F378939

General Info

Members Datasets Scaffolds Average Seq Length
273 178 270 118

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100032030|Ga0068858_1000320306
Length 134
Sequence MSRVKRGNVLQKRHKKILKYAKGFRGSKSKIFIAANQAVMRAWRNSFADRRKKKRDYRSLWITRINAACRANGLSYSKFIWANDKLGVTLNRKVLAEVALNDKEAFAALALQAKKLVDKTLAEKVESDTYAVHH

Samples

Sample ID Description Type Environment
1 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
2 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
3 3300002863 Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_12 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
101 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
113 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
114 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
115 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
116 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
117 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
118 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
119 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
120 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
121 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
122 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
123 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
124 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
125 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
126 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
157 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
163 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
164 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
165 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
171 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
172 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
173 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.98
Metatranscriptomes 13.92
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.62
Nodule 0
Rhizoplane 4.4
Rhizosphere 78.02
Stem 0
Stem Tuber 0
Unclassified 6.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006769J43182_104888 3300002863 Bacteria 651
2 Ga0006759J45824_1036100 3300003163 Bacteria 691
3 Ga0006759J45824_1050841 3300003163 Unclassified 750
4 Ga0006758J48902_1010801 3300003300 Bacteria 692
5 Ga0006758J48902_1013436 3300003300 Bacteria 730
6 Ga0006758J48902_1017135 3300003300 Bacteria 878
7 Ga0006770J48903_1027098 3300003305 Bacteria 663
8 rootH1_10021014 3300003323 Bacteria 2161
9 rootH1_10285841 3300003323 Eukaryota 1061
10 Ga0032354_1073388 3300003693 Bacteria 651
11 Ga0065704_10439740 3300005289 Bacteria 715
12 Ga0070690_101289487 3300005330 Bacteria 585
13 Ga0070670_100433601 3300005331 Bacteria 1163
14 Ga0070677_10061155 3300005333 Bacteria 1554
15 Ga0070682_100005462 3300005337 Bacteria 7077
16 Ga0070682_100043826 3300005337 Bacteria 2767
17 Ga0070682_100049034 3300005337 Bacteria 2631
18 Ga0070682_100157267 3300005337 Bacteria 1566
19 Ga0070682_100284281 3300005337 Bacteria 1207
20 Ga0068868_101250124 3300005338 Bacteria 688
21 Ga0070668_100272426 3300005347 Bacteria 1411
22 Ga0070675_100567005 3300005354 Bacteria 1028
23 Ga0070688_100826534 3300005365 Unclassified 726
24 Ga0070667_100988220 3300005367 Bacteria 785
25 Ga0070708_100494945 3300005445 Bacteria 1153
26 Ga0068867_100031965 3300005459 Bacteria 3803
27 Ga0070685_10052734 3300005466 Unclassified 2354
28 Ga0070685_10122749 3300005466 Bacteria 1615
29 Ga0070707_101205007 3300005468 Bacteria 723
30 Ga0070707_101233220 3300005468 Bacteria 714
31 Ga0070684_100288690 3300005535 Bacteria 1504
32 Ga0070684_100697837 3300005535 Bacteria 946
33 Ga0070672_100000117 3300005543 Bacteria 40556
34 Ga0070672_100346059 3300005543 Bacteria 1266
35 Ga0070672_100733730 3300005543 Bacteria 866
36 Ga0070693_100150499 3300005547 Bacteria 1474
37 Ga0070693_101078013 3300005547 Bacteria 611
38 Ga0070665_100014668 3300005548 Bacteria 7864
39 Ga0068855_100000016 3300005563 Bacteria 222591
40 Ga0068855_100147378 3300005563 Bacteria 2678
41 Ga0070664_100908221 3300005564 Bacteria 826
42 Ga0068857_100534413 3300005577 Bacteria 1103
43 Ga0068856_100004582 3300005614 Bacteria 13742
44 Ga0070702_100162158 3300005615 Unclassified 1446
45 Ga0070702_100207188 3300005615 Bacteria 1302
46 Ga0068852_100615520 3300005616 Bacteria 1091
47 Ga0068859_100206371 3300005617 Bacteria 2050
48 Ga0068864_100856216 3300005618 Bacteria 896
49 Ga0068864_101787778 3300005618 Bacteria 620
50 Ga0068861_100009515 3300005719 Bacteria 6714
51 Ga0068861_100243301 3300005719 Bacteria 1531
52 Ga0068863_100275241 3300005841 Unclassified 1630
53 Ga0068863_100863765 3300005841 Bacteria 904
54 Ga0068863_100890407 3300005841 Bacteria 890
55 Ga0068863_101418671 3300005841 Bacteria 702
56 Ga0068858_100032030 3300005842 Unclassified 4884
57 Ga0068858_100998042 3300005842 Bacteria 820
58 Ga0068858_101937874 3300005842 Bacteria 582
59 Ga0068860_100095687 3300005843 Bacteria 2831
60 Ga0068862_100792154 3300005844 Bacteria 925
61 Ga0075364_10211339 3300006051 Unclassified 1316
62 Ga0075362_10120191 3300006177 Unclassified 1243
63 Ga0075362_10376813 3300006177 Bacteria 713
64 Ga0075366_10007686 3300006195 Bacteria 5969
65 Ga0075366_10012895 3300006195 Bacteria 4750
66 Ga0075366_10014133 3300006195 Bacteria 4556
67 Ga0075366_10162735 3300006195 Bacteria 1352
68 Ga0075366_10204590 3300006195 Bacteria 1201
69 Ga0075366_10326646 3300006195 Bacteria 940
70 Ga0075366_10489864 3300006195 Bacteria 760
71 Ga0075366_10527312 3300006195 Bacteria 731
72 Ga0097621_100031265 3300006237 Bacteria 4224
73 Ga0097621_100600122 3300006237 Bacteria 1006
74 Ga0097621_101334056 3300006237 Bacteria 678
75 Ga0097621_101804093 3300006237 Bacteria 583
76 Ga0075370_11031902 3300006353 Bacteria 504
77 Ga0068871_100670847 3300006358 Bacteria 948
78 Ga0068871_101679446 3300006358 Bacteria 602
79 Ga0097620_100206375 3300006931 Bacteria 2050
80 Ga0111539_10011697 3300009094 Bacteria 11012
81 Ga0111539_11468581 3300009094 Bacteria 791
82 Ga0105245_10001855 3300009098 Bacteria 19241
83 Ga0114129_13303484 3300009147 Bacteria 521
84 Ga0105241_10295416 3300009174 Bacteria 1388
85 Ga0105242_12893294 3300009176 Bacteria 530
86 Ga0105248_10002908 3300009177 Bacteria 19007
87 Ga0105248_10585014 3300009177 Bacteria 1259
88 Ga0105249_10980898 3300009553 Bacteria 913
89 Ga0157370_10157582 3300013104 Bacteria 2112
90 Ga0157378_10880332 3300013297 Bacteria 925
91 Ga0157372_13120822 3300013307 Bacteria 529
92 Ga0163163_12405589 3300014325 Bacteria 585
93 Ga0163163_12858080 3300014325 Bacteria 539
94 Ga0157380_10051793 3300014326 Bacteria 3249
95 Ga0157376_10022323 3300014969 Bacteria 4931
96 Ga0157376_10427820 3300014969 Bacteria 1286
97 Ga0163161_11849252 3300017792 Bacteria 537
98 Ga0224712_10223070 3300022467 Bacteria 863
99 Ga0207682_10221129 3300025893 Bacteria 876
100 Ga0207654_10015921 3300025911 Bacteria 3911
101 Ga0207695_10752793 3300025913 Bacteria 854
102 Ga0207657_10489154 3300025919 Bacteria 964
103 Ga0207694_11092897 3300025924 Bacteria 675
104 Ga0207659_10303265 3300025926 Bacteria 1312
105 Ga0207687_10007688 3300025927 Bacteria 7079
106 Ga0207691_10002974 3300025940 Bacteria 16547
107 Ga0207691_10359730 3300025940 Bacteria 1245
108 Ga0207711_10025827 3300025941 Bacteria 4925
109 Ga0207689_11715957 3300025942 Bacteria 520
110 Ga0207661_11572577 3300025944 Bacteria 602
111 Ga0207667_10000099 3300025949 Bacteria 139071
112 Ga0207667_10001917 3300025949 Bacteria 26122
113 Ga0207712_10205623 3300025961 Unclassified 1564
114 Ga0207712_10793361 3300025961 Bacteria 832
115 Ga0207668_10254103 3300025972 Bacteria 1429
116 Ga0207703_10014079 3300026035 Bacteria 6233
117 Ga0207703_12026868 3300026035 Bacteria 552
118 Ga0207702_10280071 3300026078 Bacteria 1576
119 Ga0207641_10223808 3300026088 Unclassified 1746
120 Ga0207641_10603565 3300026088 Bacteria 1075
121 Ga0207641_10741035 3300026088 Unclassified 969
122 Ga0207641_12595193 3300026088 Bacteria 505
123 Ga0207648_10226426 3300026089 Bacteria 1663
124 Ga0207676_10753975 3300026095 Bacteria 947
125 Ga0207675_100000293 3300026118 Bacteria 48222
126 Ga0207675_100339223 3300026118 Bacteria 1471
127 Ga0207675_100634594 3300026118 Bacteria 1073
128 Ga0207683_10554218 3300026121 Bacteria 1063
129 Ga0207698_10319192 3300026142 Bacteria 1454
130 Ga0209999_1044203 3300027543 Bacteria 837
131 Ga0207428_10037557 3300027907 Bacteria 3940
132 Ga0268266_10071209 3300028379 Bacteria 3013
133 Ga0268265_10714923 3300028380 Bacteria 969
134 Ga0268264_10552482 3300028381 Bacteria 1129
135 Ga0265318_10025306 3300028577 Bacteria 2345
136 Ga0307515_10137113 3300028794 Bacteria 2652
137 Ga0265332_10091329 3300031238 Bacteria 1287
138 Ga0265339_10002043 3300031249 Bacteria 14815
139 Ga0265339_10053282 3300031249 Bacteria 2201
140 Ga0265331_10106717 3300031250 Unclassified 1286
141 Ga0265316_10001437 3300031344 Bacteria 25625
142 Ga0307513_10544002 3300031456 Bacteria 874
143 Ga0307513_10600183 3300031456 Unclassified 810
144 Ga0265313_10029780 3300031595 Bacteria 2819
145 Ga0307508_10311880 3300031616 Bacteria 1165
146 Ga0265314_10000001 3300031711 Bacteria 3792860
147 Ga0265314_10039222 3300031711 Unclassified 3415
148 Ga0265342_10491215 3300031712 Unclassified 627
149 Ga0316576_10111915 3300031727 Bacteria 2046
150 Ga0316578_10244149 3300031728 Unclassified 1078
151 Ga0307516_10008910 3300031730 Bacteria 11262
152 Ga0307405_10188579 3300031731 Unclassified 1487
153 Ga0307407_10918490 3300031903 Bacteria 672
154 Ga0307411_10362195 3300032005 Unclassified 1186
155 Ga0307411_10893679 3300032005 Bacteria 789
156 Ga0316588_1111211 3300033528 Bacteria 689
157 Ga0316596_1248430 3300033541 Bacteria 501
158 Ga0373933_0023866 3300035724 Unclassified 3498
159 Ga0395900_0174753 3300037418 Bacteria 2185
160 Ga0395900_0954752 3300037418 Bacteria 779
161 Ga0395900_1686751 3300037418 Bacteria 545
162 Ga0395898_0183418 3300037466 Bacteria 2000
163 Ga0395905_1386223 3300037471 Bacteria 607
164 Ga0451787_295424 3300041441 Unclassified 510
165 Ga0451787_400973 3300041441 Bacteria 1736
166 Ga0451789_1118680 3300041443 Unclassified 958
167 Ga0451790_28281 3300041444 Bacteria 579
168 Ga0451797_0409476 3300041453 Bacteria 3706
169 Ga0451800_0504732 3300041459 Bacteria 583
170 Ga0451802_1084852 3300041460 Bacteria 2540
171 Ga0451805_077609 3300041461 Bacteria 605
172 Ga0451807_0187201 3300041486 Bacteria 14284
173 Ga0451807_0330594 3300041486 Bacteria 1037
174 Ga0451807_1705418 3300041486 Bacteria 2434
175 Ga0451807_1748227 3300041486 Bacteria 1121
176 Ga0451833_0436704 3300041491 Bacteria 1057
177 Ga0451835_0472295 3300041492 Bacteria 2105
178 Ga0451841_0157698 3300041498 Bacteria 1341
179 Ga0451849_0046522 3300041505 Bacteria 7158
180 Ga0451851_0328395 3300041507 Unclassified 580
181 Ga0451852_29961 3300041508 Bacteria 698
182 Ga0451843_1160701 3300041509 Bacteria 1111
183 Ga0451843_1474169 3300041509 Unclassified 895
184 Ga0451843_1570856 3300041509 Unclassified 548
185 Ga0451853_0068542 3300041512 Bacteria 641
186 Ga0451853_0412973 3300041512 Bacteria 11526
187 Ga0451853_2507637 3300041512 Bacteria 781
188 Ga0439445_0007244 3300042004 Bacteria 2570
189 Ga0439445_0231877 3300042004 Bacteria 549
190 Ga0451577_0311146 3300042876 Bacteria 1428
191 Ga0466965_0116554 3300044683 Bacteria 1376
192 Ga0466966_0215391 3300044684 Bacteria 1160
193 Ga0466967_1561462 3300045976 Bacteria 657
194 Ga0501308_082919 3300049128 Bacteria 513
195 Ga0501309_023175 3300049129 Bacteria 881
196 Ga0501309_050291 3300049129 Bacteria 653
197 Ga0501309_079689 3300049129 Bacteria 548
198 Ga0501310_029678 3300049130 Bacteria 721
199 Ga0501310_039806 3300049130 Unclassified 651
200 Ga0501305_040248 3300049161 Bacteria 758
201 Ga0501305_063318 3300049161 Bacteria 640
202 Ga0501307_060244 3300049162 Bacteria 587
203 Ga0501312_050353 3300049528 Bacteria 701
204 Ga0501312_060552 3300049528 Bacteria 655
205 Ga0501313_032211 3300049529 Bacteria 683
206 Ga0501314_022362 3300049530 Bacteria 665
207 Ga0501314_024381 3300049530 Bacteria 646
208 Ga0501315_042263 3300049531 Bacteria 693
209 Ga0501315_053290 3300049531 Bacteria 640
210 Ga0501316_046049 3300049532 Bacteria 618
211 Ga0501317_053083 3300049533 Bacteria 649
212 Ga0501318_089436 3300049534 Unclassified 508
213 Ga0501323_046699 3300049539 Bacteria 648
214 Ga0501329_07722 3300049545 Bacteria 635
215 Ga0501333_010712 3300049549 Bacteria 656
216 Ga0501047_0081683 3300049581 Bacteria 3107
217 Ga0501047_0804552 3300049581 Unclassified 755
218 Ga0501067_0078264 3300049583 Bacteria 1832
219 Ga0501067_0186086 3300049583 Bacteria 1156
220 Ga0501068_0198167 3300049584 Bacteria 1273
221 Ga0501068_0212633 3300049584 Bacteria 1228
222 Ga0501068_0800992 3300049584 Bacteria 618
223 Ga0501070_0054220 3300049586 Bacteria 3325
224 Ga0501073_0010313 3300049589 Bacteria 6858
225 Ga0501073_0184958 3300049589 Bacteria 1442
226 Ga0501074_0103917 3300049590 Bacteria 2033
227 Ga0501076_0153185 3300049592 Bacteria 1875
228 Ga0501076_0243491 3300049592 Bacteria 1471
229 Ga0501077_0011533 3300049593 Bacteria 5521
230 Ga0501077_0207440 3300049593 Bacteria 1245
231 Ga0501249_068382 3300049679 Bacteria 828
232 Ga0501257_133377 3300049686 Bacteria 674
233 Ga0501079_0097602 3300049741 Bacteria 2278
234 Ga0501080_0055493 3300049742 Bacteria 3690
235 Ga0501080_0064413 3300049742 Bacteria 3409
236 Ga0501080_1569372 3300049742 Bacteria 558
237 Ga0501081_0061248 3300049743 Bacteria 2609
238 Ga0501083_0001562 3300049744 Bacteria 15658
239 Ga0501083_0004579 3300049744 Bacteria 9768
240 Ga0501083_0610979 3300049744 Bacteria 709
241 Ga0501083_0620949 3300049744 Bacteria 703
242 Ga0501269_038777 3300049766 Bacteria 630
243 nmdc:mga03683_269982_c1 3300050489 Unclassified 793
244 nmdc:mga03683_395666_c1 3300050489 Bacteria 659
245 nmdc:mga03n38_160389_c1 3300050490 Bacteria 1138
246 nmdc:mga03n38_245229_c1 3300050490 Unclassified 944
247 nmdc:mga00v17_127899_c1 3300050491 Bacteria 1622
248 nmdc:mga0k408_112628_c1 3300050493 Bacteria 1609
249 nmdc:mga0k408_15013_c1 3300050493 Bacteria 4280
250 nmdc:mga0k408_455100_c1 3300050493 Bacteria 760
251 nmdc:mga0k408_462811_c1 3300050493 Bacteria 753
252 nmdc:mga0k408_4639_c1 3300050493 Bacteria 7280
253 nmdc:mga0k408_875340_c1 3300050493 Bacteria 522
254 nmdc:mga07m45_603184_c1 3300050496 Bacteria 634
255 nmdc:mga07m45_608071_c1 3300050496 Bacteria 631
256 nmdc:mga05p37_928419_c1 3300050507 Bacteria 934
257 nmdc:mga08y16_6171_c1 3300050511 Bacteria 12576
258 Ga0500635_0134843 3300053080 Bacteria 933
259 Ga0500644_0033460 3300053088 Bacteria 1650
260 Ga0500568_0051971 3300053139 Bacteria 1611
261 Ga0500588_0045449 3300053146 Bacteria 1345
262 Ga0501084_0003199 3300054114 Bacteria 13258
263 Ga0501084_0034615 3300054114 Bacteria 4223
264 Ga0501084_0078925 3300054114 Bacteria 2759
265 Ga0501084_0277419 3300054114 Bacteria 1415
266 Ga0587073_0170433 3300059492 Bacteria 631
267 Ga0587085_159426 3300059506 Bacteria 526
268 Ga0501082_0230504 3300060353 Unclassified 1612
269 Ga0501082_0543255 3300060353 Bacteria 1016
270 Ga0501082_0957583 3300060353 Bacteria 748

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049589 Ga0501073_0184958 Ga0501073_0184958_716_1018 100
2 3300009177 Ga0105248_10585014 Ga0105248_105850142 101
3 3300009553 Ga0105249_10980898 Ga0105249_109808982 101
4 3300025919 Ga0207657_10489154 Ga0207657_104891542 101
5 3300041486 Ga0451807_1705418 Ga0451807_1705418_2088_2393 101
6 3300050489 nmdc:mga03683_269982_c1 nmdc:mga03683_269982_c1_226_531 101
7 3300050491 nmdc:mga00v17_127899_c1 nmdc:mga00v17_127899_c1_791_1096 101
8 3300050493 nmdc:mga0k408_112628_c1 nmdc:mga0k408_112628_c1_885_1190 101
9 3300005719 Ga0068861_100243301 Ga0068861_1002433013 114
10 3300009176 Ga0105242_12893294 Ga0105242_128932941 114
11 3300026118 Ga0207675_100634594 Ga0207675_1006345943 114
12 3300049581 Ga0501047_0804552 Ga0501047_0804552_141_494 114
13 iso_pu_bacteria 2829745981 2829747425 114
14 iso_pu_bacteria 2861691609 2861691689 114
15 iso_pu_bacteria 8002392321 8002394240 114
16 3300006195 Ga0075366_10326646 Ga0075366_103266462 115
17 3300031727 Ga0316576_10111915 Ga0316576_101119152 115
18 3300031728 Ga0316578_10244149 Ga0316578_102441492 115
19 3300033541 Ga0316596_1248430 Ga0316596_12484301 115
20 3300050493 nmdc:mga0k408_455100_c1 nmdc:mga0k408_455100_c1_290_637 115
21 3300003163 Ga0006759J45824_1050841 Ga0006759J45824_10508412 116
22 3300003300 Ga0006758J48902_1013436 Ga0006758J48902_10134362 116
23 3300003300 Ga0006758J48902_1017135 Ga0006758J48902_10171352 116
24 3300005331 Ga0070670_100433601 Ga0070670_1004336013 116
25 3300005333 Ga0070677_10061155 Ga0070677_100611552 116
26 3300005337 Ga0070682_100049034 Ga0070682_1000490341 116
27 3300005338 Ga0068868_101250124 Ga0068868_1012501241 116
28 3300005354 Ga0070675_100567005 Ga0070675_1005670051 116
29 3300005459 Ga0068867_100031965 Ga0068867_1000319653 116
30 3300005466 Ga0070685_10122749 Ga0070685_101227493 116
31 3300005468 Ga0070707_101233220 Ga0070707_1012332201 116
32 3300005535 Ga0070684_100697837 Ga0070684_1006978372 116
33 3300005543 Ga0070672_100000117 Ga0070672_10000011711 116
34 3300005543 Ga0070672_100346059 Ga0070672_1003460592 116
35 3300005543 Ga0070672_100733730 Ga0070672_1007337301 116
36 3300005547 Ga0070693_101078013 Ga0070693_1010780131 116
37 3300005563 Ga0068855_100147378 Ga0068855_1001473782 116
38 3300005564 Ga0070664_100908221 Ga0070664_1009082211 116
39 3300005614 Ga0068856_100004582 Ga0068856_1000045828 116
40 3300005615 Ga0070702_100207188 Ga0070702_1002071881 116
41 3300005616 Ga0068852_100615520 Ga0068852_1006155202 116
42 3300005618 Ga0068864_100856216 Ga0068864_1008562161 116
43 3300005618 Ga0068864_101787778 Ga0068864_1017877782 116
44 3300005719 Ga0068861_100009515 Ga0068861_1000095154 116
45 3300005841 Ga0068863_100863765 Ga0068863_1008637652 116
46 3300005841 Ga0068863_101418671 Ga0068863_1014186712 116
47 3300005842 Ga0068858_100998042 Ga0068858_1009980422 116
48 3300005844 Ga0068862_100792154 Ga0068862_1007921542 116
49 3300006195 Ga0075366_10204590 Ga0075366_102045903 116
50 3300006237 Ga0097621_101804093 Ga0097621_1018040932 116
51 3300006358 Ga0068871_100670847 Ga0068871_1006708472 116
52 3300006358 Ga0068871_101679446 Ga0068871_1016794462 116
53 3300014325 Ga0163163_12405589 Ga0163163_124055892 116
54 3300014969 Ga0157376_10427820 Ga0157376_104278202 116
55 3300017792 Ga0163161_11849252 Ga0163161_118492521 116
56 3300025893 Ga0207682_10221129 Ga0207682_102211291 116
57 3300025913 Ga0207695_10752793 Ga0207695_107527932 116
58 3300025926 Ga0207659_10303265 Ga0207659_103032652 116
59 3300025940 Ga0207691_10002974 Ga0207691_1000297412 116
60 3300025940 Ga0207691_10359730 Ga0207691_103597302 116
61 3300025942 Ga0207689_11715957 Ga0207689_117159572 116
62 3300025949 Ga0207667_10001917 Ga0207667_100019177 116
63 3300025961 Ga0207712_10205623 Ga0207712_102056232 116
64 3300026035 Ga0207703_12026868 Ga0207703_120268681 116
65 3300026078 Ga0207702_10280071 Ga0207702_102800712 116
66 3300026088 Ga0207641_10603565 Ga0207641_106035652 116
67 3300026088 Ga0207641_12595193 Ga0207641_125951931 116
68 3300026089 Ga0207648_10226426 Ga0207648_102264263 116
69 3300026095 Ga0207676_10753975 Ga0207676_107539752 116
70 3300026118 Ga0207675_100000293 Ga0207675_10000029336 116
71 3300026118 Ga0207675_100339223 Ga0207675_1003392232 116
72 3300026121 Ga0207683_10554218 Ga0207683_105542181 116
73 3300026142 Ga0207698_10319192 Ga0207698_103191923 116
74 3300028380 Ga0268265_10714923 Ga0268265_107149232 116
75 3300031456 Ga0307513_10544002 Ga0307513_105440022 116
76 3300031616 Ga0307508_10311880 Ga0307508_103118801 116
77 3300033528 Ga0316588_1111211 Ga0316588_11112112 116
78 3300041441 Ga0451787_295424 Ga0451787_295424_29_379 116
79 3300041508 Ga0451852_29961 Ga0451852_29961_27_377 116
80 3300041512 Ga0451853_2507637 Ga0451853_2507637_186_536 116
81 3300049589 Ga0501073_0010313 Ga0501073_0010313_5128_5478 116
82 3300049592 Ga0501076_0153185 Ga0501076_0153185_1328_1678 116
83 3300049593 Ga0501077_0207440 Ga0501077_0207440_658_1008 116
84 3300049742 Ga0501080_0055493 Ga0501080_0055493_821_1171 116
85 3300049744 Ga0501083_0004579 Ga0501083_0004579_8036_8386 116
86 3300050493 nmdc:mga0k408_462811_c1 nmdc:mga0k408_462811_c1_378_728 116
87 3300053080 Ga0500635_0134843 Ga0500635_0134843_277_627 116
88 3300053146 Ga0500588_0045449 Ga0500588_0045449_216_593 116
89 3300054114 Ga0501084_0034615 Ga0501084_0034615_167_517 116
90 3300003323 rootH1_10021014 rootH1_100210141 117
91 3300005337 Ga0070682_100005462 Ga0070682_1000054623 117
92 3300005337 Ga0070682_100284281 Ga0070682_1002842812 117
93 3300005365 Ga0070688_100826534 Ga0070688_1008265342 117
94 3300005466 Ga0070685_10052734 Ga0070685_100527341 117
95 3300005468 Ga0070707_101205007 Ga0070707_1012050071 117
96 3300005535 Ga0070684_100288690 Ga0070684_1002886903 117
97 3300005547 Ga0070693_100150499 Ga0070693_1001504992 117
98 3300005615 Ga0070702_100162158 Ga0070702_1001621583 117
99 3300006051 Ga0075364_10211339 Ga0075364_102113392 117
100 3300006177 Ga0075362_10120191 Ga0075362_101201911 117
101 3300006177 Ga0075362_10376813 Ga0075362_103768132 117
102 3300006195 Ga0075366_10007686 Ga0075366_100076865 117
103 3300006195 Ga0075366_10012895 Ga0075366_100128954 117
104 3300006195 Ga0075366_10014133 Ga0075366_100141333 117
105 3300006237 Ga0097621_100600122 Ga0097621_1006001222 117
106 3300009094 Ga0111539_10011697 Ga0111539_100116976 117
107 3300009094 Ga0111539_11468581 Ga0111539_114685811 117
108 3300009098 Ga0105245_10001855 Ga0105245_100018557 117
109 3300009147 Ga0114129_13303484 Ga0114129_133034841 117
110 3300009174 Ga0105241_10295416 Ga0105241_102954162 117
111 3300013307 Ga0157372_13120822 Ga0157372_131208222 117
112 3300014969 Ga0157376_10022323 Ga0157376_100223235 117
113 3300025911 Ga0207654_10015921 Ga0207654_100159213 117
114 3300025924 Ga0207694_11092897 Ga0207694_110928971 117
115 3300025927 Ga0207687_10007688 Ga0207687_100076883 117
116 3300025961 Ga0207712_10793361 Ga0207712_107933612 117
117 3300026088 Ga0207641_10223808 Ga0207641_102238082 117
118 3300027907 Ga0207428_10037557 Ga0207428_100375573 117
119 3300028794 Ga0307515_10137113 Ga0307515_101371131 117
120 3300032005 Ga0307411_10893679 Ga0307411_108936792 117
121 3300041444 Ga0451790_28281 Ga0451790_28281_172_525 117
122 3300041453 Ga0451797_0409476 Ga0451797_0409476_2542_2895 117
123 3300041460 Ga0451802_1084852 Ga0451802_1084852_697_1050 117
124 3300041461 Ga0451805_077609 Ga0451805_077609_198_551 117
125 3300041486 Ga0451807_0187201 Ga0451807_0187201_6704_7057 117
126 3300041491 Ga0451833_0436704 Ga0451833_0436704_402_755 117
127 3300041492 Ga0451835_0472295 Ga0451835_0472295_126_479 117
128 3300041498 Ga0451841_0157698 Ga0451841_0157698_727_1080 117
129 3300041505 Ga0451849_0046522 Ga0451849_0046522_4965_5318 117
130 3300041509 Ga0451843_1160701 Ga0451843_1160701_195_548 117
131 3300041512 Ga0451853_0412973 Ga0451853_0412973_5942_6295 117
132 3300042004 Ga0439445_0007244 Ga0439445_0007244_456_809 117
133 3300049529 Ga0501313_032211 Ga0501313_032211_260_613 117
134 3300049530 Ga0501314_024381 Ga0501314_024381_28_381 117
135 3300049531 Ga0501315_042263 Ga0501315_042263_68_421 117
136 3300049583 Ga0501067_0078264 Ga0501067_0078264_1390_1743 117
137 3300049584 Ga0501068_0198167 Ga0501068_0198167_638_991 117
138 3300049584 Ga0501068_0212633 Ga0501068_0212633_426_779 117
139 3300049590 Ga0501074_0103917 Ga0501074_0103917_523_876 117
140 3300049592 Ga0501076_0243491 Ga0501076_0243491_841_1194 117
141 3300049741 Ga0501079_0097602 Ga0501079_0097602_1059_1412 117
142 3300049742 Ga0501080_0064413 Ga0501080_0064413_2276_2629 117
143 3300049743 Ga0501081_0061248 Ga0501081_0061248_1231_1584 117
144 3300049744 Ga0501083_0001562 Ga0501083_0001562_5594_5947 117
145 3300050489 nmdc:mga03683_395666_c1 nmdc:mga03683_395666_c1_37_390 117
146 3300050493 nmdc:mga0k408_15013_c1 nmdc:mga0k408_15013_c1_1281_1634 117
147 3300050493 nmdc:mga0k408_4639_c1 nmdc:mga0k408_4639_c1_723_1076 117
148 3300050496 nmdc:mga07m45_608071_c1 nmdc:mga07m45_608071_c1_16_369 117
149 3300050511 nmdc:mga08y16_6171_c1 nmdc:mga08y16_6171_c1_4378_4731 117
150 3300054114 Ga0501084_0003199 Ga0501084_0003199_4910_5263 117
151 3300054114 Ga0501084_0277419 Ga0501084_0277419_765_1118 117
152 3300060353 Ga0501082_0230504 Ga0501082_0230504_733_1086 117
153 3300002863 Ga0006769J43182_104888 Ga0006769J43182_1048882 118
154 3300003163 Ga0006759J45824_1036100 Ga0006759J45824_10361002 118
155 3300003300 Ga0006758J48902_1010801 Ga0006758J48902_10108012 118
156 3300003305 Ga0006770J48903_1027098 Ga0006770J48903_10270982 118
157 3300003323 rootH1_10285841 rootH1_102858412 118
158 3300003693 Ga0032354_1073388 Ga0032354_10733882 118
159 3300005289 Ga0065704_10439740 Ga0065704_104397401 118
160 3300005330 Ga0070690_101289487 Ga0070690_1012894871 118
161 3300005337 Ga0070682_100043826 Ga0070682_1000438263 118
162 3300005337 Ga0070682_100157267 Ga0070682_1001572671 118
163 3300005347 Ga0070668_100272426 Ga0070668_1002724262 118
164 3300005367 Ga0070667_100988220 Ga0070667_1009882202 118
165 3300005445 Ga0070708_100494945 Ga0070708_1004949452 118
166 3300005548 Ga0070665_100014668 Ga0070665_1000146686 118
167 3300005563 Ga0068855_100000016 Ga0068855_100000016205 118
168 3300005577 Ga0068857_100534413 Ga0068857_1005344132 118
169 3300005617 Ga0068859_100206371 Ga0068859_1002063712 118
170 3300005841 Ga0068863_100275241 Ga0068863_1002752412 118
171 3300005841 Ga0068863_100890407 Ga0068863_1008904071 118
172 3300005842 Ga0068858_100032030 Ga0068858_1000320306 118
173 3300005842 Ga0068858_101937874 Ga0068858_1019378741 118
174 3300005843 Ga0068860_100095687 Ga0068860_1000956874 118
175 3300006195 Ga0075366_10162735 Ga0075366_101627351 118
176 3300006195 Ga0075366_10489864 Ga0075366_104898642 118
177 3300006195 Ga0075366_10527312 Ga0075366_105273121 118
178 3300006237 Ga0097621_100031265 Ga0097621_1000312655 118
179 3300006237 Ga0097621_101334056 Ga0097621_1013340562 118
180 3300006353 Ga0075370_11031902 Ga0075370_110319021 118
181 3300006931 Ga0097620_100206375 Ga0097620_1002063754 118
182 3300009177 Ga0105248_10002908 Ga0105248_100029085 118
183 3300013104 Ga0157370_10157582 Ga0157370_101575822 118
184 3300013297 Ga0157378_10880332 Ga0157378_108803321 118
185 3300014325 Ga0163163_12858080 Ga0163163_128580801 118
186 3300014326 Ga0157380_10051793 Ga0157380_100517932 118
187 3300022467 Ga0224712_10223070 Ga0224712_102230701 118
188 3300025941 Ga0207711_10025827 Ga0207711_100258275 118
189 3300025944 Ga0207661_11572577 Ga0207661_115725771 118
190 3300025949 Ga0207667_10000099 Ga0207667_10000099116 118
191 3300025972 Ga0207668_10254103 Ga0207668_102541032 118
192 3300026035 Ga0207703_10014079 Ga0207703_100140796 118
193 3300026088 Ga0207641_10741035 Ga0207641_107410351 118
194 3300027543 Ga0209999_1044203 Ga0209999_10442031 118
195 3300028379 Ga0268266_10071209 Ga0268266_100712096 118
196 3300028381 Ga0268264_10552482 Ga0268264_105524822 118
197 3300028577 Ga0265318_10025306 Ga0265318_100253062 118
198 3300031238 Ga0265332_10091329 Ga0265332_100913292 118
199 3300031249 Ga0265339_10002043 Ga0265339_100020435 118
200 3300031249 Ga0265339_10053282 Ga0265339_100532823 118
201 3300031250 Ga0265331_10106717 Ga0265331_101067173 118
202 3300031344 Ga0265316_10001437 Ga0265316_100014375 118
203 3300031456 Ga0307513_10600183 Ga0307513_106001831 118
204 3300031595 Ga0265313_10029780 Ga0265313_100297803 118
205 3300031711 Ga0265314_10000001 Ga0265314_100000011055 118
206 3300031711 Ga0265314_10039222 Ga0265314_100392224 118
207 3300031712 Ga0265342_10491215 Ga0265342_104912151 118
208 3300031730 Ga0307516_10008910 Ga0307516_100089105 118
209 3300031731 Ga0307405_10188579 Ga0307405_101885792 118
210 3300031903 Ga0307407_10918490 Ga0307407_109184902 118
211 3300032005 Ga0307411_10362195 Ga0307411_103621952 118
212 3300035724 Ga0373933_0023866 Ga0373933_0023866_1967_2326 118
213 3300037418 Ga0395900_0174753 Ga0395900_0174753_304_663 118
214 3300037418 Ga0395900_0954752 Ga0395900_0954752_309_680 118
215 3300037418 Ga0395900_1686751 Ga0395900_1686751_162_521 118
216 3300037466 Ga0395898_0183418 Ga0395898_0183418_1188_1547 118
217 3300037471 Ga0395905_1386223 Ga0395905_1386223_151_510 118
218 3300041441 Ga0451787_400973 Ga0451787_400973_573_929 118
219 3300041443 Ga0451789_1118680 Ga0451789_1118680_134_490 118
220 3300041459 Ga0451800_0504732 Ga0451800_0504732_92_448 118
221 3300041486 Ga0451807_0330594 Ga0451807_0330594_108_464 118
222 3300041486 Ga0451807_1748227 Ga0451807_1748227_657_1070 118
223 3300041507 Ga0451851_0328395 Ga0451851_0328395_16_375 118
224 3300041509 Ga0451843_1474169 Ga0451843_1474169_350_706 118
225 3300041509 Ga0451843_1570856 Ga0451843_1570856_114_470 118
226 3300041512 Ga0451853_0068542 Ga0451853_0068542_169_531 118
227 3300042004 Ga0439445_0231877 Ga0439445_0231877_138_494 118
228 3300042876 Ga0451577_0311146 Ga0451577_0311146_626_988 118
229 3300044683 Ga0466965_0116554 Ga0466965_0116554_951_1307 118
230 3300044684 Ga0466966_0215391 Ga0466966_0215391_192_563 118
231 3300045976 Ga0466967_1561462 Ga0466967_1561462_214_573 118
232 3300049128 Ga0501308_082919 Ga0501308_082919_138_494 118
233 3300049129 Ga0501309_023175 Ga0501309_023175_254_610 118
234 3300049129 Ga0501309_050291 Ga0501309_050291_48_404 118
235 3300049129 Ga0501309_079689 Ga0501309_079689_73_429 118
236 3300049130 Ga0501310_029678 Ga0501310_029678_93_449 118
237 3300049130 Ga0501310_039806 Ga0501310_039806_29_385 118
238 3300049161 Ga0501305_040248 Ga0501305_040248_137_493 118
239 3300049161 Ga0501305_063318 Ga0501305_063318_269_625 118
240 3300049162 Ga0501307_060244 Ga0501307_060244_200_556 118
241 3300049528 Ga0501312_050353 Ga0501312_050353_94_450 118
242 3300049528 Ga0501312_060552 Ga0501312_060552_268_624 118
243 3300049530 Ga0501314_022362 Ga0501314_022362_273_629 118
244 3300049531 Ga0501315_053290 Ga0501315_053290_14_370 118
245 3300049532 Ga0501316_046049 Ga0501316_046049_35_391 118
246 3300049533 Ga0501317_053083 Ga0501317_053083_24_380 118
247 3300049534 Ga0501318_089436 Ga0501318_089436_37_393 118
248 3300049539 Ga0501323_046699 Ga0501323_046699_22_378 118
249 3300049545 Ga0501329_07722 Ga0501329_07722_11_367 118
250 3300049549 Ga0501333_010712 Ga0501333_010712_269_625 118
251 3300049581 Ga0501047_0081683 Ga0501047_0081683_2183_2539 118
252 3300049583 Ga0501067_0186086 Ga0501067_0186086_231_587 118
253 3300049584 Ga0501068_0800992 Ga0501068_0800992_14_400 118
254 3300049586 Ga0501070_0054220 Ga0501070_0054220_669_1055 118
255 3300049593 Ga0501077_0011533 Ga0501077_0011533_3390_3755 118
256 3300049679 Ga0501249_068382 Ga0501249_068382_460_816 118
257 3300049686 Ga0501257_133377 Ga0501257_133377_152_508 118
258 3300049742 Ga0501080_1569372 Ga0501080_1569372_18_374 118
259 3300049744 Ga0501083_0610979 Ga0501083_0610979_72_458 118
260 3300049744 Ga0501083_0620949 Ga0501083_0620949_255_611 118
261 3300049766 Ga0501269_038777 Ga0501269_038777_44_400 118
262 3300050490 nmdc:mga03n38_160389_c1 nmdc:mga03n38_160389_c1_594_959 118
263 3300050490 nmdc:mga03n38_245229_c1 nmdc:mga03n38_245229_c1_16_489 118
264 3300050493 nmdc:mga0k408_875340_c1 nmdc:mga0k408_875340_c1_84_440 118
265 3300050496 nmdc:mga07m45_603184_c1 nmdc:mga07m45_603184_c1_222_587 118
266 3300050507 nmdc:mga05p37_928419_c1 nmdc:mga05p37_928419_c1_204_563 118
267 3300053088 Ga0500644_0033460 Ga0500644_0033460_82_447 118
268 3300053139 Ga0500568_0051971 Ga0500568_0051971_127_492 118
269 3300054114 Ga0501084_0078925 Ga0501084_0078925_1730_2086 118
270 3300059492 Ga0587073_0170433 Ga0587073_0170433_203_592 118
271 3300059506 Ga0587085_159426 Ga0587085_159426_134_490 118
272 3300060353 Ga0501082_0543255 Ga0501082_0543255_350_736 118
273 3300060353 Ga0501082_0957583 Ga0501082_0957583_342_698 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00453

Ribosomal_L20

Ribosomal protein L20

3

109

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v48-assembly1.cif.gz_AO real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.878 50 116
4v48-assembly1.cif.gz_AO real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.8557 50 116
1gyz-assembly1.cif.gz_A bacterial ribosomal protein l20 from aquifex aeolicus 0.8347 61 113
1gyz-assembly1.cif.gz_A bacterial ribosomal protein l20 from aquifex aeolicus 0.7415 61 113
7pkt-assembly1.cif.gz_o large subunit of the chlamydomonas reinhardtii mitoribosome 0.6827 15 113
ID Description Score Start End Superfamily
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9381 53 113 1.10.1900.20
2ghjB02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8868 58 113 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8347 61 113 1.10.1900.20
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8226 53 113 1.10.1900.20
2ghjB02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.752 58 113 1.10.1900.20
ID Description Score Start End GO Terms
AF-A0A081D3S4-F1-model_v4 deleted 0.9979 60 113
AF-A0A7G2DR74-F1-model_v4 Large ribosomal subunit protein bL20c (50S ribosomal protein L20, chloroplastic) 0.9972 58 116 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0E0N241-F1-model_v4 Large ribosomal subunit protein bL20c 0.9969 58 116 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0E0N240-F1-model_v4 Large ribosomal subunit protein bL20c 0.9961 58 116 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-X8FDF3-F1-model_v4 deleted 0.9952 61 116

Feature Viewer

pLDDT pTM Quality
81.05 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map