystal structure of thioredoxin l107a mutant 0.9922 29 104
6esx-assembly1.cif.gz_A caulobacter crescentus trx1 0.9884 5 106
3nof-assembly1.cif.gz_A mycobacterium tuberculosis thioredoxin c c40s mutant 0.9861 3 108
1nw2-assembly2.cif.gz_F the crystal structure of the mutant r82e of thioredoxin from alicyclobacillus acidocaldarius 0.9848 5 106
4ulx-assembly1.cif.gz_A crystal structure of ancestral thioredoxin, relative to the last common ancestor of the cyanobacterial, deinococcus and thermus groups, lpbca-l89k mutant. 0.9824 5 108
ID Description Score Start End Superfamily
5hr1G00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9922 29 104 3.40.30.10
4ulxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9824 5 108 3.40.30.10
5hr1G00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9794 29 104 3.40.30.10
3dieB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9792 33 108 3.40.30.10
af_Q5JMR9_59_168_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9773 13 106 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A4P5QXD6-F1-model_v4 Thioredoxin 0.9973 1 108 GO:0005829
GO:0015035
GO:0045454
AF-A0A1I7L7T5-F1-model_v4 Thioredoxin 0.9969 5 108 GO:0005829
GO:0015035
GO:0045454
AF-A0A439DNW3-F1-model_v4 Thioredoxin 0.9951 8 108 GO:0005829
GO:0015035
GO:0045454
AF-A0A1V2KF34-F1-model_v4 Thioredoxin 0.9951 6 108 GO:0005829
GO:0015035
GO:0045454
AF-Q58J59-F1-model_v4 Thioredoxin 0.9943 6 106 GO:0005829
GO:0015035
GO:0045454

Map