F378939
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 273 | 178 | 270 | 118 |
Family's Representative Sequence
| Representative Sequence | 3300005842|Ga0068858_100032030|Ga0068858_1000320306 |
| Length | 134 |
| Sequence | MSRVKRGNVLQKRHKKILKYAKGFRGSKSKIFIAANQAVMRAWRNSFADRRKKKRDYRSLWITRINAACRANGLSYSKFIWANDKLGVTLNRKVLAEVALNDKEAFAALALQAKKLVDKTLAEKVESDTYAVHH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 2 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 3 | 3300002863 | Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_12 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 41 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 42 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 86 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 90 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 91 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 92 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 93 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 94 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 95 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 96 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 97 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 98 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 99 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 100 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 101 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 102 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 103 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 104 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 105 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 106 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 109 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 110 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 111 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 112 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 113 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 114 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 115 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 116 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 117 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 118 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 119 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 120 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 121 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 122 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 123 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 124 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 125 | 3300041508 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT | Metatranscriptome | Unclassified |
| 126 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 127 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 128 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 129 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 130 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 131 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 132 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 133 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 135 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 136 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 142 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 157 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 158 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 163 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 164 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 165 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 166 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 167 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 168 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 171 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 172 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 173 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 174 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.98 |
| Metatranscriptomes | 13.92 |
| Isolates | 1.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.62 |
| Nodule | 0 |
| Rhizoplane | 4.4 |
| Rhizosphere | 78.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006769J43182_104888 | 3300002863 | Bacteria | 651 |
| 2 | Ga0006759J45824_1036100 | 3300003163 | Bacteria | 691 |
| 3 | Ga0006759J45824_1050841 | 3300003163 | Unclassified | 750 |
| 4 | Ga0006758J48902_1010801 | 3300003300 | Bacteria | 692 |
| 5 | Ga0006758J48902_1013436 | 3300003300 | Bacteria | 730 |
| 6 | Ga0006758J48902_1017135 | 3300003300 | Bacteria | 878 |
| 7 | Ga0006770J48903_1027098 | 3300003305 | Bacteria | 663 |
| 8 | rootH1_10021014 | 3300003323 | Bacteria | 2161 |
| 9 | rootH1_10285841 | 3300003323 | Eukaryota | 1061 |
| 10 | Ga0032354_1073388 | 3300003693 | Bacteria | 651 |
| 11 | Ga0065704_10439740 | 3300005289 | Bacteria | 715 |
| 12 | Ga0070690_101289487 | 3300005330 | Bacteria | 585 |
| 13 | Ga0070670_100433601 | 3300005331 | Bacteria | 1163 |
| 14 | Ga0070677_10061155 | 3300005333 | Bacteria | 1554 |
| 15 | Ga0070682_100005462 | 3300005337 | Bacteria | 7077 |
| 16 | Ga0070682_100043826 | 3300005337 | Bacteria | 2767 |
| 17 | Ga0070682_100049034 | 3300005337 | Bacteria | 2631 |
| 18 | Ga0070682_100157267 | 3300005337 | Bacteria | 1566 |
| 19 | Ga0070682_100284281 | 3300005337 | Bacteria | 1207 |
| 20 | Ga0068868_101250124 | 3300005338 | Bacteria | 688 |
| 21 | Ga0070668_100272426 | 3300005347 | Bacteria | 1411 |
| 22 | Ga0070675_100567005 | 3300005354 | Bacteria | 1028 |
| 23 | Ga0070688_100826534 | 3300005365 | Unclassified | 726 |
| 24 | Ga0070667_100988220 | 3300005367 | Bacteria | 785 |
| 25 | Ga0070708_100494945 | 3300005445 | Bacteria | 1153 |
| 26 | Ga0068867_100031965 | 3300005459 | Bacteria | 3803 |
| 27 | Ga0070685_10052734 | 3300005466 | Unclassified | 2354 |
| 28 | Ga0070685_10122749 | 3300005466 | Bacteria | 1615 |
| 29 | Ga0070707_101205007 | 3300005468 | Bacteria | 723 |
| 30 | Ga0070707_101233220 | 3300005468 | Bacteria | 714 |
| 31 | Ga0070684_100288690 | 3300005535 | Bacteria | 1504 |
| 32 | Ga0070684_100697837 | 3300005535 | Bacteria | 946 |
| 33 | Ga0070672_100000117 | 3300005543 | Bacteria | 40556 |
| 34 | Ga0070672_100346059 | 3300005543 | Bacteria | 1266 |
| 35 | Ga0070672_100733730 | 3300005543 | Bacteria | 866 |
| 36 | Ga0070693_100150499 | 3300005547 | Bacteria | 1474 |
| 37 | Ga0070693_101078013 | 3300005547 | Bacteria | 611 |
| 38 | Ga0070665_100014668 | 3300005548 | Bacteria | 7864 |
| 39 | Ga0068855_100000016 | 3300005563 | Bacteria | 222591 |
| 40 | Ga0068855_100147378 | 3300005563 | Bacteria | 2678 |
| 41 | Ga0070664_100908221 | 3300005564 | Bacteria | 826 |
| 42 | Ga0068857_100534413 | 3300005577 | Bacteria | 1103 |
| 43 | Ga0068856_100004582 | 3300005614 | Bacteria | 13742 |
| 44 | Ga0070702_100162158 | 3300005615 | Unclassified | 1446 |
| 45 | Ga0070702_100207188 | 3300005615 | Bacteria | 1302 |
| 46 | Ga0068852_100615520 | 3300005616 | Bacteria | 1091 |
| 47 | Ga0068859_100206371 | 3300005617 | Bacteria | 2050 |
| 48 | Ga0068864_100856216 | 3300005618 | Bacteria | 896 |
| 49 | Ga0068864_101787778 | 3300005618 | Bacteria | 620 |
| 50 | Ga0068861_100009515 | 3300005719 | Bacteria | 6714 |
| 51 | Ga0068861_100243301 | 3300005719 | Bacteria | 1531 |
| 52 | Ga0068863_100275241 | 3300005841 | Unclassified | 1630 |
| 53 | Ga0068863_100863765 | 3300005841 | Bacteria | 904 |
| 54 | Ga0068863_100890407 | 3300005841 | Bacteria | 890 |
| 55 | Ga0068863_101418671 | 3300005841 | Bacteria | 702 |
| 56 | Ga0068858_100032030 | 3300005842 | Unclassified | 4884 |
| 57 | Ga0068858_100998042 | 3300005842 | Bacteria | 820 |
| 58 | Ga0068858_101937874 | 3300005842 | Bacteria | 582 |
| 59 | Ga0068860_100095687 | 3300005843 | Bacteria | 2831 |
| 60 | Ga0068862_100792154 | 3300005844 | Bacteria | 925 |
| 61 | Ga0075364_10211339 | 3300006051 | Unclassified | 1316 |
| 62 | Ga0075362_10120191 | 3300006177 | Unclassified | 1243 |
| 63 | Ga0075362_10376813 | 3300006177 | Bacteria | 713 |
| 64 | Ga0075366_10007686 | 3300006195 | Bacteria | 5969 |
| 65 | Ga0075366_10012895 | 3300006195 | Bacteria | 4750 |
| 66 | Ga0075366_10014133 | 3300006195 | Bacteria | 4556 |
| 67 | Ga0075366_10162735 | 3300006195 | Bacteria | 1352 |
| 68 | Ga0075366_10204590 | 3300006195 | Bacteria | 1201 |
| 69 | Ga0075366_10326646 | 3300006195 | Bacteria | 940 |
| 70 | Ga0075366_10489864 | 3300006195 | Bacteria | 760 |
| 71 | Ga0075366_10527312 | 3300006195 | Bacteria | 731 |
| 72 | Ga0097621_100031265 | 3300006237 | Bacteria | 4224 |
| 73 | Ga0097621_100600122 | 3300006237 | Bacteria | 1006 |
| 74 | Ga0097621_101334056 | 3300006237 | Bacteria | 678 |
| 75 | Ga0097621_101804093 | 3300006237 | Bacteria | 583 |
| 76 | Ga0075370_11031902 | 3300006353 | Bacteria | 504 |
| 77 | Ga0068871_100670847 | 3300006358 | Bacteria | 948 |
| 78 | Ga0068871_101679446 | 3300006358 | Bacteria | 602 |
| 79 | Ga0097620_100206375 | 3300006931 | Bacteria | 2050 |
| 80 | Ga0111539_10011697 | 3300009094 | Bacteria | 11012 |
| 81 | Ga0111539_11468581 | 3300009094 | Bacteria | 791 |
| 82 | Ga0105245_10001855 | 3300009098 | Bacteria | 19241 |
| 83 | Ga0114129_13303484 | 3300009147 | Bacteria | 521 |
| 84 | Ga0105241_10295416 | 3300009174 | Bacteria | 1388 |
| 85 | Ga0105242_12893294 | 3300009176 | Bacteria | 530 |
| 86 | Ga0105248_10002908 | 3300009177 | Bacteria | 19007 |
| 87 | Ga0105248_10585014 | 3300009177 | Bacteria | 1259 |
| 88 | Ga0105249_10980898 | 3300009553 | Bacteria | 913 |
| 89 | Ga0157370_10157582 | 3300013104 | Bacteria | 2112 |
| 90 | Ga0157378_10880332 | 3300013297 | Bacteria | 925 |
| 91 | Ga0157372_13120822 | 3300013307 | Bacteria | 529 |
| 92 | Ga0163163_12405589 | 3300014325 | Bacteria | 585 |
| 93 | Ga0163163_12858080 | 3300014325 | Bacteria | 539 |
| 94 | Ga0157380_10051793 | 3300014326 | Bacteria | 3249 |
| 95 | Ga0157376_10022323 | 3300014969 | Bacteria | 4931 |
| 96 | Ga0157376_10427820 | 3300014969 | Bacteria | 1286 |
| 97 | Ga0163161_11849252 | 3300017792 | Bacteria | 537 |
| 98 | Ga0224712_10223070 | 3300022467 | Bacteria | 863 |
| 99 | Ga0207682_10221129 | 3300025893 | Bacteria | 876 |
| 100 | Ga0207654_10015921 | 3300025911 | Bacteria | 3911 |
| 101 | Ga0207695_10752793 | 3300025913 | Bacteria | 854 |
| 102 | Ga0207657_10489154 | 3300025919 | Bacteria | 964 |
| 103 | Ga0207694_11092897 | 3300025924 | Bacteria | 675 |
| 104 | Ga0207659_10303265 | 3300025926 | Bacteria | 1312 |
| 105 | Ga0207687_10007688 | 3300025927 | Bacteria | 7079 |
| 106 | Ga0207691_10002974 | 3300025940 | Bacteria | 16547 |
| 107 | Ga0207691_10359730 | 3300025940 | Bacteria | 1245 |
| 108 | Ga0207711_10025827 | 3300025941 | Bacteria | 4925 |
| 109 | Ga0207689_11715957 | 3300025942 | Bacteria | 520 |
| 110 | Ga0207661_11572577 | 3300025944 | Bacteria | 602 |
| 111 | Ga0207667_10000099 | 3300025949 | Bacteria | 139071 |
| 112 | Ga0207667_10001917 | 3300025949 | Bacteria | 26122 |
| 113 | Ga0207712_10205623 | 3300025961 | Unclassified | 1564 |
| 114 | Ga0207712_10793361 | 3300025961 | Bacteria | 832 |
| 115 | Ga0207668_10254103 | 3300025972 | Bacteria | 1429 |
| 116 | Ga0207703_10014079 | 3300026035 | Bacteria | 6233 |
| 117 | Ga0207703_12026868 | 3300026035 | Bacteria | 552 |
| 118 | Ga0207702_10280071 | 3300026078 | Bacteria | 1576 |
| 119 | Ga0207641_10223808 | 3300026088 | Unclassified | 1746 |
| 120 | Ga0207641_10603565 | 3300026088 | Bacteria | 1075 |
| 121 | Ga0207641_10741035 | 3300026088 | Unclassified | 969 |
| 122 | Ga0207641_12595193 | 3300026088 | Bacteria | 505 |
| 123 | Ga0207648_10226426 | 3300026089 | Bacteria | 1663 |
| 124 | Ga0207676_10753975 | 3300026095 | Bacteria | 947 |
| 125 | Ga0207675_100000293 | 3300026118 | Bacteria | 48222 |
| 126 | Ga0207675_100339223 | 3300026118 | Bacteria | 1471 |
| 127 | Ga0207675_100634594 | 3300026118 | Bacteria | 1073 |
| 128 | Ga0207683_10554218 | 3300026121 | Bacteria | 1063 |
| 129 | Ga0207698_10319192 | 3300026142 | Bacteria | 1454 |
| 130 | Ga0209999_1044203 | 3300027543 | Bacteria | 837 |
| 131 | Ga0207428_10037557 | 3300027907 | Bacteria | 3940 |
| 132 | Ga0268266_10071209 | 3300028379 | Bacteria | 3013 |
| 133 | Ga0268265_10714923 | 3300028380 | Bacteria | 969 |
| 134 | Ga0268264_10552482 | 3300028381 | Bacteria | 1129 |
| 135 | Ga0265318_10025306 | 3300028577 | Bacteria | 2345 |
| 136 | Ga0307515_10137113 | 3300028794 | Bacteria | 2652 |
| 137 | Ga0265332_10091329 | 3300031238 | Bacteria | 1287 |
| 138 | Ga0265339_10002043 | 3300031249 | Bacteria | 14815 |
| 139 | Ga0265339_10053282 | 3300031249 | Bacteria | 2201 |
| 140 | Ga0265331_10106717 | 3300031250 | Unclassified | 1286 |
| 141 | Ga0265316_10001437 | 3300031344 | Bacteria | 25625 |
| 142 | Ga0307513_10544002 | 3300031456 | Bacteria | 874 |
| 143 | Ga0307513_10600183 | 3300031456 | Unclassified | 810 |
| 144 | Ga0265313_10029780 | 3300031595 | Bacteria | 2819 |
| 145 | Ga0307508_10311880 | 3300031616 | Bacteria | 1165 |
| 146 | Ga0265314_10000001 | 3300031711 | Bacteria | 3792860 |
| 147 | Ga0265314_10039222 | 3300031711 | Unclassified | 3415 |
| 148 | Ga0265342_10491215 | 3300031712 | Unclassified | 627 |
| 149 | Ga0316576_10111915 | 3300031727 | Bacteria | 2046 |
| 150 | Ga0316578_10244149 | 3300031728 | Unclassified | 1078 |
| 151 | Ga0307516_10008910 | 3300031730 | Bacteria | 11262 |
| 152 | Ga0307405_10188579 | 3300031731 | Unclassified | 1487 |
| 153 | Ga0307407_10918490 | 3300031903 | Bacteria | 672 |
| 154 | Ga0307411_10362195 | 3300032005 | Unclassified | 1186 |
| 155 | Ga0307411_10893679 | 3300032005 | Bacteria | 789 |
| 156 | Ga0316588_1111211 | 3300033528 | Bacteria | 689 |
| 157 | Ga0316596_1248430 | 3300033541 | Bacteria | 501 |
| 158 | Ga0373933_0023866 | 3300035724 | Unclassified | 3498 |
| 159 | Ga0395900_0174753 | 3300037418 | Bacteria | 2185 |
| 160 | Ga0395900_0954752 | 3300037418 | Bacteria | 779 |
| 161 | Ga0395900_1686751 | 3300037418 | Bacteria | 545 |
| 162 | Ga0395898_0183418 | 3300037466 | Bacteria | 2000 |
| 163 | Ga0395905_1386223 | 3300037471 | Bacteria | 607 |
| 164 | Ga0451787_295424 | 3300041441 | Unclassified | 510 |
| 165 | Ga0451787_400973 | 3300041441 | Bacteria | 1736 |
| 166 | Ga0451789_1118680 | 3300041443 | Unclassified | 958 |
| 167 | Ga0451790_28281 | 3300041444 | Bacteria | 579 |
| 168 | Ga0451797_0409476 | 3300041453 | Bacteria | 3706 |
| 169 | Ga0451800_0504732 | 3300041459 | Bacteria | 583 |
| 170 | Ga0451802_1084852 | 3300041460 | Bacteria | 2540 |
| 171 | Ga0451805_077609 | 3300041461 | Bacteria | 605 |
| 172 | Ga0451807_0187201 | 3300041486 | Bacteria | 14284 |
| 173 | Ga0451807_0330594 | 3300041486 | Bacteria | 1037 |
| 174 | Ga0451807_1705418 | 3300041486 | Bacteria | 2434 |
| 175 | Ga0451807_1748227 | 3300041486 | Bacteria | 1121 |
| 176 | Ga0451833_0436704 | 3300041491 | Bacteria | 1057 |
| 177 | Ga0451835_0472295 | 3300041492 | Bacteria | 2105 |
| 178 | Ga0451841_0157698 | 3300041498 | Bacteria | 1341 |
| 179 | Ga0451849_0046522 | 3300041505 | Bacteria | 7158 |
| 180 | Ga0451851_0328395 | 3300041507 | Unclassified | 580 |
| 181 | Ga0451852_29961 | 3300041508 | Bacteria | 698 |
| 182 | Ga0451843_1160701 | 3300041509 | Bacteria | 1111 |
| 183 | Ga0451843_1474169 | 3300041509 | Unclassified | 895 |
| 184 | Ga0451843_1570856 | 3300041509 | Unclassified | 548 |
| 185 | Ga0451853_0068542 | 3300041512 | Bacteria | 641 |
| 186 | Ga0451853_0412973 | 3300041512 | Bacteria | 11526 |
| 187 | Ga0451853_2507637 | 3300041512 | Bacteria | 781 |
| 188 | Ga0439445_0007244 | 3300042004 | Bacteria | 2570 |
| 189 | Ga0439445_0231877 | 3300042004 | Bacteria | 549 |
| 190 | Ga0451577_0311146 | 3300042876 | Bacteria | 1428 |
| 191 | Ga0466965_0116554 | 3300044683 | Bacteria | 1376 |
| 192 | Ga0466966_0215391 | 3300044684 | Bacteria | 1160 |
| 193 | Ga0466967_1561462 | 3300045976 | Bacteria | 657 |
| 194 | Ga0501308_082919 | 3300049128 | Bacteria | 513 |
| 195 | Ga0501309_023175 | 3300049129 | Bacteria | 881 |
| 196 | Ga0501309_050291 | 3300049129 | Bacteria | 653 |
| 197 | Ga0501309_079689 | 3300049129 | Bacteria | 548 |
| 198 | Ga0501310_029678 | 3300049130 | Bacteria | 721 |
| 199 | Ga0501310_039806 | 3300049130 | Unclassified | 651 |
| 200 | Ga0501305_040248 | 3300049161 | Bacteria | 758 |
| 201 | Ga0501305_063318 | 3300049161 | Bacteria | 640 |
| 202 | Ga0501307_060244 | 3300049162 | Bacteria | 587 |
| 203 | Ga0501312_050353 | 3300049528 | Bacteria | 701 |
| 204 | Ga0501312_060552 | 3300049528 | Bacteria | 655 |
| 205 | Ga0501313_032211 | 3300049529 | Bacteria | 683 |
| 206 | Ga0501314_022362 | 3300049530 | Bacteria | 665 |
| 207 | Ga0501314_024381 | 3300049530 | Bacteria | 646 |
| 208 | Ga0501315_042263 | 3300049531 | Bacteria | 693 |
| 209 | Ga0501315_053290 | 3300049531 | Bacteria | 640 |
| 210 | Ga0501316_046049 | 3300049532 | Bacteria | 618 |
| 211 | Ga0501317_053083 | 3300049533 | Bacteria | 649 |
| 212 | Ga0501318_089436 | 3300049534 | Unclassified | 508 |
| 213 | Ga0501323_046699 | 3300049539 | Bacteria | 648 |
| 214 | Ga0501329_07722 | 3300049545 | Bacteria | 635 |
| 215 | Ga0501333_010712 | 3300049549 | Bacteria | 656 |
| 216 | Ga0501047_0081683 | 3300049581 | Bacteria | 3107 |
| 217 | Ga0501047_0804552 | 3300049581 | Unclassified | 755 |
| 218 | Ga0501067_0078264 | 3300049583 | Bacteria | 1832 |
| 219 | Ga0501067_0186086 | 3300049583 | Bacteria | 1156 |
| 220 | Ga0501068_0198167 | 3300049584 | Bacteria | 1273 |
| 221 | Ga0501068_0212633 | 3300049584 | Bacteria | 1228 |
| 222 | Ga0501068_0800992 | 3300049584 | Bacteria | 618 |
| 223 | Ga0501070_0054220 | 3300049586 | Bacteria | 3325 |
| 224 | Ga0501073_0010313 | 3300049589 | Bacteria | 6858 |
| 225 | Ga0501073_0184958 | 3300049589 | Bacteria | 1442 |
| 226 | Ga0501074_0103917 | 3300049590 | Bacteria | 2033 |
| 227 | Ga0501076_0153185 | 3300049592 | Bacteria | 1875 |
| 228 | Ga0501076_0243491 | 3300049592 | Bacteria | 1471 |
| 229 | Ga0501077_0011533 | 3300049593 | Bacteria | 5521 |
| 230 | Ga0501077_0207440 | 3300049593 | Bacteria | 1245 |
| 231 | Ga0501249_068382 | 3300049679 | Bacteria | 828 |
| 232 | Ga0501257_133377 | 3300049686 | Bacteria | 674 |
| 233 | Ga0501079_0097602 | 3300049741 | Bacteria | 2278 |
| 234 | Ga0501080_0055493 | 3300049742 | Bacteria | 3690 |
| 235 | Ga0501080_0064413 | 3300049742 | Bacteria | 3409 |
| 236 | Ga0501080_1569372 | 3300049742 | Bacteria | 558 |
| 237 | Ga0501081_0061248 | 3300049743 | Bacteria | 2609 |
| 238 | Ga0501083_0001562 | 3300049744 | Bacteria | 15658 |
| 239 | Ga0501083_0004579 | 3300049744 | Bacteria | 9768 |
| 240 | Ga0501083_0610979 | 3300049744 | Bacteria | 709 |
| 241 | Ga0501083_0620949 | 3300049744 | Bacteria | 703 |
| 242 | Ga0501269_038777 | 3300049766 | Bacteria | 630 |
| 243 | nmdc:mga03683_269982_c1 | 3300050489 | Unclassified | 793 |
| 244 | nmdc:mga03683_395666_c1 | 3300050489 | Bacteria | 659 |
| 245 | nmdc:mga03n38_160389_c1 | 3300050490 | Bacteria | 1138 |
| 246 | nmdc:mga03n38_245229_c1 | 3300050490 | Unclassified | 944 |
| 247 | nmdc:mga00v17_127899_c1 | 3300050491 | Bacteria | 1622 |
| 248 | nmdc:mga0k408_112628_c1 | 3300050493 | Bacteria | 1609 |
| 249 | nmdc:mga0k408_15013_c1 | 3300050493 | Bacteria | 4280 |
| 250 | nmdc:mga0k408_455100_c1 | 3300050493 | Bacteria | 760 |
| 251 | nmdc:mga0k408_462811_c1 | 3300050493 | Bacteria | 753 |
| 252 | nmdc:mga0k408_4639_c1 | 3300050493 | Bacteria | 7280 |
| 253 | nmdc:mga0k408_875340_c1 | 3300050493 | Bacteria | 522 |
| 254 | nmdc:mga07m45_603184_c1 | 3300050496 | Bacteria | 634 |
| 255 | nmdc:mga07m45_608071_c1 | 3300050496 | Bacteria | 631 |
| 256 | nmdc:mga05p37_928419_c1 | 3300050507 | Bacteria | 934 |
| 257 | nmdc:mga08y16_6171_c1 | 3300050511 | Bacteria | 12576 |
| 258 | Ga0500635_0134843 | 3300053080 | Bacteria | 933 |
| 259 | Ga0500644_0033460 | 3300053088 | Bacteria | 1650 |
| 260 | Ga0500568_0051971 | 3300053139 | Bacteria | 1611 |
| 261 | Ga0500588_0045449 | 3300053146 | Bacteria | 1345 |
| 262 | Ga0501084_0003199 | 3300054114 | Bacteria | 13258 |
| 263 | Ga0501084_0034615 | 3300054114 | Bacteria | 4223 |
| 264 | Ga0501084_0078925 | 3300054114 | Bacteria | 2759 |
| 265 | Ga0501084_0277419 | 3300054114 | Bacteria | 1415 |
| 266 | Ga0587073_0170433 | 3300059492 | Bacteria | 631 |
| 267 | Ga0587085_159426 | 3300059506 | Bacteria | 526 |
| 268 | Ga0501082_0230504 | 3300060353 | Unclassified | 1612 |
| 269 | Ga0501082_0543255 | 3300060353 | Bacteria | 1016 |
| 270 | Ga0501082_0957583 | 3300060353 | Bacteria | 748 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049589 | Ga0501073_0184958 | Ga0501073_0184958_716_1018 | 100 |
| 2 | 3300009177 | Ga0105248_10585014 | Ga0105248_105850142 | 101 |
| 3 | 3300009553 | Ga0105249_10980898 | Ga0105249_109808982 | 101 |
| 4 | 3300025919 | Ga0207657_10489154 | Ga0207657_104891542 | 101 |
| 5 | 3300041486 | Ga0451807_1705418 | Ga0451807_1705418_2088_2393 | 101 |
| 6 | 3300050489 | nmdc:mga03683_269982_c1 | nmdc:mga03683_269982_c1_226_531 | 101 |
| 7 | 3300050491 | nmdc:mga00v17_127899_c1 | nmdc:mga00v17_127899_c1_791_1096 | 101 |
| 8 | 3300050493 | nmdc:mga0k408_112628_c1 | nmdc:mga0k408_112628_c1_885_1190 | 101 |
| 9 | 3300005719 | Ga0068861_100243301 | Ga0068861_1002433013 | 114 |
| 10 | 3300009176 | Ga0105242_12893294 | Ga0105242_128932941 | 114 |
| 11 | 3300026118 | Ga0207675_100634594 | Ga0207675_1006345943 | 114 |
| 12 | 3300049581 | Ga0501047_0804552 | Ga0501047_0804552_141_494 | 114 |
| 13 | iso_pu_bacteria | 2829745981 | 2829747425 | 114 |
| 14 | iso_pu_bacteria | 2861691609 | 2861691689 | 114 |
| 15 | iso_pu_bacteria | 8002392321 | 8002394240 | 114 |
| 16 | 3300006195 | Ga0075366_10326646 | Ga0075366_103266462 | 115 |
| 17 | 3300031727 | Ga0316576_10111915 | Ga0316576_101119152 | 115 |
| 18 | 3300031728 | Ga0316578_10244149 | Ga0316578_102441492 | 115 |
| 19 | 3300033541 | Ga0316596_1248430 | Ga0316596_12484301 | 115 |
| 20 | 3300050493 | nmdc:mga0k408_455100_c1 | nmdc:mga0k408_455100_c1_290_637 | 115 |
| 21 | 3300003163 | Ga0006759J45824_1050841 | Ga0006759J45824_10508412 | 116 |
| 22 | 3300003300 | Ga0006758J48902_1013436 | Ga0006758J48902_10134362 | 116 |
| 23 | 3300003300 | Ga0006758J48902_1017135 | Ga0006758J48902_10171352 | 116 |
| 24 | 3300005331 | Ga0070670_100433601 | Ga0070670_1004336013 | 116 |
| 25 | 3300005333 | Ga0070677_10061155 | Ga0070677_100611552 | 116 |
| 26 | 3300005337 | Ga0070682_100049034 | Ga0070682_1000490341 | 116 |
| 27 | 3300005338 | Ga0068868_101250124 | Ga0068868_1012501241 | 116 |
| 28 | 3300005354 | Ga0070675_100567005 | Ga0070675_1005670051 | 116 |
| 29 | 3300005459 | Ga0068867_100031965 | Ga0068867_1000319653 | 116 |
| 30 | 3300005466 | Ga0070685_10122749 | Ga0070685_101227493 | 116 |
| 31 | 3300005468 | Ga0070707_101233220 | Ga0070707_1012332201 | 116 |
| 32 | 3300005535 | Ga0070684_100697837 | Ga0070684_1006978372 | 116 |
| 33 | 3300005543 | Ga0070672_100000117 | Ga0070672_10000011711 | 116 |
| 34 | 3300005543 | Ga0070672_100346059 | Ga0070672_1003460592 | 116 |
| 35 | 3300005543 | Ga0070672_100733730 | Ga0070672_1007337301 | 116 |
| 36 | 3300005547 | Ga0070693_101078013 | Ga0070693_1010780131 | 116 |
| 37 | 3300005563 | Ga0068855_100147378 | Ga0068855_1001473782 | 116 |
| 38 | 3300005564 | Ga0070664_100908221 | Ga0070664_1009082211 | 116 |
| 39 | 3300005614 | Ga0068856_100004582 | Ga0068856_1000045828 | 116 |
| 40 | 3300005615 | Ga0070702_100207188 | Ga0070702_1002071881 | 116 |
| 41 | 3300005616 | Ga0068852_100615520 | Ga0068852_1006155202 | 116 |
| 42 | 3300005618 | Ga0068864_100856216 | Ga0068864_1008562161 | 116 |
| 43 | 3300005618 | Ga0068864_101787778 | Ga0068864_1017877782 | 116 |
| 44 | 3300005719 | Ga0068861_100009515 | Ga0068861_1000095154 | 116 |
| 45 | 3300005841 | Ga0068863_100863765 | Ga0068863_1008637652 | 116 |
| 46 | 3300005841 | Ga0068863_101418671 | Ga0068863_1014186712 | 116 |
| 47 | 3300005842 | Ga0068858_100998042 | Ga0068858_1009980422 | 116 |
| 48 | 3300005844 | Ga0068862_100792154 | Ga0068862_1007921542 | 116 |
| 49 | 3300006195 | Ga0075366_10204590 | Ga0075366_102045903 | 116 |
| 50 | 3300006237 | Ga0097621_101804093 | Ga0097621_1018040932 | 116 |
| 51 | 3300006358 | Ga0068871_100670847 | Ga0068871_1006708472 | 116 |
| 52 | 3300006358 | Ga0068871_101679446 | Ga0068871_1016794462 | 116 |
| 53 | 3300014325 | Ga0163163_12405589 | Ga0163163_124055892 | 116 |
| 54 | 3300014969 | Ga0157376_10427820 | Ga0157376_104278202 | 116 |
| 55 | 3300017792 | Ga0163161_11849252 | Ga0163161_118492521 | 116 |
| 56 | 3300025893 | Ga0207682_10221129 | Ga0207682_102211291 | 116 |
| 57 | 3300025913 | Ga0207695_10752793 | Ga0207695_107527932 | 116 |
| 58 | 3300025926 | Ga0207659_10303265 | Ga0207659_103032652 | 116 |
| 59 | 3300025940 | Ga0207691_10002974 | Ga0207691_1000297412 | 116 |
| 60 | 3300025940 | Ga0207691_10359730 | Ga0207691_103597302 | 116 |
| 61 | 3300025942 | Ga0207689_11715957 | Ga0207689_117159572 | 116 |
| 62 | 3300025949 | Ga0207667_10001917 | Ga0207667_100019177 | 116 |
| 63 | 3300025961 | Ga0207712_10205623 | Ga0207712_102056232 | 116 |
| 64 | 3300026035 | Ga0207703_12026868 | Ga0207703_120268681 | 116 |
| 65 | 3300026078 | Ga0207702_10280071 | Ga0207702_102800712 | 116 |
| 66 | 3300026088 | Ga0207641_10603565 | Ga0207641_106035652 | 116 |
| 67 | 3300026088 | Ga0207641_12595193 | Ga0207641_125951931 | 116 |
| 68 | 3300026089 | Ga0207648_10226426 | Ga0207648_102264263 | 116 |
| 69 | 3300026095 | Ga0207676_10753975 | Ga0207676_107539752 | 116 |
| 70 | 3300026118 | Ga0207675_100000293 | Ga0207675_10000029336 | 116 |
| 71 | 3300026118 | Ga0207675_100339223 | Ga0207675_1003392232 | 116 |
| 72 | 3300026121 | Ga0207683_10554218 | Ga0207683_105542181 | 116 |
| 73 | 3300026142 | Ga0207698_10319192 | Ga0207698_103191923 | 116 |
| 74 | 3300028380 | Ga0268265_10714923 | Ga0268265_107149232 | 116 |
| 75 | 3300031456 | Ga0307513_10544002 | Ga0307513_105440022 | 116 |
| 76 | 3300031616 | Ga0307508_10311880 | Ga0307508_103118801 | 116 |
| 77 | 3300033528 | Ga0316588_1111211 | Ga0316588_11112112 | 116 |
| 78 | 3300041441 | Ga0451787_295424 | Ga0451787_295424_29_379 | 116 |
| 79 | 3300041508 | Ga0451852_29961 | Ga0451852_29961_27_377 | 116 |
| 80 | 3300041512 | Ga0451853_2507637 | Ga0451853_2507637_186_536 | 116 |
| 81 | 3300049589 | Ga0501073_0010313 | Ga0501073_0010313_5128_5478 | 116 |
| 82 | 3300049592 | Ga0501076_0153185 | Ga0501076_0153185_1328_1678 | 116 |
| 83 | 3300049593 | Ga0501077_0207440 | Ga0501077_0207440_658_1008 | 116 |
| 84 | 3300049742 | Ga0501080_0055493 | Ga0501080_0055493_821_1171 | 116 |
| 85 | 3300049744 | Ga0501083_0004579 | Ga0501083_0004579_8036_8386 | 116 |
| 86 | 3300050493 | nmdc:mga0k408_462811_c1 | nmdc:mga0k408_462811_c1_378_728 | 116 |
| 87 | 3300053080 | Ga0500635_0134843 | Ga0500635_0134843_277_627 | 116 |
| 88 | 3300053146 | Ga0500588_0045449 | Ga0500588_0045449_216_593 | 116 |
| 89 | 3300054114 | Ga0501084_0034615 | Ga0501084_0034615_167_517 | 116 |
| 90 | 3300003323 | rootH1_10021014 | rootH1_100210141 | 117 |
| 91 | 3300005337 | Ga0070682_100005462 | Ga0070682_1000054623 | 117 |
| 92 | 3300005337 | Ga0070682_100284281 | Ga0070682_1002842812 | 117 |
| 93 | 3300005365 | Ga0070688_100826534 | Ga0070688_1008265342 | 117 |
| 94 | 3300005466 | Ga0070685_10052734 | Ga0070685_100527341 | 117 |
| 95 | 3300005468 | Ga0070707_101205007 | Ga0070707_1012050071 | 117 |
| 96 | 3300005535 | Ga0070684_100288690 | Ga0070684_1002886903 | 117 |
| 97 | 3300005547 | Ga0070693_100150499 | Ga0070693_1001504992 | 117 |
| 98 | 3300005615 | Ga0070702_100162158 | Ga0070702_1001621583 | 117 |
| 99 | 3300006051 | Ga0075364_10211339 | Ga0075364_102113392 | 117 |
| 100 | 3300006177 | Ga0075362_10120191 | Ga0075362_101201911 | 117 |
| 101 | 3300006177 | Ga0075362_10376813 | Ga0075362_103768132 | 117 |
| 102 | 3300006195 | Ga0075366_10007686 | Ga0075366_100076865 | 117 |
| 103 | 3300006195 | Ga0075366_10012895 | Ga0075366_100128954 | 117 |
| 104 | 3300006195 | Ga0075366_10014133 | Ga0075366_100141333 | 117 |
| 105 | 3300006237 | Ga0097621_100600122 | Ga0097621_1006001222 | 117 |
| 106 | 3300009094 | Ga0111539_10011697 | Ga0111539_100116976 | 117 |
| 107 | 3300009094 | Ga0111539_11468581 | Ga0111539_114685811 | 117 |
| 108 | 3300009098 | Ga0105245_10001855 | Ga0105245_100018557 | 117 |
| 109 | 3300009147 | Ga0114129_13303484 | Ga0114129_133034841 | 117 |
| 110 | 3300009174 | Ga0105241_10295416 | Ga0105241_102954162 | 117 |
| 111 | 3300013307 | Ga0157372_13120822 | Ga0157372_131208222 | 117 |
| 112 | 3300014969 | Ga0157376_10022323 | Ga0157376_100223235 | 117 |
| 113 | 3300025911 | Ga0207654_10015921 | Ga0207654_100159213 | 117 |
| 114 | 3300025924 | Ga0207694_11092897 | Ga0207694_110928971 | 117 |
| 115 | 3300025927 | Ga0207687_10007688 | Ga0207687_100076883 | 117 |
| 116 | 3300025961 | Ga0207712_10793361 | Ga0207712_107933612 | 117 |
| 117 | 3300026088 | Ga0207641_10223808 | Ga0207641_102238082 | 117 |
| 118 | 3300027907 | Ga0207428_10037557 | Ga0207428_100375573 | 117 |
| 119 | 3300028794 | Ga0307515_10137113 | Ga0307515_101371131 | 117 |
| 120 | 3300032005 | Ga0307411_10893679 | Ga0307411_108936792 | 117 |
| 121 | 3300041444 | Ga0451790_28281 | Ga0451790_28281_172_525 | 117 |
| 122 | 3300041453 | Ga0451797_0409476 | Ga0451797_0409476_2542_2895 | 117 |
| 123 | 3300041460 | Ga0451802_1084852 | Ga0451802_1084852_697_1050 | 117 |
| 124 | 3300041461 | Ga0451805_077609 | Ga0451805_077609_198_551 | 117 |
| 125 | 3300041486 | Ga0451807_0187201 | Ga0451807_0187201_6704_7057 | 117 |
| 126 | 3300041491 | Ga0451833_0436704 | Ga0451833_0436704_402_755 | 117 |
| 127 | 3300041492 | Ga0451835_0472295 | Ga0451835_0472295_126_479 | 117 |
| 128 | 3300041498 | Ga0451841_0157698 | Ga0451841_0157698_727_1080 | 117 |
| 129 | 3300041505 | Ga0451849_0046522 | Ga0451849_0046522_4965_5318 | 117 |
| 130 | 3300041509 | Ga0451843_1160701 | Ga0451843_1160701_195_548 | 117 |
| 131 | 3300041512 | Ga0451853_0412973 | Ga0451853_0412973_5942_6295 | 117 |
| 132 | 3300042004 | Ga0439445_0007244 | Ga0439445_0007244_456_809 | 117 |
| 133 | 3300049529 | Ga0501313_032211 | Ga0501313_032211_260_613 | 117 |
| 134 | 3300049530 | Ga0501314_024381 | Ga0501314_024381_28_381 | 117 |
| 135 | 3300049531 | Ga0501315_042263 | Ga0501315_042263_68_421 | 117 |
| 136 | 3300049583 | Ga0501067_0078264 | Ga0501067_0078264_1390_1743 | 117 |
| 137 | 3300049584 | Ga0501068_0198167 | Ga0501068_0198167_638_991 | 117 |
| 138 | 3300049584 | Ga0501068_0212633 | Ga0501068_0212633_426_779 | 117 |
| 139 | 3300049590 | Ga0501074_0103917 | Ga0501074_0103917_523_876 | 117 |
| 140 | 3300049592 | Ga0501076_0243491 | Ga0501076_0243491_841_1194 | 117 |
| 141 | 3300049741 | Ga0501079_0097602 | Ga0501079_0097602_1059_1412 | 117 |
| 142 | 3300049742 | Ga0501080_0064413 | Ga0501080_0064413_2276_2629 | 117 |
| 143 | 3300049743 | Ga0501081_0061248 | Ga0501081_0061248_1231_1584 | 117 |
| 144 | 3300049744 | Ga0501083_0001562 | Ga0501083_0001562_5594_5947 | 117 |
| 145 | 3300050489 | nmdc:mga03683_395666_c1 | nmdc:mga03683_395666_c1_37_390 | 117 |
| 146 | 3300050493 | nmdc:mga0k408_15013_c1 | nmdc:mga0k408_15013_c1_1281_1634 | 117 |
| 147 | 3300050493 | nmdc:mga0k408_4639_c1 | nmdc:mga0k408_4639_c1_723_1076 | 117 |
| 148 | 3300050496 | nmdc:mga07m45_608071_c1 | nmdc:mga07m45_608071_c1_16_369 | 117 |
| 149 | 3300050511 | nmdc:mga08y16_6171_c1 | nmdc:mga08y16_6171_c1_4378_4731 | 117 |
| 150 | 3300054114 | Ga0501084_0003199 | Ga0501084_0003199_4910_5263 | 117 |
| 151 | 3300054114 | Ga0501084_0277419 | Ga0501084_0277419_765_1118 | 117 |
| 152 | 3300060353 | Ga0501082_0230504 | Ga0501082_0230504_733_1086 | 117 |
| 153 | 3300002863 | Ga0006769J43182_104888 | Ga0006769J43182_1048882 | 118 |
| 154 | 3300003163 | Ga0006759J45824_1036100 | Ga0006759J45824_10361002 | 118 |
| 155 | 3300003300 | Ga0006758J48902_1010801 | Ga0006758J48902_10108012 | 118 |
| 156 | 3300003305 | Ga0006770J48903_1027098 | Ga0006770J48903_10270982 | 118 |
| 157 | 3300003323 | rootH1_10285841 | rootH1_102858412 | 118 |
| 158 | 3300003693 | Ga0032354_1073388 | Ga0032354_10733882 | 118 |
| 159 | 3300005289 | Ga0065704_10439740 | Ga0065704_104397401 | 118 |
| 160 | 3300005330 | Ga0070690_101289487 | Ga0070690_1012894871 | 118 |
| 161 | 3300005337 | Ga0070682_100043826 | Ga0070682_1000438263 | 118 |
| 162 | 3300005337 | Ga0070682_100157267 | Ga0070682_1001572671 | 118 |
| 163 | 3300005347 | Ga0070668_100272426 | Ga0070668_1002724262 | 118 |
| 164 | 3300005367 | Ga0070667_100988220 | Ga0070667_1009882202 | 118 |
| 165 | 3300005445 | Ga0070708_100494945 | Ga0070708_1004949452 | 118 |
| 166 | 3300005548 | Ga0070665_100014668 | Ga0070665_1000146686 | 118 |
| 167 | 3300005563 | Ga0068855_100000016 | Ga0068855_100000016205 | 118 |
| 168 | 3300005577 | Ga0068857_100534413 | Ga0068857_1005344132 | 118 |
| 169 | 3300005617 | Ga0068859_100206371 | Ga0068859_1002063712 | 118 |
| 170 | 3300005841 | Ga0068863_100275241 | Ga0068863_1002752412 | 118 |
| 171 | 3300005841 | Ga0068863_100890407 | Ga0068863_1008904071 | 118 |
| 172 | 3300005842 | Ga0068858_100032030 | Ga0068858_1000320306 | 118 |
| 173 | 3300005842 | Ga0068858_101937874 | Ga0068858_1019378741 | 118 |
| 174 | 3300005843 | Ga0068860_100095687 | Ga0068860_1000956874 | 118 |
| 175 | 3300006195 | Ga0075366_10162735 | Ga0075366_101627351 | 118 |
| 176 | 3300006195 | Ga0075366_10489864 | Ga0075366_104898642 | 118 |
| 177 | 3300006195 | Ga0075366_10527312 | Ga0075366_105273121 | 118 |
| 178 | 3300006237 | Ga0097621_100031265 | Ga0097621_1000312655 | 118 |
| 179 | 3300006237 | Ga0097621_101334056 | Ga0097621_1013340562 | 118 |
| 180 | 3300006353 | Ga0075370_11031902 | Ga0075370_110319021 | 118 |
| 181 | 3300006931 | Ga0097620_100206375 | Ga0097620_1002063754 | 118 |
| 182 | 3300009177 | Ga0105248_10002908 | Ga0105248_100029085 | 118 |
| 183 | 3300013104 | Ga0157370_10157582 | Ga0157370_101575822 | 118 |
| 184 | 3300013297 | Ga0157378_10880332 | Ga0157378_108803321 | 118 |
| 185 | 3300014325 | Ga0163163_12858080 | Ga0163163_128580801 | 118 |
| 186 | 3300014326 | Ga0157380_10051793 | Ga0157380_100517932 | 118 |
| 187 | 3300022467 | Ga0224712_10223070 | Ga0224712_102230701 | 118 |
| 188 | 3300025941 | Ga0207711_10025827 | Ga0207711_100258275 | 118 |
| 189 | 3300025944 | Ga0207661_11572577 | Ga0207661_115725771 | 118 |
| 190 | 3300025949 | Ga0207667_10000099 | Ga0207667_10000099116 | 118 |
| 191 | 3300025972 | Ga0207668_10254103 | Ga0207668_102541032 | 118 |
| 192 | 3300026035 | Ga0207703_10014079 | Ga0207703_100140796 | 118 |
| 193 | 3300026088 | Ga0207641_10741035 | Ga0207641_107410351 | 118 |
| 194 | 3300027543 | Ga0209999_1044203 | Ga0209999_10442031 | 118 |
| 195 | 3300028379 | Ga0268266_10071209 | Ga0268266_100712096 | 118 |
| 196 | 3300028381 | Ga0268264_10552482 | Ga0268264_105524822 | 118 |
| 197 | 3300028577 | Ga0265318_10025306 | Ga0265318_100253062 | 118 |
| 198 | 3300031238 | Ga0265332_10091329 | Ga0265332_100913292 | 118 |
| 199 | 3300031249 | Ga0265339_10002043 | Ga0265339_100020435 | 118 |
| 200 | 3300031249 | Ga0265339_10053282 | Ga0265339_100532823 | 118 |
| 201 | 3300031250 | Ga0265331_10106717 | Ga0265331_101067173 | 118 |
| 202 | 3300031344 | Ga0265316_10001437 | Ga0265316_100014375 | 118 |
| 203 | 3300031456 | Ga0307513_10600183 | Ga0307513_106001831 | 118 |
| 204 | 3300031595 | Ga0265313_10029780 | Ga0265313_100297803 | 118 |
| 205 | 3300031711 | Ga0265314_10000001 | Ga0265314_100000011055 | 118 |
| 206 | 3300031711 | Ga0265314_10039222 | Ga0265314_100392224 | 118 |
| 207 | 3300031712 | Ga0265342_10491215 | Ga0265342_104912151 | 118 |
| 208 | 3300031730 | Ga0307516_10008910 | Ga0307516_100089105 | 118 |
| 209 | 3300031731 | Ga0307405_10188579 | Ga0307405_101885792 | 118 |
| 210 | 3300031903 | Ga0307407_10918490 | Ga0307407_109184902 | 118 |
| 211 | 3300032005 | Ga0307411_10362195 | Ga0307411_103621952 | 118 |
| 212 | 3300035724 | Ga0373933_0023866 | Ga0373933_0023866_1967_2326 | 118 |
| 213 | 3300037418 | Ga0395900_0174753 | Ga0395900_0174753_304_663 | 118 |
| 214 | 3300037418 | Ga0395900_0954752 | Ga0395900_0954752_309_680 | 118 |
| 215 | 3300037418 | Ga0395900_1686751 | Ga0395900_1686751_162_521 | 118 |
| 216 | 3300037466 | Ga0395898_0183418 | Ga0395898_0183418_1188_1547 | 118 |
| 217 | 3300037471 | Ga0395905_1386223 | Ga0395905_1386223_151_510 | 118 |
| 218 | 3300041441 | Ga0451787_400973 | Ga0451787_400973_573_929 | 118 |
| 219 | 3300041443 | Ga0451789_1118680 | Ga0451789_1118680_134_490 | 118 |
| 220 | 3300041459 | Ga0451800_0504732 | Ga0451800_0504732_92_448 | 118 |
| 221 | 3300041486 | Ga0451807_0330594 | Ga0451807_0330594_108_464 | 118 |
| 222 | 3300041486 | Ga0451807_1748227 | Ga0451807_1748227_657_1070 | 118 |
| 223 | 3300041507 | Ga0451851_0328395 | Ga0451851_0328395_16_375 | 118 |
| 224 | 3300041509 | Ga0451843_1474169 | Ga0451843_1474169_350_706 | 118 |
| 225 | 3300041509 | Ga0451843_1570856 | Ga0451843_1570856_114_470 | 118 |
| 226 | 3300041512 | Ga0451853_0068542 | Ga0451853_0068542_169_531 | 118 |
| 227 | 3300042004 | Ga0439445_0231877 | Ga0439445_0231877_138_494 | 118 |
| 228 | 3300042876 | Ga0451577_0311146 | Ga0451577_0311146_626_988 | 118 |
| 229 | 3300044683 | Ga0466965_0116554 | Ga0466965_0116554_951_1307 | 118 |
| 230 | 3300044684 | Ga0466966_0215391 | Ga0466966_0215391_192_563 | 118 |
| 231 | 3300045976 | Ga0466967_1561462 | Ga0466967_1561462_214_573 | 118 |
| 232 | 3300049128 | Ga0501308_082919 | Ga0501308_082919_138_494 | 118 |
| 233 | 3300049129 | Ga0501309_023175 | Ga0501309_023175_254_610 | 118 |
| 234 | 3300049129 | Ga0501309_050291 | Ga0501309_050291_48_404 | 118 |
| 235 | 3300049129 | Ga0501309_079689 | Ga0501309_079689_73_429 | 118 |
| 236 | 3300049130 | Ga0501310_029678 | Ga0501310_029678_93_449 | 118 |
| 237 | 3300049130 | Ga0501310_039806 | Ga0501310_039806_29_385 | 118 |
| 238 | 3300049161 | Ga0501305_040248 | Ga0501305_040248_137_493 | 118 |
| 239 | 3300049161 | Ga0501305_063318 | Ga0501305_063318_269_625 | 118 |
| 240 | 3300049162 | Ga0501307_060244 | Ga0501307_060244_200_556 | 118 |
| 241 | 3300049528 | Ga0501312_050353 | Ga0501312_050353_94_450 | 118 |
| 242 | 3300049528 | Ga0501312_060552 | Ga0501312_060552_268_624 | 118 |
| 243 | 3300049530 | Ga0501314_022362 | Ga0501314_022362_273_629 | 118 |
| 244 | 3300049531 | Ga0501315_053290 | Ga0501315_053290_14_370 | 118 |
| 245 | 3300049532 | Ga0501316_046049 | Ga0501316_046049_35_391 | 118 |
| 246 | 3300049533 | Ga0501317_053083 | Ga0501317_053083_24_380 | 118 |
| 247 | 3300049534 | Ga0501318_089436 | Ga0501318_089436_37_393 | 118 |
| 248 | 3300049539 | Ga0501323_046699 | Ga0501323_046699_22_378 | 118 |
| 249 | 3300049545 | Ga0501329_07722 | Ga0501329_07722_11_367 | 118 |
| 250 | 3300049549 | Ga0501333_010712 | Ga0501333_010712_269_625 | 118 |
| 251 | 3300049581 | Ga0501047_0081683 | Ga0501047_0081683_2183_2539 | 118 |
| 252 | 3300049583 | Ga0501067_0186086 | Ga0501067_0186086_231_587 | 118 |
| 253 | 3300049584 | Ga0501068_0800992 | Ga0501068_0800992_14_400 | 118 |
| 254 | 3300049586 | Ga0501070_0054220 | Ga0501070_0054220_669_1055 | 118 |
| 255 | 3300049593 | Ga0501077_0011533 | Ga0501077_0011533_3390_3755 | 118 |
| 256 | 3300049679 | Ga0501249_068382 | Ga0501249_068382_460_816 | 118 |
| 257 | 3300049686 | Ga0501257_133377 | Ga0501257_133377_152_508 | 118 |
| 258 | 3300049742 | Ga0501080_1569372 | Ga0501080_1569372_18_374 | 118 |
| 259 | 3300049744 | Ga0501083_0610979 | Ga0501083_0610979_72_458 | 118 |
| 260 | 3300049744 | Ga0501083_0620949 | Ga0501083_0620949_255_611 | 118 |
| 261 | 3300049766 | Ga0501269_038777 | Ga0501269_038777_44_400 | 118 |
| 262 | 3300050490 | nmdc:mga03n38_160389_c1 | nmdc:mga03n38_160389_c1_594_959 | 118 |
| 263 | 3300050490 | nmdc:mga03n38_245229_c1 | nmdc:mga03n38_245229_c1_16_489 | 118 |
| 264 | 3300050493 | nmdc:mga0k408_875340_c1 | nmdc:mga0k408_875340_c1_84_440 | 118 |
| 265 | 3300050496 | nmdc:mga07m45_603184_c1 | nmdc:mga07m45_603184_c1_222_587 | 118 |
| 266 | 3300050507 | nmdc:mga05p37_928419_c1 | nmdc:mga05p37_928419_c1_204_563 | 118 |
| 267 | 3300053088 | Ga0500644_0033460 | Ga0500644_0033460_82_447 | 118 |
| 268 | 3300053139 | Ga0500568_0051971 | Ga0500568_0051971_127_492 | 118 |
| 269 | 3300054114 | Ga0501084_0078925 | Ga0501084_0078925_1730_2086 | 118 |
| 270 | 3300059492 | Ga0587073_0170433 | Ga0587073_0170433_203_592 | 118 |
| 271 | 3300059506 | Ga0587085_159426 | Ga0587085_159426_134_490 | 118 |
| 272 | 3300060353 | Ga0501082_0543255 | Ga0501082_0543255_350_736 | 118 |
| 273 | 3300060353 | Ga0501082_0957583 | Ga0501082_0957583_342_698 | 118 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v48-assembly1.cif.gz_AO | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.878 | 50 | 116 |
| 4v48-assembly1.cif.gz_AO | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.8557 | 50 | 116 |
| 1gyz-assembly1.cif.gz_A | bacterial ribosomal protein l20 from aquifex aeolicus | 0.8347 | 61 | 113 |
| 1gyz-assembly1.cif.gz_A | bacterial ribosomal protein l20 from aquifex aeolicus | 0.7415 | 61 | 113 |
| 7pkt-assembly1.cif.gz_o | large subunit of the chlamydomonas reinhardtii mitoribosome | 0.6827 | 15 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ghjD02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9381 | 53 | 113 | 1.10.1900.20 |
| 2ghjB02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8868 | 58 | 113 | 1.10.1900.20 |
| 1gyzA00 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8347 | 61 | 113 | 1.10.1900.20 |
| 2ghjD02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8226 | 53 | 113 | 1.10.1900.20 |
| 2ghjB02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.752 | 58 | 113 | 1.10.1900.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A081D3S4-F1-model_v4 | deleted | 0.9979 | 60 | 113 |
|
| AF-A0A7G2DR74-F1-model_v4 | Large ribosomal subunit protein bL20c (50S ribosomal protein L20, chloroplastic) | 0.9972 | 58 | 116 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A0E0N241-F1-model_v4 | Large ribosomal subunit protein bL20c | 0.9969 | 58 | 116 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A0E0N240-F1-model_v4 | Large ribosomal subunit protein bL20c | 0.9961 | 58 | 116 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-X8FDF3-F1-model_v4 | deleted | 0.9952 | 61 | 116 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar